28S ribosomal protein S30, mitochondrial

Overview
Name28S ribosomal protein S30, mitochondrial
Smed IDSMED30007235
Length (bp)1850
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 28S ribosomal protein S30, mitochondrial (SMED30007235) t-SNE clustered cells

Violin plots show distribution of expression levels for 28S ribosomal protein S30, mitochondrial (SMED30007235) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 28S ribosomal protein S30, mitochondrial (SMED30007235) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 28S ribosomal protein S30, mitochondrial (SMED30007235) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007235

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30007235h1SMcG0015736 SmedASXL_006447SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30007235h1SMcG0015736 SmedASXL_006447SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30007235h1SMcG0015736 dd_Smed_v4_8469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007235h1SMcG0015736 dd_Smed_v4_8469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007235h1SMcG0015736 Contig48429uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007235h1SMcG0015736 Contig48429newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Human
Match: MRPS30 (mitochondrial ribosomal protein S30 [Source:HGNC Symbol;Acc:HGNC:8769])

HSP 1 Score: 55.4546 bits (132), Expect = 2.153e-7
Identity = 40/146 (27.40%), Postives = 70/146 (47.95%), Query Frame = 1
Query: 1030 NHI----RTGDPC--GFSVLGVINTNLS-QRVLLDFSRDHPGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFKLNESSQIDQVNEHALHQLL 1446
            NHI    +T DPC  G +   ++   L  +R+L     D   +V R   + A+ + F WT AQA  QGF    ++T P  +  ++TDG  F    +QLN+++   +   +    N+ W +    L++  E + +   N+  L Q++
Sbjct:  280 NHIFVGSKTADPCCYGHTQFHLLPDKLRRERLLRQNCADQIEVVFR---ANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIV 422          
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Fly
Match: mRpS30 (gene:FBgn0030692 transcript:FBtr0346193)

HSP 1 Score: 67.0106 bits (162), Expect = 2.622e-11
Identity = 63/250 (25.20%), Postives = 110/250 (44.00%), Query Frame = 1
Query:  769 KSAEGCIQYRMRAELAWQLRSRDPLKEFVNKADSLFVDDGSQFPIYNYHPKTFDMESKDFYFFQNVPFAYSRVSSEYLRNIPGFWGTNHIRTGDPCGFSVLGVIN-TNLSQRVLLDFSRDHPGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLF-KLNESSQIDQVNEHALHQLLA-AMSLPRSTMTTEELQPYLKT 1509
            +S +  +QY     LA  LR R  L  +  +A+S  ++   Q P + + P+T    +K                 ++  N+PG+W       G+   F +L   +  +L  R      +D    +H    S A+ +S+ W +AQA   GF  Y+ELTYP+ T  ++T+G  +    +QLN++            VN    + P  L+ +++ S +    N++AL  LL    + P    +  E QPY+ +
Sbjct:  238 ESVDRMVQYTGAPYLA--LRHRKQLTPWKTEAESENLELSKQLPRFKHDPRTLGYSTK----------------HQHATNVPGYWPK-----GNENNFGLLSFQSRAHLQIRPKSFGEQDQLEALH----SLAIKSSYAWLLAQANYNGFNTYNELTYPMNTQTVITNGREWSFYEYQLNTLLLHGTNVAENPRVNFCRGTKPLPLYAEISASGKCVDFNDNALRHLLNFYANAPSIQRSIGEQQPYVAS 460          
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Fly
Match: mRpS30 (gene:FBgn0030692 transcript:FBtr0074094)

HSP 1 Score: 67.0106 bits (162), Expect = 2.622e-11
Identity = 63/250 (25.20%), Postives = 110/250 (44.00%), Query Frame = 1
