MFS transporter

Overview
NameMFS transporter
Smed IDSMED30007257
Length (bp)1427
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MFS transporter (SMED30007257) t-SNE clustered cells

Violin plots show distribution of expression levels for MFS transporter (SMED30007257) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MFS transporter (SMED30007257) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MFS transporter (SMED30007257) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007257

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30007257SMESG000043485.1 Contig3367GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007257SMESG000061394.1 Contig3367GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30007257SMESG000061394.1 dd_Smed_v4_9051_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MFS transporter vs. TrEMBL
Match: A0A0H3YF10 (Slc16a-10 OS=Schmidtea mediterranea OX=79327 GN=slc16a-10 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.365e-19
Identity = 89/318 (27.99%), Postives = 142/318 (44.65%), Query Frame = 3
Query:  321 IITSFT--YHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKKILPCNFILCSNENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRI----LEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISFFPPKIVFMFMCXXXXXXXXXXXXXXQTQK-----------KYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSI 1223
            I+T FT   H +    +YG I G+G G+ Y V + + ++ F +  GL+ G+++SGF +G +  +LI  Y ID    +   +    + +    +G     I L  +  I            R   V + V+ +   +       +++PH+++   +FWI+WI +A+NS  ++L I L ++    LEI    L  +                 S FGRIIWG L   F  KIV        ++++       +  K            Y I V I    +SGNFSI P    K FG  HF  NFG+++T YSF  ++T I
Sbjct:  101 ILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPGLLSGIILSGFGIGSVGFDLIHSYFIDDDITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLI-----------KRPETVEESVNQNNLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEISDLRLLIATCT----------GGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPI 397          
BLAST of MFS transporter vs. TrEMBL
Match: R7RUU4 (Major facilitator:Oxalate:Formate Antiporter OS=Thermobrachium celere DSM 8682 OX=941824 GN=TCEL_02326 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.847e-14
Identity = 86/333 (25.83%), Postives = 147/333 (44.14%), Query Frame = 3
Query:  327 TSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKKILPCNFILCSNENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQL-----HRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISFFPPKIVFMFMCXXXXXXXXXXXXXXQTQKKYEIIVSICCGWLS--GNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSIFLEEMGQHLRMTMNFFGSMSILSFILL 1304
            +SF+ + +    TYG + G G G+ Y V + V S+ F    GL LG+++SGF + P +   I+K LID+            +    + LG+  ++I +  S   LP  F    NEN      D+                + P +ML    F+ILW  FA+ +F  ++II +       I+ I    ++F  ++ S  N            GR ++G L     P  V + + +       +S+ FF   K +  ++S    W++  G  SI P    K FGP +++ N+GI++T+Y    IL ++          +  + FGS   +S+ +L
Sbjct:   89 SSFSKNIVMLTITYGVVAGSGVGIAYGVPIGVVSRWFPDKKGLALGILLSGFGMSPFVTAPIAKKLIDMYG----------VFTSFKLLGIIFLFILIVLS---LPFKF---PNENVKTNTEDY--------------NSLSPTEMLKDRKFYILWTCFAIATFVGLMIIGITGPMGEDIIGIPSTTMAFYVSLFSIFNG----------IGRPLFGYLSDKLGPSKVIL-LSYTLISFATLSILFFNNAKTFLFVLSFVIFWMNFGGWLSIAPTLTSKFFGPKYYSENYGIVFTAYGIGAILGNL-------TSGLAKDLFGSYKFVSYPIL 373          
BLAST of MFS transporter vs. TrEMBL
Match: A0A1S3HKS6 (uncharacterized protein LOC106155360 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106155360 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.493e-14
Identity = 84/356 (23.60%), Postives = 148/356 (41.57%), Query Frame = 3
