Bardet-Biedl syndrome 7 protein homolog

Overview
NameBardet-Biedl syndrome 7 protein homolog
Smed IDSMED30007234
Length (bp)2224
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bardet-Biedl syndrome 7 protein homolog (SMED30007234) t-SNE clustered cells

Violin plots show distribution of expression levels for Bardet-Biedl syndrome 7 protein homolog (SMED30007234) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bardet-Biedl syndrome 7 protein homolog (SMED30007234) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bardet-Biedl syndrome 7 protein homolog (SMED30007234) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007234

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007234SMESG000005653.1 SmedASXL_014365SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30007234SMESG000005653.1 dd_Smed_v4_15015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007234SMESG000005653.1 dd_Smed_v4_15015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30007234SMESG000005653.1 dd_Smed_v6_15015_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007234SMESG000005653.1 dd_Smed_v4_15015_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Human
Match: BBS7 (Bardet-Biedl syndrome 7 [Source:HGNC Symbol;Acc:HGNC:18758])

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 343/721 (47.57%), Postives = 500/721 (69.35%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPSKILAGNM--LNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQ-DGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNS 2179
            MD  L +++Y+Q G+ ++   KLI  S   +  +QK+VIGD +G++  FGMKK ++  +FK   G K+ +L LGG     +EK+++A  + I GFTK+GKQFL F TNL+E I+ +++   +LF+++ YIY  Y + +D+ Y L  D+IN +ICLP+ +   + P+LAC+DRV+R+L+ S++ Y +EV GPP VL L++ +GG +G ++++GT DGK+ L+ I   KP  KWEI  E + G + CI  +DI GDG+ ++L+GR+DG VEVY  ++  EP L ++  L++++TSI GG  G  +Y EI+ +TYSGWV GLTTE   K       +  + ++  K+  ++ E+  L  K+  ++ +   S  S      +    +N+KFTL+  +A+Y L +E   +IDNVLIQSD  IDLLD +KNSAVVSFS  D + + N LLATYRCQA+TTRL +KIRSIEGQYG ++ YVTP+   KTCQ+  + +KPLSLH+R+H ID+ RP NTLTL G+FS AE++SW++FCLPE PE+  +      +   +++TFL TQLE   +K E VF+SDN+S ISILKDVL+KEATK+ I L+ISY+IN+ S+++ L+LIHPK++  LLLAKKVQLID LKEL+ +E      FL  +Y  ILE A+ L+E++KKQP HLERLYG+ITDL+IDK+KF+G +V++ V  L+++LD+Y    LI FF++
Sbjct:    1 MDLILNRMDYLQVGVTSQKTMKLIPASRHRA--TQKVVIGDHDGVVMCFGMKKGEAAAVFKTLPGPKIARLELGGVINTPQEKIFIAAASEIRGFTKRGKQFLSFETNLTESIKAMHISGSDLFLSASYIYNHYCDCKDQHYYLSGDKINDVICLPVERLSRITPVLACQDRVLRVLQGSDVMYAVEVPGPPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVRKWEIQNEKKRGGILCIDSFDIVGDGVKDLLVGRDDGMVEVYSFDNANEPVLRFDQMLSESVTSIQGGCVGKDSYDEIVVSTYSGWVTGLTTEPIHKESGPGEELKINQEMQNKISSLRNELEHLQYKVLQERENYQQSSQSSKAKSAVPSFGINDKFTLNKDDASYSLILEVQTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDSESNDNFLLATYRCQADTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAG---ECVTFYFQNTFLDTQLESTYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEG--NTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDSYDQNALISFFDA 714          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Human
Match: BBS7 (Bardet-Biedl syndrome 7 [Source:HGNC Symbol;Acc:HGNC:18758])

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 323/679 (47.57%), Postives = 467/679 (68.78%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPSKILAGNM--LNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQ-DGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYG 2053
            MD  L +++Y+Q G+ ++   KLI  S   +  +QK+VIGD +G++  FGMKK ++  +FK   G K+ +L LGG     +EK+++A  + I GFTK+GKQFL F TNL+E I+ +++   +LF+++ YIY  Y + +D+ Y L  D+IN +ICLP+ +   + P+LAC+DRV+R+L+ S++ Y +EV GPP VL L++ +GG +G ++++GT DGK+ L+ I   KP  KWEI  E + G + CI  +DI GDG+ ++L+GR+DG VEVY  ++  EP L ++  L++++TSI GG  G  +Y EI+ +TYSGWV GLTTE   K       +  + ++  K+  ++ E+  L  K+  ++ +   S  S      +    +N+KFTL+  +A+Y L +E   +IDNVLIQSD  IDLLD +KNSAVVSFS  D + + N LLATYRCQA+TTRL +KIRSIEGQYG ++ YVTP+   KTCQ+  + +KPLSLH+R+H ID+ RP NTLTL G+FS AE++SW++FCLPE PE+  +      +   +++TFL TQLE   +K E VF+SDN+S ISILKDVL+KEATK+ I L+ISY+IN+ S+++ L+LIHPK++  LLLAKKVQLID LKEL+ +E      FL  +Y  ILE A+ L+E++KKQP HLERLYG
Sbjct:    1 MDLILNRMDYLQVGVTSQKTMKLIPASRHRA--TQKVVIGDHDGVVMCFGMKKGEAAAVFKTLPGPKIARLELGGVINTPQEKIFIAAASEIRGFTKRGKQFLSFETNLTESIKAMHISGSDLFLSASYIYNHYCDCKDQHYYLSGDKINDVICLPVERLSRITPVLACQDRVLRVLQGSDVMYAVEVPGPPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVRKWEIQNEKKRGGILCIDSFDIVGDGVKDLLVGRDDGMVEVYSFDNANEPVLRFDQMLSESVTSIQGGCVGKDSYDEIVVSTYSGWVTGLTTEPIHKESGPGEELKINQEMQNKISSLRNELEHLQYKVLQERENYQQSSQSSKAKSAVPSFGINDKFTLNKDDASYSLILEVQTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDSESNDNFLLATYRCQADTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAG---ECVTFYFQNTFLDTQLESTYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEG--NTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYG 672          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Human
Match: BBS7 (Bardet-Biedl syndrome 7 [Source:HGNC Symbol;Acc:HGNC:18758])

HSP 1 Score: 152.91 bits (385), Expect = 8.947e-43
Identity = 78/139 (56.12%), Postives = 109/139 (78.42%), Query Frame = 2
Query: 1763 DVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNS 2179
            DVL+KEATK+ I L+ISY+IN+ S+++ L+LIHPK++  LLLAKKVQLID LKEL+ +E      FL  +Y  ILE A+ L+E++KKQP HLERLYG+ITDL+IDK+KF+G +V++ V  L+++LD+Y    LI FF++
Sbjct:    1 DVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEG--NTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDSYDQNALISFFDA 137          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Celegans
Match: osm-12 (Bardet-Biedl syndrome 7 protein homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9XW70])

HSP 1 Score: 320.087 bits (819), Expect = 2.415e-98
Identity = 213/719 (29.62%), Postives = 376/719 (52.29%), Query Frame = 2
Query:   44 KINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGG-STGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSK---NKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNA---KLAVKQNDSNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQDGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYE-STFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDT-YKLENLIEFF 2173
            + ++ Q G  N+GC ++I +  +  H    IV+G  NG +     K   + IIFK + G  V  L LGG ++ + K+K+++A    + G  +KGK F    TN++E    ++V  +++ +T +  Y RY +  D +  LC + I+ ++ L   +   ++E   ILAC +  ++I++ +   Y++ +   P  + L   DGG     ++YGT  G++GLV +        WEI   + A  V+ I  +++TG    ++++G+EDG +E+Y +++ +   L    + +++IT I  G   + +  +II  T++GW+  L  +TS   I+N   VAA+  + ++    + E  +      +L  ++        +     +   ++E F  S    AY L+IE  + ID V++QS   I L++ EKN++VVS  + D  +   LLA+YRCQAN  RL +++++ EG  G I +YV PK   K  Q+    +K LS H RSH  D  RP NTL   G FS+AE ++W+   LP  P +     P + I   Y+ S    TQL+ +  K   VFRSD ++ I I++D ++++  K  I ++++ ++N  S+ + L+LI PKI S+L + K       LKEL++N N +  +FLS     IL++ + + E+ +        +  I+ +L + + K  G+  +     +  ++ T Y LEN+   F
Sbjct:    6 RTDFAQVGTTNRGCMRVIPSDKEKEH--DLIVVGGQNGSLICLSRKSNDTTIIFKTQPGYPVQSLALGGPASSKKKDKIFVASQNTVRGVNRKGKTFFSMETNMAEVANRMFVRGLDVVLTGRKSYSRYHDTVDSNSYLCTEDIHDVVSLVFEEAWGSREYTSILACGNSTLQIIEGNNFAYDVRLDSVPFTVSLFMGDGGHTKLLVLYGTKTGRLGLVSVPQGGGKILWEIDTTSGA-CVTTIVCFNVTGGQFPDIIVGKEDGLIEIYVIDETDHAHLFGTFSCDESITGISCGHVSSKSEIDIIICTFTGWLFSLA-KTSRPMIENL-PVAANFSVKMQQLRSEVEELQTKVNEERLRYEEITKRQGSGTGSTFFHSFQVHENFEYSAAHGAYNLTIELVIPIDFVVVQSQLPIRLMEVEKNASVVSEVRQDALNPWPLLASYRCQANVCRLELRVQANEGDSGVINLYVCPKVMPKCAQITTHYIKALSSHMRSHDFDLYRPMNTLQFTGNFSIAEAHAWLHNLLPNVPSK---CPPADTITNNYQCSVNGGTQLQVVYSKGSAVFRSDCMTTICIIRDKVSEQTMKMQIRVEVACELNQDSVNHCLKLIDPKITSMLNIEKNKLYAAALKELESN-NDDVFSFLSAANAKILKDHDAIYEKSEGVSIEDSGVLAILENLMVARGKLTGRSSKGRGDAIRDLISTDYSLENMQTLF 715          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Zebrafish
Match: bbs7 (Bardet-Biedl syndrome 7 [Source:ZFIN;Acc:ZDB-GENE-030219-90])