Query:  769 KSAEGCIQYRMRAELAWQLRSRDPLKEFVNKADSLFVDDGSQFPIYNYHPKTFDMESKDFYFFQNVPFAYSRVSSEYLRNIPGFWGTNHIRTGDPCGFSVLGVIN-TNLSQRVLLDFSRDHPGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLF-KLNESSQIDQVNEHALHQLLA-AMSLPRSTMTTEELQPYLKT 1509
            +S +  +QY     LA  LR R  L  +  +A+S  ++   Q P + + P+T    +K                 ++  N+PG+W       G+   F +L   +  +L  R      +D    +H    S A+ +S+ W +AQA   GF  Y+ELTYP+ T  ++T+G  +    +QLN++            VN    + P  L+ +++ S +    N++AL  LL    + P    +  E QPY+ +
Sbjct:  238 ESVDRMVQYTGAPYLA--LRHRKQLTPWKTEAESENLELSKQLPRFKHDPRTLGYSTK----------------HQHATNVPGYWPK-----GNENNFGLLSFQSRAHLQIRPKSFGEQDQLEALH----SLAIKSSYAWLLAQANYNGFNTYNELTYPMNTQTVITNGREWSFYEYQLNTLLLHGTNVAENPRVNFCRGTKPLPLYAEISASGKCVDFNDNALRHLLNFYANAPSIQRSIGEQQPYVAS 460          
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Mouse
Match: Mrps30 (mitochondrial ribosomal protein S30 [Source:MGI Symbol;Acc:MGI:1926237])

HSP 1 Score: 53.9138 bits (128), Expect = 4.584e-7
Identity = 35/138 (25.36%), Postives = 66/138 (47.83%), Query Frame = 1
Query: 1039 RTGDPC--GFSVLGVINTNLSQRVLLDFSRDHPGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFKLNESSQIDQVNEHALHQLL 1446
            +T DPC  G +   +I   L +  L+   ++    V   + + A+ + F WT AQA  QGF    ++T P  +  ++TDG  F    +QLN+++   +   +    N+ W S    L++  E + +   ++  L Q++
Sbjct:  281 KTADPCCYGHTQFHLIPDRLKRERLI--RQNQAEQVEAVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTVQADQNNPRKNLCWGSQSQPLYETVEDNDVKGFDDGTLLQIV 416          
BLAST of 28S ribosomal protein S30, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9NP92|RT30_HUMAN (39S ribosomal protein S30, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS30 PE=1 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 1.034e-6
Identity = 40/146 (27.40%), Postives = 70/146 (47.95%), Query Frame = 1
Query: 1030 NHI----RTGDPC--GFSVLGVINTNLS-QRVLLDFSRDHPGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFKLNESSQIDQVNEHALHQLL 1446
            NHI    +T DPC  G +   ++   L  +R+L     D   +V R   + A+ + F WT AQA  QGF    ++T P  +  ++TDG  F    +QLN+++   +   +    N+ W +    L++  E + +   N+  L Q++
Sbjct:  280 NHIFVGSKTADPCCYGHTQFHLLPDKLRRERLLRQNCADQIEVVFR---ANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIV 422          
BLAST of 28S ribosomal protein S30, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9D0G0|RT30_MOUSE (28S ribosomal protein S30, mitochondrial OS=Mus musculus OX=10090 GN=Mrps30 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.207e-6
Identity = 35/138 (25.36%), Postives = 66/138 (47.83%), Query Frame = 1
Query: 1039 RTGDPC--GFSVLGVINTNLSQRVLLDFSRDHPGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFKLNESSQIDQVNEHALHQLL 1446
            +T DPC  G +   +I   L +  L+   ++    V   + + A+ + F WT AQA  QGF    ++T P  +  ++TDG  F    +QLN+++   +   +    N+ W S    L++  E + +   ++  L Q++
Sbjct:  281 KTADPCCYGHTQFHLIPDRLKRERLI--RQNQAEQVEAVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTVQADQNNPRKNLCWGSQSQPLYETVEDNDVKGFDDGTLLQIV 416          
BLAST of 28S ribosomal protein S30, mitochondrial vs. TrEMBL
Match: A0A4Z2DQ63 (28S ribosomal mitochondrial isoform 4 OS=Schistosoma japonicum OX=6182 GN=EWB00_010006 PE=4 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.676e-69
Identity = 198/650 (30.46%), Postives = 313/650 (48.15%), Query Frame = 1