Query:  348 LWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKD----------RSKIFIICP--MILLGIQWLGVFLIWIALKYSKKILPCNFILCSNENRFIQVSDFVDDHIS--EVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFF---GRIIWGALISFFPPKIVFMFMCXXXXXXXXXXXXXXQTQK-KYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSIFLEEMGQHLRMTMNFF-----GSMSILSFILLFIYREKSGQLGKGI 1346
            L  + TYG + G+G G+ Y+ CLA + K F    GL+ G++V+GF  G  + N +    I+  +            K+    P   ++LG  ++ +  + I + ++             +   +   D  D  +   +    N   D  P +M+   +F+ILW +F +N    I    L++         ++ Q    +        ++ + F   GRI WG +   F  K   + +C     +    +      K  + I V +  G  SGNFS+ P    K FG  H A N+G+++TS   A  L +   +++   L +   FF        S +S IL F++  K+ + GK I
Sbjct:  124 LLTLLTYGIMFGLGVGMAYAPCLANSMKWFPDHKGLVNGLVVAGFGGGAFIFNQVQTAYINPHNLPVNSARYFTEKKLLERVPSCFLVLGGSYVAMQFVGILILFAPPEAHSRRASIQEDESALLPEDRSDSDVDYKKKMAPNIARDYYPKQMIRSKYFYILWFIFLLNGQAVIFSSSLYK---------AYGQTFIKDDQFLAIVGAFAAVFNAGGRIFWGVIADKFSFKTAMLCLCTSMCALMMTFIIAPLGGKVMFFIWVCLIFGTFSGNFSLFPTATAKAFGAKHVAVNYGLLFTSQVIAPPLGAFLTQQL---LHLIGWFFMFCIVAGCSFISLILTFLFNVKTRE-GKDI 466          
BLAST of MFS transporter vs. TrEMBL
Match: A0A2T7ND92 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_21703 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.529e-13
Identity = 78/334 (23.35%), Postives = 146/334 (43.71%), Query Frame = 3
Query:  354 AIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIIC--------------PMILL-------GIQWLGVFLIWIALKYSKKILPCNFILCSNENRFIQVSDFV--------DDHISEVPVINGVTD-VEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSY---CSFFGRIIWGALISFFPPKIVFMFM-CXXXXXXXXXXXXXXQTQKKYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSY----SFAGILTSIFLEEMG 1241
            A+ TYG + G+G G+ Y+V +A   +   +  GL+ G +V+GF  G  + + +    I+  +++    I               P I L        +Q LGVF      K S ++L        +++      D          D  IS   + +  T+ + P +ML    F+ LW +  +N  G + I  L++         ++ Q    N +   +  ++   C+  GRIIWGA+   F  K+  + M C  +S++    ++    +  + I V +     SG +S++P    + FGP +++ N+GI++TS     +   +LTS   +++G
Sbjct:  107 AVVTYGLMFGLGIGVAYAVPIACGMRWLPKKKGLVSGCVVAGFGAGAFIFDQVQTAFINPDNKAPNETIAGEKYFSQEDVLERVPTIFLLLGGCYAAMQLLGVF---APFKSSSRLLQDTSSPGDSKHSNDHTEDTASVGSNSDNDSGISSRTIQDEETESMPPQRMLKTRAFYTLWFIMLLNGQGVVFISSLYK---------AYGQTFIRNDSYMAWVGAFAAVCNGGGRIIWGAVADRFSFKVAMLCMSCTFTSLMLTFGLTKLGAEAMFFIWVCLLFFGFSGTYSLLPTATARAFGPKYYSMNYGIVFTSQIISNATGALLTSQLKDQIG 428          
BLAST of MFS transporter vs. TrEMBL
Match: A0A4Y7S0H5 (Putative MFS-type transporter YhjX OS=Pelotomaculum sp. FP OX=261474 GN=yhjX_2 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.031e-12
Identity = 81/347 (23.34%), Postives = 153/347 (44.09%), Query Frame = 3
Query:  321 IITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKKILPCNFILCSNENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQ-----LHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISFFP--PKIVFMFMCXXXXXXXXXXXXXXQTQKKYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSIFLEEM-GQHLRMTMNFF--GSMSILSFILLFIYREKSGQ 1331
            ++  F+    W   +YG I G+G G+IYS  +A T K F    GL+ G+  +G+  G I++  I+  +I     + + I+     LGI ++ +  ++             FI  + +N   +   +     +    ++GV D   ++ML    F++L+++    +F  ++II      +  + ++ P   +   ++ +  N           FGRI WGA+       P ++ M++  G++ +   S++ + T     + V  C G   G   I P      FGP +   N+GIM+  ++ AG L  I    +   +   TM F    SMSI+  +L  I + K+ +
Sbjct:   88 LLAGFSTSVSWLYMSYGVIMGLGMGIIYSCTVANTVKFFPDKRGLVAGLATAGYGCGSIIVPPIANSMI-----ASMGILNTFKTLGIAYIVIIAVF-----------SFFIQKAPDNY--KPEGWNPPAPTATSTVSGV-DKNWNQMLSDPMFYVLFVMLTAGAFSGLMIISQASPIIQEVTKVTPAAAAVGVSLLAMANT----------FGRIFWGAVSDKIGRYPALIIMYIIAGAATLSLSSIASYGTFVAAIMFVGFCFG---GTMGIFPALTADMFGPKNNGVNYGIMFCGFALAGYLGPILAASIKASNGNYTMAFMIAASMSIIGVVLTLIVQNKNKK 402          
BLAST of MFS transporter vs. Planmine SMEST
Match: SMESG000061394.1 (SMESG000061394.1)