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 344/728 (47.25%), Postives = 503/728 (69.09%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSV----------KSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQ-DGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFN 2176
            M+  L  ++YIQ G+ ++   KL+ ++   S  +QK+ + D +G++  FGMKK ++  +FK   G K+ +L LGG+ G  +EK++++  + + G+TKKGKQFL F  NL+E I  ++V   +LFV + YIY  Y + +D+DY L  D+IN ++CLP+     ++PILAC+DRV+R+L+ SE++Y++EV GPP VL  +  DGG  G E++YGT DGK+GLV I    P   WE+  E + G V CI  +DI  DG+ ++L+GR+DG VEVY ++   EP L +E  L++++TSI GG  G   Y E++ TTY+GWV GLTTE              S + QG VAA     ++ E  + ++  L  +   +Q+  +++  S +    + ++N+KFTL   +A+Y L++E   +IDN+L+QSD  IDLLD +KNSAVVSFS+ D + +GN LLATYRCQANTTRL +K+RSIEGQYG ++ YVTP+   KTCQ+  + +KPLSLH+R+HTI+  RP NTL L G+FS AE++SW++FCLPE PE+  +   EN I  C+++TFL TQLE    K E  F+SDN+S ISILKDVL+KEATK+ I L+ISY++N+ S+ + LR+IHPK++  L+LAKKVQLID LKEL+ +E   AD FL  +Y  IL+ +  L E++KKQP HLERLYG+ITDL+IDK+KF+G++V++ V  L+ +L+ Y+L++L+EFF+
Sbjct:    1 MELNLNHVDYIQVGVTSQKTMKLLPSAGRKS--TQKVAVADHDGVVSCFGMKKGEAVPVFKSLPGQKISRLELGGALGTPQEKIFVSSGSEVRGYTKKGKQFLTFEANLTESINAMHVSGADLFVCASYIYNHYCDCKDQDYYLSGDKINDVLCLPVETVGRIVPILACQDRVLRVLQGSELQYDVEVPGPPTVLERHDRDGGKGGEEVLYGTADGKLGLVRIAKSGPVTSWELDNEKKKGGVLCIDTFDIVADGVKDILVGRDDGTVEVYGLDGSNEPTLRFENVLSESVTSIQGGCVGKEMYDEVLTTTYTGWVSGLTTEPQQMVAGPGEEIKMSQETQGKVAA-----LRAELEQLQLKVLQGREKYQQSSQSSTAVSAV---PVFSINDKFTLCQDDASYSLTLEVQTAIDNLLLQSDVPIDLLDVDKNSAVVSFSECDSESNGNFLLATYRCQANTTRLELKVRSIEGQYGTLQAYVTPRLQPKTCQVRQYQIKPLSLHQRTHTIEQERPMNTLRLTGQFSFAEIHSWVVFCLPEVPEK--TPAGEN-ITFCFQNTFLGTQLEATYCKGEANFKSDNISTISILKDVLSKEATKRKINLNISYEVNEDSVSHTLRMIHPKLEYQLILAKKVQLIDALKELQVHEG-NAD-FLIPEYRSILDESAQLLEEYKKQPAHLERLYGMITDLFIDKFKFKGQNVKTKVSQLLAILNNYELDSLMEFFS 713          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Zebrafish
Match: bbs7 (Bardet-Biedl syndrome 7 [Source:ZFIN;Acc:ZDB-GENE-030219-90])

HSP 1 Score: 322.783 bits (826), Expect = 5.632e-103
Identity = 165/420 (39.29%), Postives = 262/420 (62.38%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSV----------KSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQ 1255
            M+  L  ++YIQ G+ ++   KL+ ++   S  +QK+ + D +G++  FGMKK ++  +FK   G K+ +L LGG+ G  +EK++++  + + G+TKKGKQFL F  NL+E I  ++V   +LFV + YIY  Y + +D+DY L  D+IN ++CLP+     ++PILAC+DRV+R+L+ SE++Y++EV GPP VL  +  DGG  G E++YGT DGK+GLV I    P   WE+  E + G V CI  +DI  DG+ ++L+GR+DG VEVY ++   EP L +E  L++++TSI GG  G   Y E++ TTY+GWV GLTTE              S + QG VAA     ++ E  + ++  L  +   +Q+  +++  S +    + ++N+KFTL   +A+Y L++E   +IDN+L+Q
Sbjct:    1 MELNLNHVDYIQVGVTSQKTMKLLPSAGRKS--TQKVAVADHDGVVSCFGMKKGEAVPVFKSLPGQKISRLELGGALGTPQEKIFVSSGSEVRGYTKKGKQFLTFEANLTESINAMHVSGADLFVCASYIYNHYCDCKDQDYYLSGDKINDVLCLPVETVGRIVPILACQDRVLRVLQGSELQYDVEVPGPPTVLERHDRDGGKGGEEVLYGTADGKLGLVRIAKSGPVTSWELDNEKKKGGVLCIDTFDIVADGVKDILVGRDDGTVEVYGLDGSNEPTLRFENVLSESVTSIQGGCVGKEMYDEVLTTTYTGWVSGLTTEPQQMVAGPGEEIKMSQETQGKVAA-----LRAELEQLQLKVLQGREKYQQSSQSSTAVSAV---PVFSINDKFTLCQDDASYSLTLEVQTAIDNLLLQ 410          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Xenopus
Match: gfod2 (glucose-fructose oxidoreductase domain containing 2 [Source:Xenbase;Acc:XB-GENE-5740207])

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 344/723 (47.58%), Postives = 509/723 (70.40%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPS--KILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQ-DGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNSEK 2185
            M+  L +++Y+Q  + ++   KL+  S   +  +QK+V+GD +G++  FG+KK ++  +FK   G K+ +L LGG+ G ++EK+++A  + + GFTK+GK FL F TNL+E I  +++   +LF+ + YIY  Y + +D+ Y L  D+I+ ++CLP+ + + + P+LAC+DRV+R+L+ S + YE++V GPP++L LN+ +GG +G E++YGT DGKIGL+ I    P  KWEI  E + G + CI  +DI GDG+ +MLIGR+DG VEVY  +   EP L Y+ +L ++ITSI GG  G   Y EI+ +TYSGWV GLTTE   K       +    D+  K+  ++ E+ +L  K+  +++   +S  S   + A  + ++N+KFTL+  +A+Y L +E  ++IDNVLIQSD  +DLLD +KNSAVVSFS  D++ +GN LLATYRCQANTTRL +KIRSIEGQYG ++ Y+TP+   KTCQ+  + +KPLSLH+R+H ID +RP NT++L G+FS ++M+SW++FCLPE PE+  +   ENV    +++TFL TQLEC  +K E +F+SDN+S ISILKDVL+KEATK+ I L+ISYDIN++S+ + L+LIHPK++  LLLAKKVQLID LKEL+ +E      FL  +Y  ILE A  L+E++KKQP HLERLYG+ITDL+IDK+KF+G +V++ V  L+++LD Y+ + L+ FF + +
Sbjct:    1 MELQLHRMDYLQVAVTSQKTMKLLPASGRRA--TQKVVVGDQDGVVTCFGIKKNEAVPVFKTLPGQKIARLELGGALGTVQEKIFVAAGSEVRGFTKRGKPFLSFETNLTESIRAMHISGSDLFLCASYIYNHYCDCKDQHYFLSGDKISDVLCLPVERLERITPVLACQDRVLRVLQGSSLMYEVDVPGPPSILALNNGNGGESGEELLYGTSDGKIGLIHIAMNTPIPKWEIPNEKKRGGILCIDSFDIIGDGVKDMLIGRDDGTVEVYGYDSANEPVLQYDHSLTESITSIQGGCVGKDGYDEIVLSTYSGWVTGLTTEPIHKEAGPGQELKMSQDMQNKIASLRSELEQLQFKVLQERDRYQHSSQSVTAVSAVPVFSINDKFTLNQDDASYSLILEVQMAIDNVLIQSDVPVDLLDVDKNSAVVSFSGCDNEPNGNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYITPRIQPKTCQVRQYQIKPLSLHQRAHAIDQNRPMNTVSLTGQFSFSDMHSWVVFCLPEVPEK--TPVGENV-TFYFKNTFLETQLECTYRKGEGLFKSDNISTISILKDVLSKEATKRKINLNISYDINEESVGHTLKLIHPKLEYQLLLAKKVQLIDALKELQVHEG--NTDFLIPEYRSILEEAEKLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDNYEQDALMAFFETAQ 716          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Xenopus
Match: gfod2 (glucose-fructose oxidoreductase domain containing 2 [Source:Xenbase;Acc:XB-GENE-5740207])

HSP 1 Score: 658.292 bits (1697), Expect = 0.000e+0
Identity = 343/724 (47.38%), Postives = 506/724 (69.89%), Query Frame = 2
Query:   23 DMDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPS--KILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQ-DGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNSEK 2185
            DM +T +     +  + ++   KL+  S   +  +QK+V+GD +G++  FG+KK ++  +FK   G K+ +L LGG+ G ++EK+++A  + + GFTK+GK FL F TNL+E I  +++   +LF+ + YIY  Y + +D+ Y L  D+I+ ++CLP+ + + + P+LAC+DRV+R+L+ S + YE++V GPP++L LN+ +GG +G E++YGT DGKIGL+ I    P  KWEI  E + G + CI  +DI GDG+ +MLIGR+DG VEVY  +   EP L Y+ +L ++ITSI GG  G   Y EI+ +TYSGWV GLTTE   K       +    D+  K+  ++ E+ +L  K+  +++   +S  S   + A  + ++N+KFTL+  +A+Y L +E  ++IDNVLIQSD  +DLLD +KNSAVVSFS  D++ +GN LLATYRCQANTTRL +KIRSIEGQYG ++ Y+TP+   KTCQ+  + +KPLSLH+R+H ID +RP NT++L G+FS ++M+SW++FCLPE PE+  +   ENV    +++TFL TQLEC  +K E +F+SDN+S ISILKDVL+KEATK+ I L+ISYDIN++S+ + L+LIHPK++  LLLAKKVQLID LKEL+ +E      FL  +Y  ILE A  L+E++KKQP HLERLYG+ITDL+IDK+KF+G +V++ V  L+++LD Y+ + L+ FF + +
Sbjct:    1 DMPYTHRLSYETRFPVTSQKTMKLLPASGRRA--TQKVVVGDQDGVVTCFGIKKNEAVPVFKTLPGQKIARLELGGALGTVQEKIFVAAGSEVRGFTKRGKPFLSFETNLTESIRAMHISGSDLFLCASYIYNHYCDCKDQHYFLSGDKISDVLCLPVERLERITPVLACQDRVLRVLQGSSLMYEVDVPGPPSILALNNGNGGESGEELLYGTSDGKIGLIHIAMNTPIPKWEIPNEKKRGGILCIDSFDIIGDGVKDMLIGRDDGTVEVYGYDSANEPVLQYDHSLTESITSIQGGCVGKDGYDEIVLSTYSGWVTGLTTEPIHKEAGPGQELKMSQDMQNKIASLRSELEQLQFKVLQERDRYQHSSQSVTAVSAVPVFSINDKFTLNQDDASYSLILEVQMAIDNVLIQSDVPVDLLDVDKNSAVVSFSGCDNEPNGNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYITPRIQPKTCQVRQYQIKPLSLHQRAHAIDQNRPMNTVSLTGQFSFSDMHSWVVFCLPEVPEK--TPVGENV-TFYFKNTFLETQLECTYRKGEGLFKSDNISTISILKDVLSKEATKRKINLNISYDINEESVGHTLKLIHPKLEYQLLLAKKVQLIDALKELQVHEG--NTDFLIPEYRSILEEAEKLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDNYEQDALMAFFETAQ 717          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Xenopus
Match: gfod2 (glucose-fructose oxidoreductase domain containing 2 [Source:Xenbase;Acc:XB-GENE-5740207])