Query:   97 RHYNLSSILLSRRPPNYLSKLRSKTFPFFQL-YYDTDMAGPHKVVVDRLTHYPP---GNWGSMPISDCWKRYDEIIHLQSIPSYFDKLISMSWTEYNMYYHTLDVPMRFPETLEFAQFLTRTKIAYSIPDSVKDSFNDISGDSIKSASEFLKFHVDNYFSQNRPYLTSY-------DAEGHKSRSN---DFVIQLMDSIMR---SKYNKEIFENYTTA--PTSKIETFIKR-------SCYDELK------VVEHIKSAEGCIQYRMRAELAWQLRSRDPLKEFVNKADSLFVDDGSQFP----IYNYHPKTFDMESKDFYFFQNVPFAYSRVSSEYLRNIPGFWGTNHIRTGDPCGFSVLGVINTNLSQ--RVLLDFS----RDHPGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFKLNESSQID---QVNEHALHQLLAAMSLPRSTMTTEE-LQPYLK-TPAPRD-----------IGPSIIDFH------------PETATXXXXXXXXXXXXXXPLKPFS--KHHPNFLFYFDKLMTSDMNSRFRKIVPTAQN----VPDFIDKKMELYHLKKSQEIGKKKLMKYPTKWR 1818
            R+ + S++L  +   + L   R+   PF  L +YD   A       D L   P    G WGS        R+    HL++IP+ FDKL  + + E NM++H++D+P++ PE LEF+QF+TRTK+    P+S     ND +          L  +++  FS+    + S           G  SR++     +  +M+++ R   S   + + +  +T     + IE F+KR        C +++       V E I  +E CI YR+R+ELAWQLR   PLK   N      ++D   FP    + NY P+ FD++  + Y F  +PFA +   +E+ R I G+W       GDPC F +LGV++ N S+  R  +++S         ++ R+ ++E +  +F W  AQA NQGFT+Y+ELTYPIC  ++L DG   Q++ FQLNSI+SLWK +DS LP N+ W SP   L  L  +S+ +    +N+ A+  L +AM  P   +T  E L+PYL    APR            I  S  D H             E   +      +     KPL+ F+  + HPN +F+F     S +    ++ +P        +P+  + K++ Y + K     + ++   P +WR
Sbjct:   17 RYISSSTVLFKQPSRDRLRSKRANPPPFHSLPFYDEAPA-------DSLPSKPVNVVGQWGSTNSKTKKLRFLHGEHLKTIPTLFDKLQELYYLEDNMWFHSIDIPLQHPEMLEFSQFVTRTKLIPWGPES-----NDTNS--------ILLNYLNYLFSEELESVNSMPVNILDQSVNGFNSRADCRRKKISMIMETVYRAFLSTGTESLVDELSTQIDERATIEMFLKRLVDNEVFECTEKVNEDIYEPVNETIFDSESCIHYRIRSELAWQLRGPFPLKPLFN------LNDPICFPEKPIVCNYRPEAFDLQLVECYNFNCLPFARTIDFTEFARPIAGYWSRTPFWEGDPCEFGLLGVLDLNRSECVRNAINYSSLPDNVKSNVLMRHGIAEGIFTAFAWASAQAYNQGFTLYNELTYPICVQLILMDGNHIQLLRFQLNSITSLWKAEDSMLPYNLAWYSPRVELCILQSNSESNTSLSINKEAISLLTSAMLYPVDKITPSEFLRPYLADEAAPRSYLINKSSDKHLIPSSEEDKHHAKYGDLARSELSELEKKALESTAEMNKTKKPLRLFTSKRPHPNDIFFFKLTDKSTLVDEIKETMPDFGGPFGRLPEPYESKVKEYRMYKRSCQPRLRVQPPPRRWR 640          
BLAST of 28S ribosomal protein S30, mitochondrial vs. TrEMBL
Match: A0A4Z2DQG3 (28S ribosomal mitochondrial isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_010006 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 6.510e-69
Identity = 175/522 (33.52%), Postives = 269/522 (51.53%), Query Frame = 1
Query:   97 RHYNLSSILLSRRPPNYLSKLRSKTFPFFQL-YYDTDMAGPHKVVVDRLTHYPP---GNWGSMPISDCWKRYDEIIHLQSIPSYFDKLISMSWTEYNMYYHTLDVPMRFPETLEFAQFLTRTKIAYSIPDSVKDSFNDISGDSIKSASEFLKFHVDNYFSQNRPYLTSY-------DAEGHKSRSN---DFVIQLMDSIMR---SKYNKEIFENYTTA--PTSKIETFIKR-------SCYDELK------VVEHIKSAEGCIQYRMRAELAWQLRSRDPLKEFVNKADSLFVDDGSQFP----IYNYHPKTFDMESKDFYFFQNVPFAYSRVSSEYLRNIPGFWGTNHIRTGDPCGFSVLGVINTNLSQ--RVLLDFS----RDHPGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFKLNESSQID---QVNEHALHQLLAAMSLPRSTMTTEE-LQPYLK-TPAPR 1521
            R+ + S++L  +   + L   R+   PF  L +YD   A       D L   P    G WGS        R+    HL++IP+ FDKL  + + E NM++H++D+P++ PE LEF+QF+TRTK+    P+S     ND +          L  +++  FS+    + S           G  SR++     +  +M+++ R   S   + + +  +T     + IE F+KR        C +++       V E I  +E CI YR+R+ELAWQLR   PLK   N      ++D   FP    + NY P+ FD++  + Y F  +PFA +   +E+ R I G+W       GDPC F +LGV++ N S+  R  +++S         ++ R+ ++E +  +F W  AQA NQGFT+Y+ELTYPIC  ++L DG   Q++ FQLNSI+SLWK +DS LP N+ W SP   L  L  +S+ +    +N+ A+  L +AM  P   +T  E L+PYL    APR