HSP 1 Score: 673.7 bits (1737), Expect = 0.000e+0
Identity = 349/350 (99.71%), Postives = 349/350 (99.71%), Query Frame = 3
Query:  321 IITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKKILPCNFILCSNENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISFFPPKIVFMFMCXXXXXXXXXXXXXXQTQKKYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSIFLEEMGQHLRMTMNFFGSMSILSFILLFIYREKSGQLGKGIFDNFKFSY 1370
            IITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKKILPCNFILCSNENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISF PPKIVFMFMCFGSSVIYFVSVSFFQTQKKYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSIFLEEMGQHLRMTMNFFGSMSILSFILLFIYREKSGQLGKGIFDNFKFSY
Sbjct:   91 IITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKKILPCNFILCSNENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISFLPPKIVFMFMCFGSSVIYFVSVSFFQTQKKYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSIFLEEMGQHLRMTMNFFGSMSILSFILLFIYREKSGQLGKGIFDNFKFSY 440          

HSP 2 Score: 96.6709 bits (239), Expect = 2.538e-21
Identity = 74/89 (83.15%), Postives = 76/89 (85.39%), Query Frame = 2
Query:   83 MSKKVSVCQLSSVIGSFLIQLTLGGAYAY---------KNVTQNIHKAQFIXXXXXXXXXXXXXXXXXXETSFNPCLIILTGSFIMKIN 322
            MS KVSVCQLSSVIGSFLIQLTLGGAYAY         +NVTQNI KAQFIFGVGMFGLSSSMGFGGYMETSFNPCLIILTGSFIM + 
Sbjct:    1 MSIKVSVCQLSSVIGSFLIQLTLGGAYAYNEFSYYFATENVTQNIQKAQFIFGVGMFGLSSSMGFGGYMETSFNPCLIILTGSFIMNLG 89          
BLAST of MFS transporter vs. Planmine SMEST
Match: SMESG000061394.1 (SMESG000061394.1)

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 349/350 (99.71%), Postives = 349/350 (99.71%), Query Frame = 3
Query:  321 IITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKKILPCNFILCSNENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISFFPPKIVFMFMCXXXXXXXXXXXXXXQTQKKYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSIFLEEMGQHLRMTMNFFGSMSILSFILLFIYREKSGQLGKGIFDNFKFSY 1370
            IITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKKILPCNFILCSNENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISF PPKIVFMFMCFGSSVIYFVSVSFFQTQKKYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSIFLEEMGQHLRMTMNFFGSMSILSFILLFIYREKSGQLGKGIFDNFKFSY
Sbjct:   93 IITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKKILPCNFILCSNENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISFLPPKIVFMFMCFGSSVIYFVSVSFFQTQKKYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSIFLEEMGQHLRMTMNFFGSMSILSFILLFIYREKSGQLGKGIFDNFKFSY 442          