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 328/670 (48.96%), Postives = 474/670 (70.75%), Query Frame = 2
Query:  185 FQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPS--KILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQ-DGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNSEK 2185
            F    +FK   G K+ +L LGG+ G ++EK+++A  + + GFTK+GK FL F TNL+E I  +++   +LF+ + YIY  Y + +D+ Y L  D+I+ ++CLP+ + + + P+LAC+DRV+R+L+ S + YE++V GPP++L LN+ +GG +G E++YGT DGKIGL+ I    P  KWEI  E + G + CI  +DI GDG+ +MLIGR+DG VEVY  +   EP L Y+ +L ++ITSI GG  G   Y EI+ +TYSGWV GLTTE   K       +    D+  K+  ++ E+ +L  K+  +++   +S  S   + A  + ++N+KFTL+  +A+Y L +E  ++IDNVLIQSD  +DLLD +KNSAVVSFS  D++ +GN LLATYRCQANTTRL +KIRSIEGQYG ++ Y+TP+   KTCQ+  + +KPLSLH+R+H ID +RP NT++L G+FS ++M+SW++FCLPE PE+  +   ENV    +++TFL TQLEC  +K E +F+SDN+S ISILKDVL+KEATK+ I L+ISYDIN++S+ + L+LIHPK++  LLLAKKVQLID LKEL+ +E      FL  +Y  ILE A  L+E++KKQP HLERLYG+ITDL+IDK+KF+G +V++ V  L+++LD Y+ + L+ FF + +
Sbjct:    3 FVENPVFKTLPGQKIARLELGGALGTVQEKIFVAAGSEVRGFTKRGKPFLSFETNLTESIRAMHISGSDLFLCASYIYNHYCDCKDQHYFLSGDKISDVLCLPVERLERITPVLACQDRVLRVLQGSSLMYEVDVPGPPSILALNNGNGGESGEELLYGTSDGKIGLIHIAMNTPIPKWEIPNEKKRGGILCIDSFDIIGDGVKDMLIGRDDGTVEVYGYDSANEPVLQYDHSLTESITSIQGGCVGKDGYDEIVLSTYSGWVTGLTTEPIHKEAGPGQELKMSQDMQNKIASLRSELEQLQFKVLQERDRYQHSSQSVTAVSAVPVFSINDKFTLNQDDASYSLILEVQMAIDNVLIQSDVPVDLLDVDKNSAVVSFSGCDNEPNGNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYITPRIQPKTCQVRQYQIKPLSLHQRAHAIDQNRPMNTVSLTGQFSFSDMHSWVVFCLPEVPEK--TPVGENV-TFYFKNTFLETQLECTYRKGEGLFKSDNISTISILKDVLSKEATKRKINLNISYDINEESVGHTLKLIHPKLEYQLLLAKKVQLIDALKELQVHEG--NTDFLIPEYRSILEEAEKLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDNYEQDALMAFFETAQ 667          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Mouse
Match: Bbs7 (Bardet-Biedl syndrome 7 (human) [Source:MGI Symbol;Acc:MGI:1918742])

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 348/728 (47.80%), Postives = 510/728 (70.05%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQND---------SNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQ-DGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNS 2179
            MD TL + +Y+Q G+ ++   KL+  S   +  +QK+V+GD +G++  FG+KK ++ ++FK   G K+ +L LGG+    +EK+++A  + I GFTK+GKQFL F TNL+E I+ +Y+   +LF+++ YIY  Y + +D++Y L  D+IN +ICLP+ K   V P+LAC+DRV+R+L+ S++ YE+EV GPP VL L++ DGG +G  +++GT DG++GL+ I   KP HKWEI  + + G + C+  +DI GDG+ ++L+GR+DG VEVY   +  EP L ++  L++++TSI GG  G   Y EI+  TYSGWV GLTTE + K       +  + ++  K+  ++ EI  L  K+  ++ +         + +++PS        ++N+KFTL+ ++A+Y L +E   +IDNVLIQSD  IDLLD +KNSAVVSFS  D + + N LLATYRCQANTTRL +KIRSIEGQYG ++ YVTP+   KTCQ+  + +KPLSLH+R+H ID+ RP NTLTL G+FS AE++SW++FCLPE PE+  +          +++TFL TQLEC+ +K E VF+SDN+S ISILKDVL+KEATK+ I L+ISY+IN+ S+++ L+LIHPK++  LLLAKKVQLID LKEL+ +E      FL+ +Y  ILE A+ L+E++KKQP HLERLYG+ITDL+IDK+KF+G +V++ V  L+++LD+Y    LI FF++
Sbjct:    1 MDLTLSRADYLQVGVTSQKTMKLLPTSRQRA--TQKVVVGDQDGVVICFGVKKGEAVVMFKTLPGQKISRLELGGAVNTPQEKIFIAAGSEIRGFTKRGKQFLSFETNLTESIKAMYISGSDLFLSASYIYNHYCDCKDQNYYLSGDKINDVICLPVEKLSRVTPVLACQDRVLRVLQGSDVMYEIEVPGPPTVLALHNGDGGDSGEGLLFGTSDGRLGLIQITTSKPIHKWEIRNDKKRGGILCVDSFDIMGDGVKDLLVGRDDGMVEVYSFENANEPVLRFDQMLSESVTSIQGGCVGKDGYDEIVLATYSGWVTGLTTEPTHKESGPGEELKLNQEMQNKISSLRSEIEHLQFKVLQERENYQQSSQSSQAKSTVPS-------FSINDKFTLNKEDASYSLVLEVRTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDTESNDNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAG---ECATFYFQNTFLDTQLECVYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQVHEG--NTDFLTPEYRCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPMLLEILDSYDQNTLISFFDA 714          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Mouse
Match: Bbs7 (Bardet-Biedl syndrome 7 (human) [Source:MGI Symbol;Acc:MGI:1918742])

HSP 1 Score: 673.7 bits (1737), Expect = 0.000e+0
Identity = 348/728 (47.80%), Postives = 509/728 (69.92%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQND---------SNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQ-DGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNS 2179
            MD TL + +Y+Q G+ ++   KL+  S   +  +QK+V+GD +G++  FG+KK ++  +FK   G K+ +L LGG+    +EK+++A  + I GFTK+GKQFL F TNL+E I+ +Y+   +LF+++ YIY  Y + +D++Y L  D+IN +ICLP+ K   V P+LAC+DRV+R+L+ S++ YE+EV GPP VL L++ DGG +G  +++GT DG++GL+ I   KP HKWEI  + + G + C+  +DI GDG+ ++L+GR+DG VEVY   +  EP L ++  L++++TSI GG  G   Y EI+  TYSGWV GLTTE + K       +  + ++  K+  ++ EI  L  K+  ++ +         + +++PS        ++N+KFTL+ ++A+Y L +E   +IDNVLIQSD  IDLLD +KNSAVVSFS  D + + N LLATYRCQANTTRL +KIRSIEGQYG ++ YVTP+   KTCQ+  + +KPLSLH+R+H ID+ RP NTLTL G+FS AE++SW++FCLPE PE+  +          +++TFL TQLEC+ +K E VF+SDN+S ISILKDVL+KEATK+ I L+ISY+IN+ S+++ L+LIHPK++  LLLAKKVQLID LKEL+ +E      FL+ +Y  ILE A+ L+E++KKQP HLERLYG+ITDL+IDK+KF+G +V++ V  L+++LD+Y    LI FF++
Sbjct:    1 MDLTLSRADYLQVGVTSQKTMKLLPTSRQRA--TQKVVVGDQDGVVICFGVKKGEAVPVFKTLPGQKISRLELGGAVNTPQEKIFIAAGSEIRGFTKRGKQFLSFETNLTESIKAMYISGSDLFLSASYIYNHYCDCKDQNYYLSGDKINDVICLPVEKLSRVTPVLACQDRVLRVLQGSDVMYEIEVPGPPTVLALHNGDGGDSGEGLLFGTSDGRLGLIQITTSKPIHKWEIRNDKKRGGILCVDSFDIMGDGVKDLLVGRDDGMVEVYSFENANEPVLRFDQMLSESVTSIQGGCVGKDGYDEIVLATYSGWVTGLTTEPTHKESGPGEELKLNQEMQNKISSLRSEIEHLQFKVLQERENYQQSSQSSQAKSTVPS-------FSINDKFTLNKEDASYSLVLEVRTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDTESNDNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAG---ECATFYFQNTFLDTQLECVYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQVHEG--NTDFLTPEYRCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPMLLEILDSYDQNTLISFFDA 714          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Mouse
Match: Bbs7 (Bardet-Biedl syndrome 7 (human) [Source:MGI Symbol;Acc:MGI:1918742])

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 328/686 (47.81%), Postives = 476/686 (69.39%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQND---------SNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQ-DGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYG 2053
            MD TL + +Y+Q G+ ++   KL+  S   +  +QK+V+GD +G++  FG+KK ++  +FK   G K+ +L LGG+    +EK+++A  + I GFTK+GKQFL F TNL+E I+ +Y+   +LF+++ YIY  Y + +D++Y L  D+IN +ICLP+ K   V P+LAC+DRV+R+L+ S++ YE+EV GPP VL L++ DGG +G  +++GT DG++GL+ I   KP HKWEI  + + G + C+  +DI GDG+ ++L+GR+DG VEVY   +  EP L ++  L++++TSI GG  G   Y EI+  TYSGWV GLTTE + K       +  + ++  K+  ++ EI  L  K+  ++ +         + +++PS        ++N+KFTL+ ++A+Y L +E   +IDNVLIQSD  IDLLD +KNSAVVSFS  D + + N LLATYRCQANTTRL +KIRSIEGQYG ++ YVTP+   KTCQ+  + +KPLSLH+R+H ID+ RP NTLTL G+FS AE++SW++FCLPE PE+  +          +++TFL TQLEC+ +K E VF+SDN+S ISILKDVL+KEATK+ I L+ISY+IN+ S+++ L+LIHPK++  LLLAKKVQLID LKEL+ +E      FL+ +Y  ILE A+ L+E++KKQP HLERLYG
Sbjct:    1 MDLTLSRADYLQVGVTSQKTMKLLPTSRQRA--TQKVVVGDQDGVVICFGVKKGEAVPVFKTLPGQKISRLELGGAVNTPQEKIFIAAGSEIRGFTKRGKQFLSFETNLTESIKAMYISGSDLFLSASYIYNHYCDCKDQNYYLSGDKINDVICLPVEKLSRVTPVLACQDRVLRVLQGSDVMYEIEVPGPPTVLALHNGDGGDSGEGLLFGTSDGRLGLIQITTSKPIHKWEIRNDKKRGGILCVDSFDIMGDGVKDLLVGRDDGMVEVYSFENANEPVLRFDQMLSESVTSIQGGCVGKDGYDEIVLATYSGWVTGLTTEPTHKESGPGEELKLNQEMQNKISSLRSEIEHLQFKVLQERENYQQSSQSSQAKSTVPS-------FSINDKFTLNKEDASYSLVLEVRTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDTESNDNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAG---ECATFYFQNTFLDTQLECVYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQVHEG--NTDFLTPEYRCILEEADHLQEEYKKQPAHLERLYG 672          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Mouse
Match: Bbs7 (Bardet-Biedl syndrome 7 (human) [Source:MGI Symbol;Acc:MGI:1918742])