Sbjct:   17 RYISSSTVLFKQPSRDRLRSKRANPPPFHSLPFYDEAPA-------DSLPSKPVNVVGQWGSTNSKTKKLRFLHGEHLKTIPTLFDKLQELYYLEDNMWFHSIDIPLQHPEMLEFSQFVTRTKLIPWGPES-----NDTNS--------ILLNYLNYLFSEELESVNSMPVNILDQSVNGFNSRADCRRKKISMIMETVYRAFLSTGTESLVDELSTQIDERATIEMFLKRLVDNEVFECTEKVNEDIYEPVNETIFDSESCIHYRIRSELAWQLRGPFPLKPLFN------LNDPICFPEKPIVCNYRPEAFDLQLVECYNFNCLPFARTIDFTEFARPIAGYWSRTPFWEGDPCEFGLLGVLDLNRSECVRNAINYSSLPDNVKSNVLMRHGIAEGIFTAFAWASAQAYNQGFTLYNELTYPICVQLILMDGNHIQLLRFQLNSITSLWKAEDSMLPYNLAWYSPRVELCILQSNSESNTSLSINKEAISLLTSAMLYPVDKITPSEFLRPYLADEAAPR 512          
BLAST of 28S ribosomal protein S30, mitochondrial vs. TrEMBL
Match: A0A0X3P0C7 (28S ribosomal protein S30 OS=Schistocephalus solidus OX=70667 GN=RT30 PE=4 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 1.321e-68
Identity = 196/645 (30.39%), Postives = 313/645 (48.53%), Query Frame = 1
Query:  112 SSILLSRRPPNYLSKLRSKTFPFFQL--YYDTDMAGPHKVVVDRLTHYP-PGNWGSMPISDCWKRYDEIIHLQSIPSYFDKLISMSWTEYNMYYHTLDVPMRFPETLEFAQFLTRTKIAYSI--PDSVKDSFNDISGDSIKSASEFLKFHVDNYFSQNRPYLTSYD--AEGHKSRSN---DFVIQLMDSIMRS-----KYNKEIFENYTTAPTSKIETFIKRSCYDEL----------------KVVEHIKSAEGCIQYRMRAELAWQLRSRDPLKEFVNKADSLFVDDGSQF----PIYNYHPKTFDMESKDFYFFQNVPFAYSRVSSEYLRNIPGFWGTNHIRTGDPCGFSVLGVINTNLSQRVLLDF-------SRDHPGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFKLNESSQIDQVNEHALHQLLAAMSLPRSTMTTEE---LQPYLKTPA--------PRDIGPSI----------------IDFHPETATXXX-XXXXXXXXXXXPLKPFSK--HHPNFLFYFDKLMTSDMNSRFRKIVPTAQNVPDFIDKKMELYHLKKSQEIGK----KKLMKYPTKWR 1818
            SS  L ++PP    + + K  P  Q   + D D  G  K+  + +   P  G WGS   S   K + +   L+  P+ F KL  + + E NM+Y+ LD+P+ + E+LEF+Q +TRT +  +   P S  +    I    +   S+FL+   D     N+PY+ + D   E  + RS+   +F+  LM+ I  +       +  I  N      +K+ETF KR+ Y +L                 V E +  ++  I++R+R +L WQLR + PL+ FV+       DD S F    P   Y P++F +E  + Y F  +PF  +++ SEYLR + G+W       GDPC F ++GV++T+ ++ +L D        + D   I+ R+ LSE +L +F W+ A A NQGFT+Y++LTYPI   +LLTDG  FQ++ FQLNS+++LWKP+D+GLP NM W S   +L+  +E    D++  +     L   +L R  M   E   L+PYL   A         R I PS+                +D H   A  K  +       K  PL+  ++   HPN +F+      +D+   FR+ +P        + +  +   LK+ + I +    +K+ + P +WR
Sbjct:   18 SSECLQKQPPWSRMRRKRKIVPPAQSLPFCDEDPVGGLKM--EEVFPKPVTGVWGSTEESLKRKFFKKEEILKQSPTVFGKLRELYYLEDNMWYNNLDLPLLYLESLEFSQHITRTALHQTTLPPSSQPEEKTTILSQRL---SQFLR---DELHLLNKPYINTVDMSVEARRQRSSATHEFLCSLMECIHGTLAQLYPNSHLITRNNQIDNGAKVETFFKRTGYADLLNAHTSDSTLAEGLWEPVSEVLLDSDNLIRFRLRGQLNWQLRGQMPLQPFVS------TDDPSCFQKYLPSALYRPESFGVEPVENYDFSCLPFTLNKILSEYLRTVAGYWSDTPFFKGDPCQFGLVGVVDTSRNEDLLDDLTTSTLLNAADRELIITRHGLSEGILTAFAWSSAIAYNQGFTLYNDLTYPIPVQLLLTDGHHFQLLRFQLNSLTALWKPEDAGLPFNMAWASQRLALYNQDEVVANDKITINTSALALIINALLREPMKPNEEINLRPYLAMTADNASDSLSQRLIPPSLSEEEQLKMSAGAHGEHLDAHLTPAERKALLATEASASKRTPLRIGNRPQPHPNDIFFLRPTEKTDLMEEFREQMPVFGGRSAALPEPHKQTLLKEKRRIREITPHRKVQRGPRRWR 648          
BLAST of 28S ribosomal protein S30, mitochondrial vs. TrEMBL
Match: A0A4S2L8V5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009097 PE=4 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 2.596e-68
Identity = 175/590 (29.66%), Postives = 292/590 (49.49%), Query Frame = 1