HSP 2 Score: 100.138 bits (248), Expect = 1.518e-22
Identity = 76/91 (83.52%), Postives = 78/91 (85.71%), Query Frame = 2
Query:   77 MSMSKKVSVCQLSSVIGSFLIQLTLGGAYAY---------KNVTQNIHKAQFIXXXXXXXXXXXXXXXXXXETSFNPCLIILTGSFIMKIN 322
            MSMS KVSVCQLSSVIGSFLIQLTLGGAYAY         +NVTQNI KAQFIFGVGMFGLSSSMGFGGYMETSFNPCLIILTGSFIM + 
Sbjct:    1 MSMSIKVSVCQLSSVIGSFLIQLTLGGAYAYNEFSYYFATENVTQNIQKAQFIFGVGMFGLSSSMGFGGYMETSFNPCLIILTGSFIMNLG 91          
BLAST of MFS transporter vs. Planmine SMEST
Match: SMESG000061394.1 (SMESG000061394.1)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 338/350 (96.57%), Postives = 338/350 (96.57%), Query Frame = 3
Query:  321 IITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKKILPCNFILCSNENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISFFPPKIVFMFMCXXXXXXXXXXXXXXQTQKKYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSIFLEEMGQHLRMTMNFFGSMSILSFILLFIYREKSGQLGKGIFDNFKFSY 1370
            IITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKK           ENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISF PPKIVFMFMCFGSSVIYFVSVSFFQTQKKYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSIFLEEMGQHLRMTMNFFGSMSILSFILLFIYREKSGQLGKGIFDNFKFSY
Sbjct:   91 IITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKK-----------ENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISFLPPKIVFMFMCFGSSVIYFVSVSFFQTQKKYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSIFLEEMGQHLRMTMNFFGSMSILSFILLFIYREKSGQLGKGIFDNFKFSY 429          

HSP 2 Score: 96.6709 bits (239), Expect = 1.767e-21
Identity = 74/89 (83.15%), Postives = 76/89 (85.39%), Query Frame = 2
Query:   83 MSKKVSVCQLSSVIGSFLIQLTLGGAYAY---------KNVTQNIHKAQFIXXXXXXXXXXXXXXXXXXETSFNPCLIILTGSFIMKIN 322
            MS KVSVCQLSSVIGSFLIQLTLGGAYAY         +NVTQNI KAQFIFGVGMFGLSSSMGFGGYMETSFNPCLIILTGSFIM + 
Sbjct:    1 MSIKVSVCQLSSVIGSFLIQLTLGGAYAYNEFSYYFATENVTQNIQKAQFIFGVGMFGLSSSMGFGGYMETSFNPCLIILTGSFIMNLG 89          
BLAST of MFS transporter vs. Planmine SMEST
Match: SMESG000061394.1 (SMESG000061394.1)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 338/350 (96.57%), Postives = 338/350 (96.57%), Query Frame = 3
Query:  321 IITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKKILPCNFILCSNENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISFFPPKIVFMFMCXXXXXXXXXXXXXXQTQKKYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSIFLEEMGQHLRMTMNFFGSMSILSFILLFIYREKSGQLGKGIFDNFKFSY 1370
            IITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKK           ENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISF PPKIVFMFMCFGSSVIYFVSVSFFQTQKKYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSIFLEEMGQHLRMTMNFFGSMSILSFILLFIYREKSGQLGKGIFDNFKFSY
Sbjct:   93 IITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKK-----------ENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISFLPPKIVFMFMCFGSSVIYFVSVSFFQTQKKYEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTSIFLEEMGQHLRMTMNFFGSMSILSFILLFIYREKSGQLGKGIFDNFKFSY 431          