HSP 1 Score: 64.6994 bits (156), Expect = 2.253e-12
Identity = 31/66 (46.97%), Postives = 46/66 (69.70%), Query Frame = 2
Query:  170 FGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIE 367
            FG+KK ++  +FK   G K+ +L LGG+    +EK+++A  + I GFTK+GKQFL F TNL+E I+
Sbjct:   25 FGVKKGEAVPVFKTLPGQKISRLELGGAVNTPQEKIFIAAGSEIRGFTKRGKQFLSFETNLTESIK 90          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. UniProt/SwissProt
Match: sp|Q8K2G4|BBS7_MOUSE (Bardet-Biedl syndrome 7 protein homolog OS=Mus musculus OX=10090 GN=Bbs7 PE=1 SV=1)

HSP 1 Score: 673.7 bits (1737), Expect = 0.000e+0
Identity = 348/728 (47.80%), Postives = 509/728 (69.92%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQND---------SNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQ-DGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNS 2179
            MD TL + +Y+Q G+ ++   KL+  S   +  +QK+V+GD +G++  FG+KK ++  +FK   G K+ +L LGG+    +EK+++A  + I GFTK+GKQFL F TNL+E I+ +Y+   +LF+++ YIY  Y + +D++Y L  D+IN +ICLP+ K   V P+LAC+DRV+R+L+ S++ YE+EV GPP VL L++ DGG +G  +++GT DG++GL+ I   KP HKWEI  + + G + C+  +DI GDG+ ++L+GR+DG VEVY   +  EP L ++  L++++TSI GG  G   Y EI+  TYSGWV GLTTE + K       +  + ++  K+  ++ EI  L  K+  ++ +         + +++PS        ++N+KFTL+ ++A+Y L +E   +IDNVLIQSD  IDLLD +KNSAVVSFS  D + + N LLATYRCQANTTRL +KIRSIEGQYG ++ YVTP+   KTCQ+  + +KPLSLH+R+H ID+ RP NTLTL G+FS AE++SW++FCLPE PE+  +          +++TFL TQLEC+ +K E VF+SDN+S ISILKDVL+KEATK+ I L+ISY+IN+ S+++ L+LIHPK++  LLLAKKVQLID LKEL+ +E      FL+ +Y  ILE A+ L+E++KKQP HLERLYG+ITDL+IDK+KF+G +V++ V  L+++LD+Y    LI FF++
Sbjct:    1 MDLTLSRADYLQVGVTSQKTMKLLPTSRQRA--TQKVVVGDQDGVVICFGVKKGEAVPVFKTLPGQKISRLELGGAVNTPQEKIFIAAGSEIRGFTKRGKQFLSFETNLTESIKAMYISGSDLFLSASYIYNHYCDCKDQNYYLSGDKINDVICLPVEKLSRVTPVLACQDRVLRVLQGSDVMYEIEVPGPPTVLALHNGDGGDSGEGLLFGTSDGRLGLIQITTSKPIHKWEIRNDKKRGGILCVDSFDIMGDGVKDLLVGRDDGMVEVYSFENANEPVLRFDQMLSESVTSIQGGCVGKDGYDEIVLATYSGWVTGLTTEPTHKESGPGEELKLNQEMQNKISSLRSEIEHLQFKVLQERENYQQSSQSSQAKSTVPS-------FSINDKFTLNKEDASYSLVLEVRTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDTESNDNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAG---ECATFYFQNTFLDTQLECVYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQVHEG--NTDFLTPEYRCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPMLLEILDSYDQNTLISFFDA 714          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. UniProt/SwissProt
Match: sp|Q8IWZ6|BBS7_HUMAN (Bardet-Biedl syndrome 7 protein OS=Homo sapiens OX=9606 GN=BBS7 PE=1 SV=2)

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 343/721 (47.57%), Postives = 500/721 (69.35%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPSKILAGNM--LNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQ-DGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNS 2179
            MD  L +++Y+Q G+ ++   KLI  S   +  +QK+VIGD +G++  FGMKK ++  +FK   G K+ +L LGG     +EK+++A  + I GFTK+GKQFL F TNL+E I+ +++   +LF+++ YIY  Y + +D+ Y L  D+IN +ICLP+ +   + P+LAC+DRV+R+L+ S++ Y +EV GPP VL L++ +GG +G ++++GT DGK+ L+ I   KP  KWEI  E + G + CI  +DI GDG+ ++L+GR+DG VEVY  ++  EP L ++  L++++TSI GG  G  +Y EI+ +TYSGWV GLTTE   K       +  + ++  K+  ++ E+  L  K+  ++ +   S  S      +    +N+KFTL+  +A+Y L +E   +IDNVLIQSD  IDLLD +KNSAVVSFS  D + + N LLATYRCQA+TTRL +KIRSIEGQYG ++ YVTP+   KTCQ+  + +KPLSLH+R+H ID+ RP NTLTL G+FS AE++SW++FCLPE PE+  +      +   +++TFL TQLE   +K E VF+SDN+S ISILKDVL+KEATK+ I L+ISY+IN+ S+++ L+LIHPK++  LLLAKKVQLID LKEL+ +E      FL  +Y  ILE A+ L+E++KKQP HLERLYG+ITDL+IDK+KF+G +V++ V  L+++LD+Y    LI FF++
Sbjct:    1 MDLILNRMDYLQVGVTSQKTMKLIPASRHRA--TQKVVIGDHDGVVMCFGMKKGEAAAVFKTLPGPKIARLELGGVINTPQEKIFIAAASEIRGFTKRGKQFLSFETNLTESIKAMHISGSDLFLSASYIYNHYCDCKDQHYYLSGDKINDVICLPVERLSRITPVLACQDRVLRVLQGSDVMYAVEVPGPPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVRKWEIQNEKKRGGILCIDSFDIVGDGVKDLLVGRDDGMVEVYSFDNANEPVLRFDQMLSESVTSIQGGCVGKDSYDEIVVSTYSGWVTGLTTEPIHKESGPGEELKINQEMQNKISSLRNELEHLQYKVLQERENYQQSSQSSKAKSAVPSFGINDKFTLNKDDASYSLILEVQTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDSESNDNFLLATYRCQADTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAG---ECVTFYFQNTFLDTQLESTYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEG--NTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDSYDQNALISFFDA 714          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. UniProt/SwissProt
Match: sp|Q9XW70|BBS7_CAEEL (Bardet-Biedl syndrome 7 protein homolog OS=Caenorhabditis elegans OX=6239 GN=osm-12 PE=1 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 3.072e-97
Identity = 213/719 (29.62%), Postives = 376/719 (52.29%), Query Frame = 2
Query:   44 KINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGG-STGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSK---NKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNA---KLAVKQNDSNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQDGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYE-STFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDT-YKLENLIEFF 2173
            + ++ Q G  N+GC ++I +  +  H    IV+G  NG +     K   + IIFK + G  V  L LGG ++ + K+K+++A    + G  +KGK F    TN++E    ++V  +++ +T +  Y RY +  D +  LC + I+ ++ L   +   ++E   ILAC +  ++I++ +   Y++ +   P  + L   DGG     ++YGT  G++GLV +        WEI   + A  V+ I  +++TG    ++++G+EDG +E+Y +++ +   L    + +++IT I  G   + +  +II  T++GW+  L  +TS   I+N   VAA+  + ++    + E  +      +L  ++        +     +   ++E F  S    AY L+IE  + ID V++QS   I L++ EKN++VVS  + D  +   LLA+YRCQAN  RL +++++ EG  G I +YV PK   K  Q+    +K LS H RSH  D  RP NTL   G FS+AE ++W+   LP  P +     P + I   Y+ S    TQL+ +  K   VFRSD ++ I I++D ++++  K  I ++++ ++N  S+ + L+LI PKI S+L + K       LKEL++N N +  +FLS     IL++ + + E+ +        +  I+ +L + + K  G+  +     +  ++ T Y LEN+   F
Sbjct:    6 RTDFAQVGTTNRGCMRVIPSDKEKEH--DLIVVGGQNGSLICLSRKSNDTTIIFKTQPGYPVQSLALGGPASSKKKDKIFVASQNTVRGVNRKGKTFFSMETNMAEVANRMFVRGLDVVLTGRKSYSRYHDTVDSNSYLCTEDIHDVVSLVFEEAWGSREYTSILACGNSTLQIIEGNNFAYDVRLDSVPFTVSLFMGDGGHTKLLVLYGTKTGRLGLVSVPQGGGKILWEIDTTSGA-CVTTIVCFNVTGGQFPDIIVGKEDGLIEIYVIDETDHAHLFGTFSCDESITGISCGHVSSKSEIDIIICTFTGWLFSLA-KTSRPMIENL-PVAANFSVKMQQLRSEVEELQTKVNEERLRYEEITKRQGSGTGSTFFHSFQVHENFEYSAAHGAYNLTIELVIPIDFVVVQSQLPIRLMEVEKNASVVSEVRQDALNPWPLLASYRCQANVCRLELRVQANEGDSGVINLYVCPKVMPKCAQITTHYIKALSSHMRSHDFDLYRPMNTLQFTGNFSIAEAHAWLHNLLPNVPSK---CPPADTITNNYQCSVNGGTQLQVVYSKGSAVFRSDCMTTICIIRDKVSEQTMKMQIRVEVACELNQDSVNHCLKLIDPKITSMLNIEKNKLYAAALKELESN-NDDVFSFLSAANAKILKDHDAIYEKSEGVSIEDSGVLAILENLMVARGKLTGRSSKGRGDAIRDLISTDYSLENMQTLF 715          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. TrEMBL
Match: R7UUJ8 (Bardet-Biedl syndrome 7 protein homolog OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_117810 PE=4 SV=1)