Query:  235 RLTHYPPGNWGSMPISDCWKRYDEIIHLQSIPSYFDKLISMSWTEYNMYYHTLDVPMRFPETLEFAQFLTRTKIAYSIPDSVKDSFNDISGDSIKSASEFLKFHVDNYFSQ-NRPYLTSYDAEGH----KSRSNDFVIQLMDSIMRSKYNKEIFENYTTA------PTSKIETFIKR-------SCYDEL------KVVEHI-KSAEGCIQYRMRAELAWQLRSRDPLKEFVNKADSLFVDDGSQFPIYNYHPKTFDMESKDFYFFQNVPFAYSRVSSEYLRNIPGFWGTNHIRTGDPCGFSVLGVINTNLSQRVLLDFSRDH------PGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFKLN-ESSQIDQVNEHALHQLLAAMSLP-RSTMTTEELQPYLKT-PAPRD-----------IGPSIIDFHPETAT-----------XXXXXXXXXXXXXXPLKPF--SKHHPNFLFYFDKLMTSDMNSRFRKIVP----TAQNVPDFIDKKMELYHLKKSQEIGKKKLMKYPTKWR 1818
            R +  P G WGS       +R+     L+ + + F+KL  +   E N++YH+LD+P++ PE LEF Q LTRT + Y     +   +          A E++   +     Q NR  + + D        ++R    +I          + +   +++             IETF+KR       S YD++      +V E +  + E  ++YR+R+ELAWQLR  DPL+ F+   D L +++  + PI NY P+ F+++  D Y F  +P   +   SE++R++ GFW  +    GDPC F  +GV++   S+++L DFS+          +  R+ LSE +L +F W  AQA NQGFT+Y+ELTYP+ T +LL D    Q++ +QLNS++SLWK  DSGLP NM W+SP   L++LN +      VN  A+  + +AM+ P    +++E L+PYLK   APRD           + P+  D  PE  +           ++ +E  K   +  P + F  ++ HPN +F+      S++    +  +P         P+  + +M+ + +++     + ++   P +WR
Sbjct:   59 RRSPTPTGLWGSTSPVVKAQRFKHEQQLKQVATAFEKLQELYNLEQNLWYHSLDLPLQHPEMLEFCQQLTRTNVVYPWEPELAQEY--------PLAQEYMAHAISECLLQLNRLPINTVDTNPEAVLLRNRERGKMIAAYMEAFHQAWLRMFPQSHVARRPHQLDERGTIETFLKRKVPPEMFSKYDDIAEDIFDEVNETVFDTKEETVRYRIRSELAWQLRGIDPLRPFLAWDDPLCLEN--RVPICNYRPEAFELKPVDCYEFSCLPHTETLDFSEFVRSVAGFWPRSPFWEGDPCEFGHVGVLDVARSEKLLRDFSKSQIPVSVMQEVRVRHALSEGILTAFAWASAQAYNQGFTLYNELTYPLATQLLLVDNDHIQLLRYQLNSLTSLWKADDSGLPFNMAWLSPKVKLYELNPDIPTTVSVNPQAIALMASAMTYPVDENLSSEYLRPYLKELCAPRDRAQPTGDPSTYLIPNSCDESPEEQSDSPLPVMSKREKEALEISKQADRETPYRIFAHARPHPNDVFFLKMTDKSELVQELKDEMPDFGGQFSRFPEPHNSRMKEFKIERRSRQPRLRVQAPPRRWR 638          
BLAST of 28S ribosomal protein S30, mitochondrial vs. TrEMBL
Match: A0A4S2L855 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009097 PE=4 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 3.205e-68
Identity = 156/464 (33.62%), Postives = 245/464 (52.80%), Query Frame = 1
Query:  235 RLTHYPPGNWGSMPISDCWKRYDEIIHLQSIPSYFDKLISMSWTEYNMYYHTLDVPMRFPETLEFAQFLTRTKIAYSIPDSVKDSFNDISGDSIKSASEFLKFHVDNYFSQ-NRPYLTSYDAEGH----KSRSNDFVIQLMDSIMRSKYNKEIFENYTTA------PTSKIETFIKR-------SCYDEL------KVVEHI-KSAEGCIQYRMRAELAWQLRSRDPLKEFVNKADSLFVDDGSQFPIYNYHPKTFDMESKDFYFFQNVPFAYSRVSSEYLRNIPGFWGTNHIRTGDPCGFSVLGVINTNLSQRVLLDFSRDH------PGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFKLN-ESSQIDQVNEHALHQLLAAMSLP-RSTMTTEELQPYLKT-PAPRD 1524
            R +  P G WGS       +R+     L+ + + F+KL  +   E N++YH+LD+P++ PE LEF Q LTRT + Y     +   +          A E++   +     Q NR  + + D        ++R    +I          + +   +++             IETF+KR       S YD++      +V E +  + E  ++YR+R+ELAWQLR  DPL+ F+   D L +++  + PI NY P+ F+++  D Y F  +P   +   SE++R++ GFW  +    GDPC F  +GV++   S+++L DFS+          +  R+ LSE +L +F W  AQA NQGFT+Y+ELTYP+ T +LL D    Q++ +QLNS++SLWK  DSGLP NM W+SP   L++LN +      VN  A+  + +AM+ P    +++E L+PYLK   APRD