HSP 2 Score: 100.523 bits (249), Expect = 1.118e-22
Identity = 76/91 (83.52%), Postives = 78/91 (85.71%), Query Frame = 2
Query:   77 MSMSKKVSVCQLSSVIGSFLIQLTLGGAYAY---------KNVTQNIHKAQFIXXXXXXXXXXXXXXXXXXETSFNPCLIILTGSFIMKIN 322
            MSMS KVSVCQLSSVIGSFLIQLTLGGAYAY         +NVTQNI KAQFIFGVGMFGLSSSMGFGGYMETSFNPCLIILTGSFIM + 
Sbjct:    1 MSMSIKVSVCQLSSVIGSFLIQLTLGGAYAYNEFSYYFATENVTQNIQKAQFIFGVGMFGLSSSMGFGGYMETSFNPCLIILTGSFIMNLG 91          
BLAST of MFS transporter vs. Planmine SMEST
Match: SMESG000061401.1 (SMESG000061401.1)

HSP 1 Score: 127.102 bits (318), Expect = 5.434e-32
Identity = 100/303 (33.00%), Postives = 154/303 (50.83%), Query Frame = 3
Query:  321 IITSFTYHTLWAIATYGFICGVGAGLIYSVCLAVTSKLFTRFTGLILGVMVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIALKYSKKILPCNFILCSNENRFIQVSDFVDDHISEVPVINGVTDVEPHKMLVQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYLYGNSYCSFFGRIIWGALISFFPPKIVFMFMCXXXXXXXXXXXXXXQTQKKYE---IIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILTS 1220
            IIT+F   + W + TYGFICG GAGL++SV LA   + F  +    L +++SGFS G +L+    +++        IF I  +    IQ +G+ L+    K S +I          E   + ++D   D            D++PH M++++ FWI+W++F +N+FG++ I    R+   I   +S  QN  S     +Y  S     G+ IWG        K VF     GSS +Y + +  +Q  + YE    ++     W +G   IIP  ++KRFG  +FA N+GI WT+Y+FAGILTS
Sbjct:   97 IITTFVAKSRWYLFTYGFICGSGAGLMFSVSLATACQWFKFYKSFGLSIVLSGFSFGKLLVQFTIRFM---NPSWSIFSIIGIEFFIIQIIGLILMQTPKKDSSEI----------EKLLLSINDSDQD-----------LDIQPHIMIMEFDFWIIWLIFYLNAFGSLFI----RLQYQIYSSISNEQNGLS-----IYIISLFIVIGQGIWGISSDRLSMKTVFCTFALGSSFMYGILLLLYQQIETYEYFYYMIYPSQFWQNGIMVIIPGLIVKRFGQKYFAINYGITWTAYTFAGILTS 366          
The following BLAST results are available for this feature:
BLAST of MFS transporter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF101.365e-1927.99Slc16a-10 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
R7RUU44.847e-1425.83Major facilitator:Oxalate:Formate Antiporter OS=Th... [more]
A0A1S3HKS66.493e-1423.60uncharacterized protein LOC106155360 isoform X1 OS... [more]
A0A2T7ND921.529e-1323.35Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A4Y7S0H51.031e-1223.34Putative MFS-type transporter YhjX OS=Pelotomaculu... [more]
back to top
BLAST of MFS transporter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS transporter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061394.12.538e-2199.71SMESG000061394.1[more]
SMESG000061394.11.518e-2299.71SMESG000061394.1[more]
SMESG000061394.11.767e-2196.57SMESG000061394.1[more]
SMESG000061394.11.118e-2296.57SMESG000061394.1[more]
SMESG000061401.15.434e-3233.00SMESG000061401.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007257 ID=SMED30007257|Name=MFS transporter|organism=Schmidtea mediterranea sexual|type=transcript|length=1427bp
CCGATCTATTTTTTTATATTTTAATTATTTTTGAAAATTTGTAGGAATAT
ATTTATTCACATCGATTCGGGTTCCTATGTCCATGAGTAAAAAAGTTAGT
GTATGTCAGCTTTCTTCAGTAATTGGAAGTTTTCTCATTCAACTAACATT
AGGTGGAGCATATGCTTACAAAAATGTAACTCAAAATATTCACAAGGCAC
AATTCATATTTGGAGTTGGAATGTTTGGATTAAGTTCTTCAATGGGGTTT
GGTGGTTATATGGAAACCTCATTCAATCCCTGTCTTATTATTCTGACAGG
AAGTTTTATTATGAAGATTAATTATCACTTCTTTTACATATCATACCTTG
TGGGCTATTGCAACTTATGGGTTTATCTGTGGTGTTGGTGCTGGATTAAT
CTACTCAGTTTGCTTGGCAGTTACTTCTAAGTTGTTTACTCGTTTTACTG
GATTAATATTAGGTGTAATGGTGTCCGGATTTTCGCTTGGTCCTATTTTA
ATTAATCTAATTTCAAAATATTTAATTGATGTAAAGGATCGTTCAAAAAT
ATTTATTATCTGTCCAATGATATTGCTGGGAATCCAATGGTTAGGAGTGT
TTTTAATCTGGATCGCACTGAAATATTCTAAAAAAATATTGCCGTGTAAT
TTTATATTATGCTCAAATGAAAACCGCTTTATTCAAGTATCTGACTTTGT
TGATGATCATATCAGTGAGGTACCAGTTATAAATGGAGTCACAGATGTTG
AGCCACATAAAATGCTTGTACAGTATCATTTTTGGATTCTTTGGATTGTC
TTTGCTATGAACTCTTTTGGTACGATTTTAATAATTCAACTTCACCGAAT
TTTAGAAATTATTCCGTGCGGCCTATCATTTTCTCAAAATATTACATCTA
ATCACAATGAATATCTTTATGGCAATTCATATTGTAGTTTTTTTGGTAGA
ATCATTTGGGGAGCACTCATCTCTTTTTTTCCACCGAAGATTGTTTTTAT
GTTTATGTGTTTTGGTTCATCTGTAATTTACTTCGTTTCTGTGTCTTTCT
TTCAAACTCAAAAAAAATATGAAATAATTGTTTCAATTTGCTGTGGTTGG
CTATCTGGAAATTTTTCTATTATTCCTTTATTTGTTTTAAAACGATTTGG
CCCTAATCATTTCGCCTCAAATTTTGGAATTATGTGGACATCTTATTCAT
TTGCTGGAATATTAACCAGTATTTTTCTTGAAGAGATGGGACAACATTTA
CGCATGACAATGAATTTCTTTGGCTCTATGTCAATTTTGTCTTTTATTTT
GTTATTTATTTATCGAGAAAAATCAGGACAACTTGGAAAAGGAATTTTCG
ATAACTTTAAATTTTCTTACTGAATTAAAAATTTAATTGTTTGAAATTCG
ATTTTTTAAATTATAAAAATTTTCAAC
back to top