HSP 1 Score: 723.776 bits (1867), Expect = 0.000e+0
Identity = 361/720 (50.14%), Postives = 509/720 (70.69%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPSK--ILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQDGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNS 2179
            M+  L +++Y+Q GI ++   +L+  S      + KI I D NG++QVFGMK  +++ +FK   G K+L+L LGG TG IK+++++   + + GF+K+GKQFL F+TNL+E I+++YVE  +LF+   Y+Y  Y + +D++Y LC D IN ++CLPL   + V P+LAC+DRVIR+L +S + YE+EV GPP  LCL  N+GG +G+EIVYGT DGK+GLV    E P ++WE+  E   G V CI  YDIT DG+ ++L+GR+DG VE+Y  ++ +EP L      +++ITSI GG      Y E++C+TY+GWV+ LTTE   KS+        D  +  K+  +KKEI E+  ++  ++     +  +K  I A    N+N KF L+ ++A+Y LS+E  ++IDNVL+QSD  IDLLD EKNSAVVSFS  + ++GN LLATYRCQANTTRL +KIRSIEGQYG ++ YVTP+   KTCQ++ + ++PLSLH+RSHT D++RP+NTL + G FSLAEM+SW+ FCLPE PER   T   + +   + STFL T LEC  ++ E VFRSDN+S ISILKDVLTKE T+KGI +DI+Y++++ S+ + L LIHPK++  LLLAKKVQLID LKEL+ +E     +F+S +Y  ILE+A+ L+ +FKKQPCHLERLYG+ITDLYIDK+KF+G++V+  V  L++VLD Y L NL++FF +
Sbjct:    1 MELNLARVDYLQVGITSEKSMRLLPPSGKKEQ-TNKIAIADHNGVLQVFGMKNGEAQHVFKTLPGPKILRLELGGPTGGIKDRIFITSGSLVKGFSKRGKQFLDFNTNLTESIQHLYVEAADLFLCGNYVYNHYRDCQDQNYYLCGDTINDVLCLPLDPTQPVTPVLACQDRVIRVLHDSTLLYEVEVPGPPQTLCLYGNNGGEDGDEIVYGTTDGKLGLVQTSSEAPHYRWEVPNEKRNGGVLCIDNYDITSDGILDLLVGRDDGLVEIYGYDESDEPALRASQQCSESITSICGGVVSTPGYDEVVCSTYAGWVLALTTEPQHKSLGAGTQAQVDQSVHNKIGNLKKEIEEMQKRVLNEREHYQVTAQNKKAISAVPHFNINHKFVLNQEDASYTLSLEVQMAIDNVLLQSDVPIDLLDVEKNSAVVSFSACNPEEGNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYVTPRLQPKTCQVVKYRIRPLSLHQRSHTSDDNRPYNTLRIVGNFSLAEMHSWVWFCLPELPER---TPAGDSVQFQFVSTFLDTLLECSYKRGEAVFRSDNISTISILKDVLTKEGTRKGIRMDITYEVDEDSVAHTLNLIHPKLEYQLLLAKKVQLIDALKELQIHET--DSSFMSPEYKQILEDADKLQTEFKKQPCHLERLYGMITDLYIDKFKFKGQNVKGRVPMLLEVLDDYDLNNLVDFFQA 714          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. TrEMBL
Match: A0A210QW02 (Bardet-Biedl syndrome 7 protein-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12930 PE=4 SV=1)

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 362/720 (50.28%), Postives = 497/720 (69.03%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNV--AADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQDGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNS 2179
            M+  L +++Y+Q G  ++ C  L+      S   QK+VIGD  GL Q  GMKK + + +FK  +  K+ ++ LGG  G  +E+++LA+ + I GFTKKGK FL+F TNLSE I++IYVE   L   S ++Y +Y + +D +Y    D+I+ I+CLP+ +N E+ PILAC+DRV+R+L+ SE+ YE+EV GPP VL L  +  G +GNEI+YGT DG++GLV I    P HKWE+  E   G V C+  +DIT DG+ ++L+GR+DGQVEVY  ++ EEP   Y    ++++T+IH G      Y EI+C+TY GW+IGLT+E   K +     V  AA  + I  L+     + +       K   + NS  + I A    N N+KF L+ ++A+Y LS+E  + IDN+L+QSD  IDLLD EKNSAVVS+S  + +DGN LLATYRCQANTTRL +KIRSIEGQYG ++ YVTP+   KTCQ+  + +KPLSLH+R+H  D+SRP NT+ L G+FSLAEM+SW+ FCLPE PER   T P +V+   + STFL T LEC  +K + VF+SDN+S +SILKDVLTKEATKK I LDI+YDI + S+ Y L LIHPK++  LLLAKKVQLID LKEL+ +EN    +FLS +Y  ILE+++ L+ ++K+QPCHLERLYG+ITDLYIDK+KF+G +V+  V  L++VLD Y L++L++FF S
Sbjct:    2 MELNLTRVDYMQAGATSQKCMCLLPPVLGKS---QKVVIGDQEGLFQCIGMKKGEPQHVFKTNVSKKINRIELGGPIGGTRERIFLAVGSEINGFTKKGKNFLKFDTNLSEPIQSIYVEGSELLTCSNFVYNQYHDCKDTNYFQSGDKISDIVCLPMDRNPEITPILACQDRVLRVLQESELLYEVEVPGPPTVLQLYGDGAGEDGNEILYGTSDGRVGLVQISRLCPSHKWELPNEKRNGGVMCMDNFDITADGVLDLLLGRDDGQVEVYSYDESEEPVHRYSHTCSESVTAIHAGVVATQGYDEIVCSTYPGWLIGLTSEQLTKGMGPSEVVVTAAATNKISNLKSELDNLQQKVLDEREKYQQTANSQ-TAISAIPNFNTNDKFVLNREDASYTLSLELQMPIDNILLQSDVPIDLLDVEKNSAVVSYSSCNPEDGNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYVTPRVQPKTCQVRQYQIKPLSLHQRTHVFDDSRPLNTVKLTGQFSLAEMHSWVSFCLPELPER---TPPGDVLTFHFVSTFLDTLLECEYRKGQAVFKSDNISTVSILKDVLTKEATKKKIRLDITYDIVEDSVPYTLNLIHPKLEYQLLLAKKVQLIDALKELQVHEN--DTSFLSPEYRQILEDSDALQAEYKRQPCHLERLYGMITDLYIDKFKFKGHNVKGKVPALLEVLDNYDLQSLVQFFES 712          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. TrEMBL
Match: A0A1S3JTG6 (Bardet-Biedl syndrome 7 protein homolog OS=Lingula unguis OX=7574 GN=LOC106175948 PE=4 SV=1)

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 353/721 (48.96%), Postives = 507/721 (70.32%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPSK--ILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQDGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADT-FLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNS 2179
            M+  L +++Y+Q GI +    KL+  +      +QK+V+ D NG++Q F +KK +   +FK   G K++++ LGG  GQ++EK+++A    + GF KKGKQFL F TN+SE I  ++VE  +LFV+  YIY  Y + +D +Y LC D++N II LP+ +  E++P+LAC+DRV+R+L++S+I YE+E  GPP+ LC+ +  GG  GNEI+YGT DG+IGLV I    P H+WE+  E   G V C+  YD+T DG+ ++++GR+DG VE+Y  ++ +EP L + T  ++++TS+ GG+  N  + E++CTTY+GW++ LTTE   K+      V AD D+  K+  +++E+  L  K+  ++     +   K  I A    N+N+KF L+ ++A+Y LS+E  ++IDNVLIQSD  +DLLD +KNSAVVSFS  + ++GN LLATYRCQANTTRL +K+RSIEGQYG ++ Y TP+   KTC +  +P+KPLSLH+R+H  D +RP  +L L G FSLAE++SW+ FCLPE PER    G   V +  + STFL TQL C  +K E +F+SDN+S ISILKDVLTKEATKK I LDISYDIN++S+ ++L LIHPK++  L+LAKKVQ+ID LKEL+ +   E+DT FLS +Y  IL++A  L+E++KKQPC LERLYG+ITDL+IDK+KF+G++V+S V  LI+ LD Y L  LI+FFN+
Sbjct:    2 MELNLSRVDYLQVGITSPKSLKLLPPAGKKDP-TQKVVVADHNGVLQCFSLKKGEPNHVFKTLPGNKMVRVELGGPLGQVREKIFVATGPEVKGFNKKGKQFLGFDTNMSESILAMHVEGADLFVSGNYIYNHYKDCKDTNYYLCQDKVNDIIVLPVERIPEIMPVLACQDRVLRVLQDSDILYEVETPGPPSTLCMYAGTGGDEGNEILYGTSDGRIGLVEIGRLAPSHRWELPNEKRNGGVLCLDNYDMTADGILDLVVGRDDGLVEIYGYDEADEPILRHTTTCSESVTSVQGGRVANGTFDEVVCTTYAGWIMSLTTEHQTKAAGPGNAVPADKDMQAKIIHMRQEMEALQQKVIQEREKYQVTAQHKNAISAVPQFNINDKFVLNKEDASYTLSLEVQMAIDNVLIQSDVPVDLLDVDKNSAVVSFSACNPEEGNYLLATYRCQANTTRLEIKVRSIEGQYGTLQAYTTPRLQPKTCVVKQYPIKPLSLHQRTHVFDENRPNCSLKLMGNFSLAEIHSWVTFCLPELPER-TPAGDTAVFH--FVSTFLDTQLMCQYKKGEGLFKSDNISTISILKDVLTKEATKKKIRLDISYDINEESVAHLLNLIHPKLEYQLVLAKKVQIIDALKELQVH---ESDTSFLSAEYQQILQDAEKLQEEYKKQPCCLERLYGMITDLFIDKFKFKGQNVKSKVPLLIEHLDNYDLGQLIQFFNA 715          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. TrEMBL
Match: A0A1S3JU34 (Bardet-Biedl syndrome 7 protein homolog OS=Lingula unguis OX=7574 GN=LOC106175948 PE=4 SV=1)