Sbjct:   59 RRSPTPTGLWGSTSPVVKAQRFKHEQQLKQVATAFEKLQELYNLEQNLWYHSLDLPLQHPEMLEFCQQLTRTNVVYPWEPELAQEY--------PLAQEYMAHAISECLLQLNRLPINTVDTNPEAVLLRNRERGKMIAAYMEAFHQAWLRMFPQSHVARRPHQLDERGTIETFLKRKVPPEMFSKYDDIAEDIFDEVNETVFDTKEETVRYRIRSELAWQLRGIDPLRPFLAWDDPLCLEN--RVPICNYRPEAFELKPVDCYEFSCLPHTETLDFSEFVRSVAGFWPRSPFWEGDPCEFGHVGVLDVARSEKLLRDFSKSQIPVSVMQEVRVRHALSEGILTAFAWASAQAYNQGFTLYNELTYPLATQLLLVDNDHIQLLRYQLNSLTSLWKADDSGLPFNMAWLSPKVKLYELNPDIPTTVSVNPQAIALMASAMTYPVDENLSSEYLRPYLKELCAPRD 512          
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Sea Lamprey
Match: mrps30 (mitochondrial ribosomal protein S30 [Source:ZFIN;Acc:ZDB-GENE-050809-4])

HSP 1 Score: 56.225 bits (134), Expect = 1.109e-8
Identity = 29/97 (29.90%), Postives = 48/97 (49.48%), Query Frame = 1
Query: 1156 SEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFKLNESSQIDQVNEHALHQLL 1446
            + A+ + F WT AQA  QGF   ++LT P  +  ++TDG  F    +QLN+++            N+ W +P   L+   E SQ+   N+  +  L+
Sbjct:  294 AHAIASLFAWTGAQAMYQGFWADEDLTRPFVSQAVITDGIHFSFFCYQLNTLALDTHTDGGNARRNVCWGTPSMRLYDAVEGSQVHGFNDEVVTMLV 390          
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Nematostella
Match: EDO39571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9U2])

HSP 1 Score: 50.8322 bits (120), Expect = 9.700e-7
Identity = 51/225 (22.67%), Postives = 94/225 (41.78%), Query Frame = 1
Query:  715 ETFIKRSCYDELKVVEHIKSAEGCIQYRMRAELAWQLRSRDPLKEFVNKADSLFVDDGSQFPIYNYHPKTFDMESKDFYFFQNVPFAYSRVSSEYLRNIPGFWGTNHIRTGDPCGFSVLGVINTNLSQRVLLDFSRDHPGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFK 1389
            E+F+ R+     +++ H      C Q + +   ++ L +R P++ F  + D+  +D     P   Y P   D+ +  +   +NVP   +R  S Y                  C   +L  +N + +Q                   S  +L  F   ++ A + G     EL+ PI T  ++TDG  +  + +QLN+++   K KD+ +  NM+W++    LFK
Sbjct:  157 ESFLDRN----PQIITHWSRGGSCFQVKTKP--SYVLWTRYPVELFSYELDTT-LDTAIPGP---YKPNALDVYAHKYVPLKNVPGCVNRQQSLY----------------PYCHTMLLTCVNQSATQ-----------------MQSNGILNMFSLLLSHALDDGRVFGSELSSPIATKCIVTDGTKYIFMCYQLNTLNFGKKKKDNSIK-NMVWMTDAIQLFK 337          
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Medaka
Match: mrps30 (mitochondrial ribosomal protein S30 [Source:NCBI gene;Acc:101167212])

HSP 1 Score: 50.8322 bits (120), Expect = 3.262e-6
Identity = 27/103 (26.21%), Postives = 53/103 (51.46%), Query Frame = 1
Query: 1138 VHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFKLNESSQIDQVNEHALHQLL 1446
            V  +  + AL + F WT AQA  QGF  ++++  P  +  ++TDG  F    +QLN+++   +   +    N++W S    LF+  +  ++  +N+  +  L+
Sbjct:  317 VEVFLRANALASLFSWTGAQAAYQGFWSHEDVCRPFVSQAVITDGHFFSFFCYQLNTVALSVETDANNPRKNLLWGSQSQQLFQTVQDGEVLGLNDGVIKLLV 419          
BLAST of 28S ribosomal protein S30, mitochondrial vs. Planmine SMEST
Match: SMESG000042375.1 (SMESG000042375.1)

HSP 1 Score: 1200.65 bits (3105), Expect = 0.000e+0
Identity = 591/591 (100.00%), Postives = 591/591 (100.00%), Query Frame = 1
Query:   46 MNILIKNHYSVLSQFFKRHYNLSSILLSRRPPNYLSKLRSKTFPFFQLYYDTDMAGPHKVVVDRLTHYPPGNWGSMPISDCWKRYDEIIHLQSIPSYFDKLISMSWTEYNMYYHTLDVPMRFPETLEFAQFLTRTKIAYSIPDSVKDSFNDISGDSIKSASEFLKFHVDNYFSQNRPYLTSYDAEGHKSRSNDFVIQLMDSIMRSKYNKEIFENYTTAPTSKIETFIKRSCYDELKVVEHIKSAEGCIQYRMRAELAWQLRSRDPLKEFVNKADSLFVDDGSQFPIYNYHPKTFDMESKDFYFFQNVPFAYSRVSSEYLRNIPGFWGTNHIRTGDPCGFSVLGVINTNLSQRVLLDFSRDHPGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFKLNESSQIDQVNEHALHQLLAAMSLPRSTMTTEELQPYLKTPAPRDIGPSIIDFHPETATXXXXXXXXXXXXXXPLKPFSKHHPNFLFYFDKLMTSDMNSRFRKIVPTAQNVPDFIDKKMELYHLKKSQEIGKKKLMKYPTKWR 1818