protein sequence of SMED30007257-orf-1

>SMED30007257-orf-1 ID=SMED30007257-orf-1|Name=SMED30007257-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=302bp
MVSGFSLGPILINLISKYLIDVKDRSKIFIICPMILLGIQWLGVFLIWIA
LKYSKKILPCNFILCSNENRFIQVSDFVDDHISEVPVINGVTDVEPHKML
VQYHFWILWIVFAMNSFGTILIIQLHRILEIIPCGLSFSQNITSNHNEYL
YGNSYCSFFGRIIWGALISFFPPKIVFMFMCFGSSVIYFVSVSFFQTQKK
YEIIVSICCGWLSGNFSIIPLFVLKRFGPNHFASNFGIMWTSYSFAGILT
SIFLEEMGQHLRMTMNFFGSMSILSFILLFIYREKSGQLGKGIFDNFKFS
Y*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR11360:SF3OXALATE/FORMATE ANTIPORTERcoord: 2..283
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 2..283
NoneNo IPR availableCDDcd17353MFS_OFA_likecoord: 2..281
e-value: 1.82916E-15
score: 73.7984
NoneNo IPR availableTMHMMTMhelixcoord: 175..194
NoneNo IPR availableTMHMMTMhelixcoord: 265..282
NoneNo IPR availableTMHMMTMhelixcoord: 106..128
NoneNo IPR availableTMHMMTMhelixcoord: 28..50
NoneNo IPR availableTMHMMTMhelixcoord: 201..223
NoneNo IPR availableTMHMMTMhelixcoord: 149..171
NoneNo IPR availableTMHMMTMhelixcoord: 236..253
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 2..284