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 355/722 (49.17%), Postives = 508/722 (70.36%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTET-SVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPSK--ILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQDGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADT-FLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNS 2179
            M+  L +++Y+Q GI +    KL+  +      +QK+V+ D NG++Q F +KK +   +FK   G K++++ LGG  GQ++EK+++A    + GF KKGKQFL F TN+SE I  ++VE  +LFV+  YIY  Y + +D +Y LC D++N II LP+ +  E++P+LAC+DRV+R+L++S+I YE+E  GPP+ LC+ +  GG  GNEI+YGT DG+IGLV I    P H+WE+  E   G V C+  YD+T DG+ ++++GR+DG VE+Y  ++ +EP L + T  ++++TS+ GG+  N  + E++CTTY+GWVIGLTT T + K+    G    D D+  K+  +++E+  L  K+  ++     +   K  I A    N+N+KF L+ ++A+Y LS+E  ++IDNVLIQSD  +DLLD +KNSAVVSFS  + ++GN LLATYRCQANTTRL +K+RSIEGQYG ++ Y TP+   KTC +  +P+KPLSLH+R+H  D +RP  +L L G FSLAE++SW+ FCLPE PER    G   V +  + STFL TQL C  +K E +F+SDN+S ISILKDVLTKEATKK I LDISYDIN++S+ ++L LIHPK++  L+LAKKVQ+ID LKEL+ +   E+DT FLS +Y  IL++A  L+E++KKQPC LERLYG+ITDL+IDK+KF+G++V+S V  LI+ LD Y L  LI+FFN+
Sbjct:    2 MELNLSRVDYLQVGITSPKSLKLLPPAGKKDP-TQKVVVADHNGVLQCFSLKKGEPNHVFKTLPGNKMVRVELGGPLGQVREKIFVATGPEVKGFNKKGKQFLGFDTNMSESILAMHVEGADLFVSGNYIYNHYKDCKDTNYYLCQDKVNDIIVLPVERIPEIMPVLACQDRVLRVLQDSDILYEVETPGPPSTLCMYAGTGGDEGNEILYGTSDGRIGLVEIGRLAPSHRWELPNEKRNGGVLCLDNYDMTADGILDLVVGRDDGLVEIYGYDEADEPILRHTTTCSESVTSVQGGRVANGTFDEVVCTTYAGWVIGLTTHTMTEKATGPGGARVVDRDVQAKIIHLRQEMEALQQKVIQEREKYQVTAQHKNAISAVPQFNINDKFVLNKEDASYTLSLEVQMAIDNVLIQSDVPVDLLDVDKNSAVVSFSACNPEEGNYLLATYRCQANTTRLEIKVRSIEGQYGTLQAYTTPRLQPKTCVVKQYPIKPLSLHQRTHVFDENRPNCSLKLMGNFSLAEIHSWVTFCLPELPER-TPAGDTAVFH--FVSTFLDTQLMCQYKKGEGLFKSDNISTISILKDVLTKEATKKKIRLDISYDINEESVAHLLNLIHPKLEYQLVLAKKVQIIDALKELQVH---ESDTSFLSAEYQQILQDAEKLQEEYKKQPCCLERLYGMITDLFIDKFKFKGQNVKSKVPLLIEHLDNYDLGQLIQFFNA 716          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. TrEMBL
Match: A0A2R2MQG4 (Bardet-Biedl syndrome 7 protein homolog OS=Lingula unguis OX=7574 GN=LOC106175948 PE=4 SV=1)

HSP 1 Score: 700.664 bits (1807), Expect = 0.000e+0
Identity = 353/729 (48.42%), Postives = 507/729 (69.55%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDE--------KPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPSK--ILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQDGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADT-FLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNS 2179
            M+  L +++Y+Q GI +    KL+  +      +QK+V+ D NG++Q F +KK +   +FK   G K++++ LGG  GQ++EK+++A    + GF KKGKQFL F TN+SE I  ++VE  +LFV+  YIY  Y + +D +Y LC D++N II LP+ +  E++P+LAC+DRV+R+L++S+I YE+E  GPP+ LC+ +  GG  GNEI+YGT DG+IGLV I            P H+WE+  E   G V C+  YD+T DG+ ++++GR+DG VE+Y  ++ +EP L + T  ++++TS+ GG+  N  + E++CTTY+GW++ LTTE   K+      V AD D+  K+  +++E+  L  K+  ++     +   K  I A    N+N+KF L+ ++A+Y LS+E  ++IDNVLIQSD  +DLLD +KNSAVVSFS  + ++GN LLATYRCQANTTRL +K+RSIEGQYG ++ Y TP+   KTC +  +P+KPLSLH+R+H  D +RP  +L L G FSLAE++SW+ FCLPE PER    G   V +  + STFL TQL C  +K E +F+SDN+S ISILKDVLTKEATKK I LDISYDIN++S+ ++L LIHPK++  L+LAKKVQ+ID LKEL+ +   E+DT FLS +Y  IL++A  L+E++KKQPC LERLYG+ITDL+IDK+KF+G++V+S V  LI+ LD Y L  LI+FFN+
Sbjct:    2 MELNLSRVDYLQVGITSPKSLKLLPPAGKKDP-TQKVVVADHNGVLQCFSLKKGEPNHVFKTLPGNKMVRVELGGPLGQVREKIFVATGPEVKGFNKKGKQFLGFDTNMSESILAMHVEGADLFVSGNYIYNHYKDCKDTNYYLCQDKVNDIIVLPVERIPEIMPVLACQDRVLRVLQDSDILYEVETPGPPSTLCMYAGTGGDEGNEILYGTSDGRIGLVEIGRTMASPRRRLAPSHRWELPNEKRNGGVLCLDNYDMTADGILDLVVGRDDGLVEIYGYDEADEPILRHTTTCSESVTSVQGGRVANGTFDEVVCTTYAGWIMSLTTEHQTKAAGPGNAVPADKDMQAKIIHMRQEMEALQQKVIQEREKYQVTAQHKNAISAVPQFNINDKFVLNKEDASYTLSLEVQMAIDNVLIQSDVPVDLLDVDKNSAVVSFSACNPEEGNYLLATYRCQANTTRLEIKVRSIEGQYGTLQAYTTPRLQPKTCVVKQYPIKPLSLHQRTHVFDENRPNCSLKLMGNFSLAEIHSWVTFCLPELPER-TPAGDTAVFH--FVSTFLDTQLMCQYKKGEGLFKSDNISTISILKDVLTKEATKKKIRLDISYDINEESVAHLLNLIHPKLEYQLVLAKKVQIIDALKELQVH---ESDTSFLSAEYQQILQDAEKLQEEYKKQPCCLERLYGMITDLFIDKFKFKGQNVKSKVPLLIEHLDNYDLGQLIQFFNA 723          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Cavefish
Match: bbs7 (Bardet-Biedl syndrome 7 [Source:NCBI gene;Acc:103037676])

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 342/720 (47.50%), Postives = 495/720 (68.75%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPSKILAG--NMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQ-DGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFN 2176
            M+ +L  ++Y+Q G+ ++   KL+      +  +QK+ + D +G++  FGMKK ++  +FK   G K+ +L LGG+ G  +EK+++   + + GFTKKGKQFL F  NL+E I  ++V   +LFV + YIY  Y + +D+DY L  D+IN I+CLP+      +P+LAC+DRV+R+L+ SE+ Y++EV GPP+VL L++ DGG NG E++YGT DGK+GL+ +    P  KWE+  E + G V CI  +DI GDG+ ++L+GR+DG VEVY ++   EP L +E  L++++TSI GG  G  +Y E++ TTY+GWV GLTTE           V    +   K+  ++ E+ +L  K+   +     S  S        + ++N++FTL   +A+Y L++E   +IDN+L+QSD  IDLLD +KNSAVVSFS+ D + +GN LLATYRCQANTTRL +K+RSIEGQYG ++ YVTP+   KTCQ+  + +KPLSLH+R+H ID  RP NTL L G+FS AE++SW++FCLPE PE+  +   EN I   +++TFL TQLE    K E  F+SDN+S ISILKDVL+KEATK+ I L+ISY++N+ S+ + L++IHPK++  LLLAKKVQLID LKEL+ +E   AD FL  +Y  IL+ +  L E++KKQP HLERLYG+ITDL+IDK+KF+G++V++ V  L+++LD Y L +L+EFFN
Sbjct:    1 MELSLNHVDYLQVGVTSQKTMKLLPAVGRKA--TQKVAVADHDGVVNCFGMKKGEAVPVFKSLPGQKISRLELGGALGTPQEKIFVCSGSEVRGFTKKGKQFLSFEANLTESINAMHVSGADLFVCASYIYNHYCDCKDQDYYLSGDKINDIVCLPVETVGRTVPVLACQDRVLRVLQGSELLYDVEVPGPPSVLELHNRDGGKNGEEVLYGTTDGKLGLIQLTSSAPVSKWEVDNEKKKGGVLCIDTFDILGDGVKDILVGRDDGTVEVYGLDSSNEPTLRFENVLSESVTSIQGGCVGKESYEEVLTTTYTGWVSGLTTEPQQMEAGPGDEVKMSRETQTKVAALRAELEQLQVKVMQGREKYQQSSLSSTAVSVVPVFSINDRFTLCQDDASYSLTLEVQTAIDNLLLQSDVPIDLLDVDKNSAVVSFSECDSEPNGNFLLATYRCQANTTRLELKVRSIEGQYGTLQAYVTPRLQPKTCQVRQYQIKPLSLHQRTHNIDQDRPMNTLRLVGQFSFAEIHSWVVFCLPEVPEK--TPAGEN-ITFYFQNTFLGTQLEASYCKGEGNFKSDNISTISILKDVLSKEATKRKINLNISYEVNEDSVSHTLKMIHPKLEYQLLLAKKVQLIDALKELQVHEG-NAD-FLIPEYRSILDESARLLEEYKKQPAHLERLYGMITDLFIDKFKFKGQNVKTKVSQLLEILDNYDLNSLMEFFN 713          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Sea Lamprey
Match: bbs7 (Bardet-Biedl syndrome 7 [Source:ZFIN;Acc:ZDB-GENE-030219-90])