            MNILIKNHYSVLSQFFKRHYNLSSILLSRRPPNYLSKLRSKTFPFFQLYYDTDMAGPHKVVVDRLTHYPPGNWGSMPISDCWKRYDEIIHLQSIPSYFDKLISMSWTEYNMYYHTLDVPMRFPETLEFAQFLTRTKIAYSIPDSVKDSFNDISGDSIKSASEFLKFHVDNYFSQNRPYLTSYDAEGHKSRSNDFVIQLMDSIMRSKYNKEIFENYTTAPTSKIETFIKRSCYDELKVVEHIKSAEGCIQYRMRAELAWQLRSRDPLKEFVNKADSLFVDDGSQFPIYNYHPKTFDMESKDFYFFQNVPFAYSRVSSEYLRNIPGFWGTNHIRTGDPCGFSVLGVINTNLSQRVLLDFSRDHPGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFKLNESSQIDQVNEHALHQLLAAMSLPRSTMTTEELQPYLKTPAPRDIGPSIIDFHPETATEKEIEEHKHLIKIKPLKPFSKHHPNFLFYFDKLMTSDMNSRFRKIVPTAQNVPDFIDKKMELYHLKKSQEIGKKKLMKYPTKWR
Sbjct:    1 MNILIKNHYSVLSQFFKRHYNLSSILLSRRPPNYLSKLRSKTFPFFQLYYDTDMAGPHKVVVDRLTHYPPGNWGSMPISDCWKRYDEIIHLQSIPSYFDKLISMSWTEYNMYYHTLDVPMRFPETLEFAQFLTRTKIAYSIPDSVKDSFNDISGDSIKSASEFLKFHVDNYFSQNRPYLTSYDAEGHKSRSNDFVIQLMDSIMRSKYNKEIFENYTTAPTSKIETFIKRSCYDELKVVEHIKSAEGCIQYRMRAELAWQLRSRDPLKEFVNKADSLFVDDGSQFPIYNYHPKTFDMESKDFYFFQNVPFAYSRVSSEYLRNIPGFWGTNHIRTGDPCGFSVLGVINTNLSQRVLLDFSRDHPGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPICTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFKLNESSQIDQVNEHALHQLLAAMSLPRSTMTTEELQPYLKTPAPRDIGPSIIDFHPETATEKEIEEHKHLIKIKPLKPFSKHHPNFLFYFDKLMTSDMNSRFRKIVPTAQNVPDFIDKKMELYHLKKSQEIGKKKLMKYPTKWR 591          
The following BLAST results are available for this feature:
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MRPS302.153e-727.40mitochondrial ribosomal protein S30 [Source:HGNC S... [more]
back to top
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mRpS302.622e-1125.20gene:FBgn0030692 transcript:FBtr0346193[more]
mRpS302.622e-1125.20gene:FBgn0030692 transcript:FBtr0074094[more]
back to top
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mrps304.584e-725.36mitochondrial ribosomal protein S30 [Source:MGI Sy... [more]
back to top
BLAST of 28S ribosomal protein S30, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9NP92|RT30_HUMAN1.034e-627.4039S ribosomal protein S30, mitochondrial OS=Homo s... [more]
sp|Q9D0G0|RT30_MOUSE3.207e-625.3628S ribosomal protein S30, mitochondrial OS=Mus mu... [more]
back to top
BLAST of 28S ribosomal protein S30, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DQ631.676e-6930.4628S ribosomal mitochondrial isoform 4 OS=Schistoso... [more]
A0A4Z2DQG36.510e-6933.5228S ribosomal mitochondrial isoform 2 OS=Schistoso... [more]
A0A0X3P0C71.321e-6830.3928S ribosomal protein S30 OS=Schistocephalus solid... [more]
A0A4S2L8V52.596e-6829.66Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2L8553.205e-6833.62Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps301.109e-829.90mitochondrial ribosomal protein S30 [Source:ZFIN;A... [more]
back to top
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO395719.700e-722.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 28S ribosomal protein S30, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps303.262e-626.21mitochondrial ribosomal protein S30 [Source:NCBI g... [more]
back to top
BLAST of 28S ribosomal protein S30, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000042375.10.000e+0100.00SMESG000042375.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007235 ID=SMED30007235|Name=28S ribosomal protein S30, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1850bp