HSP 1 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 342/690 (49.57%), Postives = 488/690 (70.72%), Query Frame = 2
Query:  131 KIVIGDFNGLIQVFGMKKFQSKI---IFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSN--NSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQ-DGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNE-NVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNS 2179
            ++ +GD NG++  FG+KK +  +     +   G K+ +L LGG+TG  +EK+++A    + GFTKKGKQFL F TN++E I+++YV   +LF+   YIY  Y + +D++Y L  D+I+ ++CLP  +  ++ P+LAC DRV+R+LK S ++YE+EV G P+VL L   +GG +G +I+YGT DGK+GL+ I   +  H+WEI  E   G V C+  +DI GDG+ ++L+GR+DG VEVY  +   +P L YE  L+++ITSI GG  G   Y EII  TY+GWV GLTTE   KS+ +   V    ++  KL+ I+ E+ +L  ++ ++++     +   S +    + ++N++FTL   +A+Y+LSIE   ++D+V++QSD  IDLLD EKNSAVVS+S  D + +GN LLATYRCQANTTRL +KIRSIEGQYG ++ Y+TP+   KTCQ+  + +KPLSLH+R HTID SRP NTL+L G+FS AE++SW++FCLPE PE+    G  + +   +++TFL TQLEC+ +K E VFRSDN+S ISILKD+LTKEATK+ I L+ISYD+N+ SI + L+LIHPK++  L+LAKKVQLID LKEL+ +E N++   FL  +Y  IL  A+ L+E+FKKQP HLERLYG+ITDL+IDK+KF+G +V+S V  L++VLD Y+L  L EFFNS
Sbjct:    1 QVAVGDQNGVLTCFGIKKGEVVVHGQCSRHWPGPKLQRLELGGATGTPQEKVFVAAGPEVRGFTKKGKQFLNFETNMAESIQSMYVSGADLFLCGSYIYNHYRDCQDKNYFLSTDKISDLLCLPAERVPDLTPVLACNDRVLRVLKQSSLRYEMEVPGSPSVLALFGRNGGDSGQDILYGTADGKLGLLQIKPTEATHRWEIVNEKRRGGVLCMDCFDILGDGVKDVLVGRDDGTVEVYGFDSVGDPVLRYEHALSESITSIQGGCVGKDGYDEIITATYAGWVSGLTTEPLQKSVGSGEEVKMSREMQTKLDNIRAELEQLQLQVMMERDHYQLTSQSDSAVATVPLFHVNDRFTLGRDDASYVLSIEVQTAMDHVMLQSDVPIDLLDVEKNSAVVSYSACDTELNGNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYITPRLQPKTCQVRQYLIKPLSLHQRVHTIDASRPMNTLSLTGQFSCAEIHSWVVFCLPELPEK-APVG--DSVTYYFQNTFLETQLECVYRKGEGVFRSDNISTISILKDILTKEATKRKINLNISYDMNEDSIGHTLQLIHPKLEHQLMLAKKVQLIDALKELQVHEGNMD---FLIAEYRAILLEADSLQEEFKKQPSHLERLYGMITDLFIDKFKFKGTNVKSRVPMLLEVLDNYELNTLTEFFNS 684          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Nematostella
Match: EDO41699 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3C1])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 277/560 (49.46%), Postives = 392/560 (70.00%), Query Frame = 2
Query:  512 VIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKS----IDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQDGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNS 2179
            ++PILAC+DRV+R+L++S++ YE+EV GPP V+ L   +GG +G E++YGT DGKIGLV +    P HKWEI  E   GS+  +  +DIT DG++++L+GR+DG VEVY  ++ +EP   +   ++++ITSI GG    A Y E++  TY+GWV+GLTTE   K     + +Q  ++ +    I     + +  +       ++        S + A     +N++F L+  +A+Y LSIE  + IDNVL+QSD  IDLLD +KNSAVVS+S  D ++GN LLATYRCQANTTRL +KIRSIEGQYG ++ Y+TP+   KTCQ+  +P+KPLSLH+R+H  D S+P N+L L G FS AE++SW+ FCLPE P+R   T   + +   + STFL TQL+C  +K E VF SDN+S ISILKDVLTKEATK+ I L+ISYD++++S+ + L +IHPK++  LLLAKKVQLID LKEL+ +E  +  +F + +Y  ILE A+ L+ ++KKQPCHLERLYG+ITDLYIDK+KF+G +V+S V  L++VLD Y ++NL++FF +
Sbjct:    1 LVPILACQDRVLRVLQDSDLLYEVEVAGPPLVMALYGGNGGPSGEEVIYGTSDGKIGLVQLGRHTPNHKWEIPNEKRNGSILALETFDITADGVADILVGRDDGVVEVYGFDEMDEPVHRFSQTMSESITSIAGGCVSAAGYDELVVGTYAGWVVGLTTEPQHKEAGSDMTSQEPISEETQQKINNLRYEIDSLQQQVLKEREKYQYTAHSTSAVSAIPQFAINDRFALNRDDASYTLSIEVQIPIDNVLLQSDVPIDLLDVDKNSAVVSYSACDVENGNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYITPRIQPKTCQVRQYPIKPLSLHQRTHVFDESKPMNSLKLTGPFSFAEVHSWVCFCLPEVPDR---TPAGDQVTFHFLSTFLDTQLDCTYRKGEAVFLSDNISTISILKDVLTKEATKRKINLNISYDLSEESVVHTLNMIHPKLEYQLLLAKKVQLIDALKELQGHE--KDISFFAPEYKTILEEADQLQAEYKKQPCHLERLYGMITDLYIDKFKFKGMNVKSKVPMLLEVLDNYDVQNLVDFFEA 555          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Nematostella
Match: EDO28324 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6T2])

HSP 1 Score: 61.6178 bits (148), Expect = 1.091e-11
Identity = 36/114 (31.58%), Postives = 65/114 (57.02%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIE 367
            M+ +L + +Y+Q G+ +    KL+ +    S  +QK+      GL   + + +  + I+FK    + + +L LGG  G  ++++++A    + GF+KKGKQFL F TNL+E I+
Sbjct:    1 MELSLTRSDYLQVGVTSPKTLKLLPSGGKRS--TQKV------GL---YALIEHWNCIVFKTLPSSAISRLSLGGFQGPAQDRIFVASGAEVKGFSKKGKQFLGFDTNLTESIQ 103          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Medaka
Match: bbs7 (Bardet-Biedl syndrome 7 [Source:NCBI gene;Acc:101166368])

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 337/728 (46.29%), Postives = 491/728 (67.45%), Query Frame = 2
Query:   26 MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFGMKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKL---------AVKQNDSNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQ--DGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFN 2176
            M+  L +++Y+Q G+ ++   +L+      +  +QK+ I D +G++  FGMKK ++  +FK   G K+ ++ LGG+ G  +EK+++   + + GFTKKGKQFL F  NL+E I  +YV   +LFV + YIY  Y + +D+DY L  D+IN I C+   K   + P+LAC+DRV+R+L+ S + Y++EV GPP+VL L + D    G E++YGT DG++GLV I +     KWEI  +N+ G + C   YDI GDG++++L+GR+DG V+VY  +   EP L +E  L++++TSI GG  G  +Y E++  TY+GWV GLTTE+       Q   AA  D     +E + ++  L A+L           +Q        + + A  + ++N+KFTL   +A+Y L++E   +IDN+L+QSD  IDLLD +KNSAVVSFS+ D +  +GN LLATYRCQANTTRL +K+RSIEGQYG ++ Y+TP+   KTCQ+  + +KPLSLH+R+H+ID +RP N L+L G+FS AE++SW++FCLPE PE+   T  E+ I   + +TFL TQLE    K E  F+SDN+S ISIL DVL+KEATKK I L+ISYDIND S+ + LR+IHPK++  LLLAKKVQL+D L+EL+ +E     +FL  +Y  IL+ +  L E++KKQP HLERLYG+ITDL+IDK+KF+G++V++ V +L+++LD Y L +L+EFFN
Sbjct:    1 MEIHLNRVDYVQVGVTSQKSMRLLPALGKKA--TQKVAIADHDGILTCFGMKKGEAVPVFKTLPGQKICRMDLGGALGTPREKIFVCSGSQVRGFTKKGKQFLTFEANLTESINAMYVSGADLFVCASYIYNHYCDCKDQDYFLSGDKINDITCVSSEKLPHLTPVLACQDRVLRVLQGSTLAYDIEVPGPPSVLELYNKDA---GEEVLYGTTDGRLGLVQIGEHSAVAKWEIDNDNKKGGILCADAYDIVGDGVNDILVGRDDGTVQVYGFDSSNEPTLRFEHVLSESVTSIQGGCVGKESYDEVVTATYTGWVTGLTTES-------QKTEAAAGDEFRMSKETQSKVEALRAELEQLQGKVLQGREQYQQTTQSSTAVSAVPVFSINDKFTLCQDDASYSLTLEVQTAIDNLLLQSDVPIDLLDVDKNSAVVSFSECDPEQPNGNFLLATYRCQANTTRLELKVRSIEGQYGTLQAYITPRLQPKTCQVRQYQIKPLSLHQRTHSIDPARPMNRLSLVGQFSFAEIHSWVVFCLPEVPEK---TPAEDDITFYFRNTFLGTQLEATYCKGEGHFQSDNISTISILSDVLSKEATKKKINLNISYDINDDSVSHTLRMIHPKLEYQLLLAKKVQLVDALRELQVHEG--NASFLIPEYRSILDESASLLEEYKKQPAHLERLYGMITDLFIDKFKFKGQNVKTKVSSLLEILDNYDLNSLLEFFN 711          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Medaka
Match: bbs7 (Bardet-Biedl syndrome 7 [Source:NCBI gene;Acc:101166368])

HSP 1 Score: 634.795 bits (1636), Expect = 0.000e+0
Identity = 322/678 (47.49%), Postives = 461/678 (67.99%), Query Frame = 2
Query:  176 MKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKL---------AVKQNDSNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQ--DGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFN 2176
            +K+   + +FK   G K+ ++ LGG+ G  +EK+++   + + GFTKKGKQFL F  NL+E I  +YV   +LFV + YIY  Y + +D+DY L  D+IN I C+   K   + P+LAC+DRV+R+L+ S + Y++EV GPP+VL L + D G    E++YGT DG++GLV I +     KWEI  +N+ G + C   YDI GDG++++L+GR+DG V+VY  +   EP L +E  L++++TSI GG  G  +Y E++  TY+GWV GLTTE+       Q   AA  D     +E + ++  L A+L           +Q        + + A  + ++N+KFTL   +A+Y L++E   +IDN+L+QSD  IDLLD +KNSAVVSFS+ D +  +GN LLATYRCQANTTRL +K+RSIEGQYG ++ Y+TP+   KTCQ+  + +KPLSLH+R+H+ID +RP N L+L G+FS AE++SW++FCLPE PE+   T  E+ I   + +TFL TQLE    K E  F+SDN+S ISIL DVL+KEATKK I L+ISYDIND S+ + LR+IHPK++  LLLAKKVQL+D L+EL+ +E     +FL  +Y  IL+ +  L E++KKQP HLERLYG+ITDL+IDK+KF+G++V++ V +L+++LD Y L +L+EFFN
Sbjct:   50 VKRLSFQPVFKTLPGQKICRMDLGGALGTPREKIFVCSGSQVRGFTKKGKQFLTFEANLTESINAMYVSGADLFVCASYIYNHYCDCKDQDYFLSGDKINDITCVSSEKLPHLTPVLACQDRVLRVLQGSTLAYDIEVPGPPSVLELYNKDAG---EEVLYGTTDGRLGLVQIGEHSAVAKWEIDNDNKKGGILCADAYDIVGDGVNDILVGRDDGTVQVYGFDSSNEPTLRFEHVLSESVTSIQGGCVGKESYDEVVTATYTGWVTGLTTES-------QKTEAAAGDEFRMSKETQSKVEALRAELEQLQGKVLQGREQYQQTTQSSTAVSAVPVFSINDKFTLCQDDASYSLTLEVQTAIDNLLLQSDVPIDLLDVDKNSAVVSFSECDPEQPNGNFLLATYRCQANTTRLELKVRSIEGQYGTLQAYITPRLQPKTCQVRQYQIKPLSLHQRTHSIDPARPMNRLSLVGQFSFAEIHSWVVFCLPEVPEK---TPAEDDITFYFRNTFLGTQLEATYCKGEGHFQSDNISTISILSDVLSKEATKKKINLNISYDINDDSVSHTLRMIHPKLEYQLLLAKKVQLVDALRELQVHEG--NASFLIPEYRSILDESASLLEEYKKQPAHLERLYGMITDLFIDKFKFKGQNVKTKVSSLLEILDNYDLNSLLEFFN 712          
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Planmine SMEST
Match: SMESG000005653.1 (SMESG000005653.1)