AATATTCAATCACGTTGATATTTAATTAAAATTAGTTATTTTAAGATGAA
CATTTTAATAAAGAATCATTATTCAGTTTTATCACAATTTTTTAAGCGAC
ATTATAATTTGTCCAGTATTTTATTGAGCCGCAGACCTCCAAATTATTTA
TCCAAATTAAGATCTAAAACCTTTCCTTTCTTTCAACTTTATTATGATAC
TGATATGGCTGGACCACATAAAGTGGTCGTTGATCGTTTGACTCATTATC
CACCTGGAAATTGGGGATCTATGCCAATTAGTGATTGTTGGAAAAGGTAT
GATGAAATAATCCATTTACAATCTATACCAAGTTATTTTGATAAACTTAT
TTCAATGAGCTGGACAGAATATAACATGTATTACCATACTTTAGACGTCC
CAATGAGATTTCCAGAAACTTTAGAATTTGCACAATTTTTAACAAGAACA
AAAATTGCTTATTCGATTCCTGATTCGGTGAAAGATAGTTTTAACGATAT
ATCAGGAGACAGTATTAAATCAGCTTCGGAATTCTTGAAATTTCACGTTG
ATAATTATTTTAGTCAAAATCGACCGTATTTGACAAGTTATGACGCGGAA
GGTCACAAAAGTCGATCTAATGATTTTGTTATACAATTAATGGATTCAAT
AATGAGAAGTAAATATAACAAAGAGATATTTGAAAATTATACAACTGCTC
CAACATCGAAAATAGAAACTTTTATTAAAAGAAGTTGTTACGATGAACTG
AAAGTTGTTGAGCATATTAAAAGTGCTGAAGGATGCATTCAATATCGCAT
GCGAGCAGAATTGGCTTGGCAATTGAGATCACGTGACCCCCTAAAAGAAT
TTGTCAATAAAGCCGATTCTCTTTTTGTTGATGATGGTTCTCAATTTCCC
ATCTATAATTACCACCCGAAAACTTTTGATATGGAATCGAAAGATTTTTA
CTTTTTCCAAAATGTTCCATTTGCATATTCACGAGTCAGTTCTGAGTACT
TACGTAATATTCCTGGTTTCTGGGGCACAAATCACATAAGAACCGGTGAT
CCCTGTGGATTTAGTGTTCTCGGTGTAATCAATACAAACCTCAGTCAAAG
AGTATTGCTGGACTTTTCCCGTGATCATCCAGGAATCGTGCATCGATATT
ACTTGAGTGAAGCACTTTTAGCTTCTTTCATTTGGACAATGGCGCAGGCA
CAGAATCAAGGGTTCACGATTTATGACGAATTGACTTATCCGATTTGCAC
CGCGATGTTACTCACTGATGGCTGTAGTTTTCAAATGGTCTATTTTCAAT
TGAATTCTATTTCGTCTCTATGGAAACCGAAAGATTCAGGATTGCCGGTA
AACATGATGTGGGTCTCTCCGCCCGCGTCTCTATTCAAATTGAATGAAAG
TTCTCAAATCGACCAAGTGAATGAGCATGCTCTACATCAGTTGCTGGCAG
CTATGTCTCTACCGAGATCAACAATGACAACTGAAGAATTGCAACCGTAT
TTGAAAACTCCTGCTCCGAGAGATATCGGTCCATCAATAATTGATTTCCA
TCCTGAAACCGCTACAGAAAAGGAAATAGAAGAACATAAACATCTAATTA
AAATCAAGCCTTTGAAACCGTTTTCCAAGCATCATCCGAACTTTTTGTTT
TACTTTGACAAGCTGATGACATCTGATATGAATTCGCGATTCAGAAAAAT
AGTTCCAACTGCTCAGAATGTTCCGGATTTTATTGATAAAAAAATGGAAC
TTTATCATTTGAAAAAAAGCCAAGAAATCGGAAAAAAGAAATTGATGAAA
TATCCTACAAAATGGCGTTAAATTTTATTCTAATAAATATATTCTGGTGG
back to top

protein sequence of SMED30007235-orf-1

>SMED30007235-orf-1 ID=SMED30007235-orf-1|Name=SMED30007235-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=592bp
MNILIKNHYSVLSQFFKRHYNLSSILLSRRPPNYLSKLRSKTFPFFQLYY
DTDMAGPHKVVVDRLTHYPPGNWGSMPISDCWKRYDEIIHLQSIPSYFDK
LISMSWTEYNMYYHTLDVPMRFPETLEFAQFLTRTKIAYSIPDSVKDSFN
DISGDSIKSASEFLKFHVDNYFSQNRPYLTSYDAEGHKSRSNDFVIQLMD
SIMRSKYNKEIFENYTTAPTSKIETFIKRSCYDELKVVEHIKSAEGCIQY
RMRAELAWQLRSRDPLKEFVNKADSLFVDDGSQFPIYNYHPKTFDMESKD
FYFFQNVPFAYSRVSSEYLRNIPGFWGTNHIRTGDPCGFSVLGVINTNLS
QRVLLDFSRDHPGIVHRYYLSEALLASFIWTMAQAQNQGFTIYDELTYPI
CTAMLLTDGCSFQMVYFQLNSISSLWKPKDSGLPVNMMWVSPPASLFKLN
ESSQIDQVNEHALHQLLAAMSLPRSTMTTEELQPYLKTPAPRDIGPSIID
FHPETATEKEIEEHKHLIKIKPLKPFSKHHPNFLFYFDKLMTSDMNSRFR
KIVPTAQNVPDFIDKKMELYHLKKSQEIGKKKLMKYPTKWR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR039982MRPS30
IPR010793Ribosomal_L37/S30
Vocabulary: biological process
TermDefinition
GO:0006412translation
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010793Ribosomal protein L37/S30PFAMPF07147PDCD9coord: 363..468
e-value: 9.6E-19
score: 67.9
IPR039982Ribosomal protein S30, mitochondrialPANTHERPTHR13014MITOCHONDRIAL 28S RIBOSOMAL PROTEIN S30/P52 PRO-APOTOTIC PROTEINcoord: 91..469