HSP 1 Score: 1330.85 bits (3443), Expect = 0.000e+0
Identity = 670/672 (99.70%), Postives = 671/672 (99.85%), Query Frame = 2
Query:  176 MKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDXXXXXXXXXXXXXXXNAKLAVKQNDSNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQDGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNSEKEF 2191
            MKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIEN+YVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEI YGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDLIIKLEEIKKEISELNAKLAVKQNDSNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQDGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNSEKEF
Sbjct:    1 MKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGKQFLRFSTNLSEKIENMYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQINAIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSNDGGLNGNEIFYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYDITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFGNANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDLIIKLEEIKKEISELNAKLAVKQNDSNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIECPVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQDGNCLLATYRCQANTTRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTIDNSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYESTFLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDINDKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDYCDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNLIQVLDTYKLENLIEFFNSEKEF 672          
The following BLAST results are available for this feature:
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
BBS70.000e+047.57Bardet-Biedl syndrome 7 [Source:HGNC Symbol;Acc:HG... [more]
BBS70.000e+047.57Bardet-Biedl syndrome 7 [Source:HGNC Symbol;Acc:HG... [more]
BBS78.947e-4356.12Bardet-Biedl syndrome 7 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
osm-122.415e-9829.62Bardet-Biedl syndrome 7 protein homolog [Source:U... [more]
back to top
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bbs70.000e+047.25Bardet-Biedl syndrome 7 [Source:ZFIN;Acc:ZDB-GENE-... [more]
bbs75.632e-10339.29Bardet-Biedl syndrome 7 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gfod20.000e+047.58glucose-fructose oxidoreductase domain containing ... [more]
gfod20.000e+047.38glucose-fructose oxidoreductase domain containing ... [more]
gfod20.000e+048.96glucose-fructose oxidoreductase domain containing ... [more]
back to top
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Bbs70.000e+047.80Bardet-Biedl syndrome 7 (human) [Source:MGI Symbol... [more]
Bbs70.000e+047.80Bardet-Biedl syndrome 7 (human) [Source:MGI Symbol... [more]
Bbs70.000e+047.81Bardet-Biedl syndrome 7 (human) [Source:MGI Symbol... [more]
Bbs72.253e-1246.97Bardet-Biedl syndrome 7 (human) [Source:MGI Symbol... [more]
back to top
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q8K2G4|BBS7_MOUSE0.000e+047.80Bardet-Biedl syndrome 7 protein homolog OS=Mus mus... [more]
sp|Q8IWZ6|BBS7_HUMAN0.000e+047.57Bardet-Biedl syndrome 7 protein OS=Homo sapiens OX... [more]
sp|Q9XW70|BBS7_CAEEL3.072e-9729.62Bardet-Biedl syndrome 7 protein homolog OS=Caenorh... [more]
back to top
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UUJ80.000e+050.14Bardet-Biedl syndrome 7 protein homolog OS=Capitel... [more]
A0A210QW020.000e+050.28Bardet-Biedl syndrome 7 protein-like OS=Mizuhopect... [more]
A0A1S3JTG60.000e+048.96Bardet-Biedl syndrome 7 protein homolog OS=Lingula... [more]
A0A1S3JU340.000e+049.17Bardet-Biedl syndrome 7 protein homolog OS=Lingula... [more]
A0A2R2MQG40.000e+048.42Bardet-Biedl syndrome 7 protein homolog OS=Lingula... [more]
back to top
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bbs70.000e+047.50Bardet-Biedl syndrome 7 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bbs70.000e+049.57Bardet-Biedl syndrome 7 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO416990.000e+049.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283241.091e-1131.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bbs70.000e+046.29Bardet-Biedl syndrome 7 [Source:NCBI gene;Acc:1011... [more]
bbs70.000e+047.49Bardet-Biedl syndrome 7 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Bardet-Biedl syndrome 7 protein homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000005653.10.000e+099.70SMESG000005653.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007234 ID=SMED30007234|Name=Bardet-Biedl syndrome 7 protein homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=2224bp
AGCATCATTTTAAATATTTTTTGATATGGACTTTACATTACAGAAAATTA
ATTATATTCAAACCGGTATAATTAATAAAGGATGTGCTAAACTAATTGAA
AATTCTTCAGATAGTTCACATTTATCTCAAAAAATTGTCATTGGAGATTT
TAATGGATTGATTCAGGTTTTCGGTATGAAAAAGTTTCAATCAAAAATTA
TTTTCAAACAAGAACTCGGCACGAAAGTATTACAGCTCATATTGGGTGGA
TCTACTGGTCAAATTAAAGAAAAATTATATCTAGCAATCGATACTAATAT
TTTGGGATTCACTAAAAAAGGAAAACAATTTTTGCGATTTTCTACAAATT
TATCTGAAAAGATTGAAAATATATACGTTGAAGACGTCAATTTGTTTGTT
ACAAGTAAATATATCTATCAAAGATATGTGAATTTGGAAGATCGAGATTA
CCTCCTATGTCCGGATCAAATCAATGCAATTATATGCTTGCCGTTGAGTA
AAAACAAAGAGGTCATACCAATCCTCGCTTGCAGAGATCGAGTTATACGG
ATTTTGAAGAACTCTGAAATCAAATATGAACTAGAAGTTGGGGGTCCACC
TAACGTGTTATGCCTTAATTCCAATGATGGCGGTTTGAATGGGAATGAAA
TTGTTTATGGGACAATCGATGGGAAAATTGGATTGGTTATAATTGACGAT
GAAAAACCGTTCCATAAATGGGAAATATCACCAGAAAATGAAGCTGGCTC
AGTGTCCTGCATCAGTTTTTATGATATAACCGGGGATGGGTTAAGTGAAA
TGTTAATTGGCCGAGAAGATGGTCAAGTTGAAGTGTATCATGTCAATGAT
TATGAAGAGCCCTTTCTAATTTATGAAACTAATCTCAATCAAACAATAAC
ATCAATTCATGGCGGAAAATTTGGAAATGCCAATTATTCAGAAATAATTT
GTACCACATATTCAGGCTGGGTTATTGGACTTACAACCGAAACAAGTGTT
AAATCAATTGACAATCAAGGAAACGTTGCAGCTGATCCCGATCTTATCAT
AAAATTGGAGGAAATAAAAAAAGAAATCTCAGAACTTAATGCAAAATTAG
CAGTGAAGCAAAACGACTCAAATAATTCTATGCCCAGTAAAATTTTAGCG
GGAAATATGCTAAATATGAATGAAAAATTCACTTTGTCACCACAAGAAGC
TGCGTATATTTTGTCAATTGAATGTCCGGTGTCAATTGACAATGTTCTCA
TACAAAGTGACACTGCCATTGACTTGTTGGATACAGAAAAGAATTCTGCA
GTTGTGAGCTTCAGTCAAGTTGACCATCAGGATGGTAACTGTTTACTAGC
AACATATCGGTGTCAGGCAAATACAACTAGGCTGGGCGTTAAAATTCGGA
GCATAGAAGGACAATATGGCAATATCAGAGTTTATGTTACACCAAAATCA
AGTGTTAAAACTTGTCAGATGCTCGTATTTCCTGTCAAGCCATTGTCATT
ACACAAAAGATCGCATACAATTGACAATTCCAGGCCATTCAATACATTGA
CTCTCCGAGGAAAGTTTTCATTGGCAGAAATGTACAGTTGGATTATATTT
TGTTTGCCGGAAACCCCTGAACGAATCGTCTCTACTGGTCCAGAAAATGT
TATCAATATTTGCTACGAATCAACATTTCTTCTGACTCAACTTGAATGCA
TTTGTCAAAAAGAAGAAGTCGTTTTTCGGTCAGACAATCTATCTGTAATT
TCTATTTTGAAAGATGTTTTAACCAAAGAAGCTACGAAAAAAGGAATTGC
TCTTGATATTAGTTACGACATAAATGATAAAAGTATTGAATATATACTTC
GTTTGATTCATCCCAAAATTGATTCGTTACTTTTGTTGGCCAAAAAGGTT
CAGTTGATAGATCCATTAAAAGAATTGAAAACTAACGAAAATGTTGAAGC
TGATACCTTTTTATCCAAAGATTACTGTGATATTTTAGAAAATGCTAATG
ACCTAAAAGAACAATTTAAAAAACAGCCGTGCCATTTAGAAAGACTTTAT
GGTATAATCACAGATTTGTATATCGACAAATACAAATTTCAAGGCAAAGA
TGTCCGTTCCAATGTCAAAAATCTTATTCAAGTCTTAGATACGTATAAAT
TAGAAAATTTAATTGAATTTTTCAATTCTGAAAAAGAATTTTAATTGAAT
TTACAATTACAAATTGTGATGTAG
back to top

protein sequence of SMED30007234-orf-1

>SMED30007234-orf-1 ID=SMED30007234-orf-1|Name=SMED30007234-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=723bp
MDFTLQKINYIQTGIINKGCAKLIENSSDSSHLSQKIVIGDFNGLIQVFG
MKKFQSKIIFKQELGTKVLQLILGGSTGQIKEKLYLAIDTNILGFTKKGK
QFLRFSTNLSEKIENIYVEDVNLFVTSKYIYQRYVNLEDRDYLLCPDQIN
AIICLPLSKNKEVIPILACRDRVIRILKNSEIKYELEVGGPPNVLCLNSN
DGGLNGNEIVYGTIDGKIGLVIIDDEKPFHKWEISPENEAGSVSCISFYD
ITGDGLSEMLIGREDGQVEVYHVNDYEEPFLIYETNLNQTITSIHGGKFG
NANYSEIICTTYSGWVIGLTTETSVKSIDNQGNVAADPDLIIKLEEIKKE
ISELNAKLAVKQNDSNNSMPSKILAGNMLNMNEKFTLSPQEAAYILSIEC
PVSIDNVLIQSDTAIDLLDTEKNSAVVSFSQVDHQDGNCLLATYRCQANT
TRLGVKIRSIEGQYGNIRVYVTPKSSVKTCQMLVFPVKPLSLHKRSHTID
NSRPFNTLTLRGKFSLAEMYSWIIFCLPETPERIVSTGPENVINICYEST
FLLTQLECICQKEEVVFRSDNLSVISILKDVLTKEATKKGIALDISYDIN
DKSIEYILRLIHPKIDSLLLLAKKVQLIDPLKELKTNENVEADTFLSKDY
CDILENANDLKEQFKKQPCHLERLYGIITDLYIDKYKFQGKDVRSNVKNL
IQVLDTYKLENLIEFFNSEKEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0001103RNA polymerase II repressing transcription factor binding
Vocabulary: biological process
TermDefinition
GO:0060173limb development
GO:0060271cilium morphogenesis
GO:1905515non-motile cilium assembly
GO:0001654eye development
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0006810transport
GO:0007224smoothened signaling pathway
GO:0007420brain development
GO:0007507heart development
GO:0008104protein localization
GO:0015031protein transport
GO:0030030cell projection organization
GO:0032436positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0045444fat cell differentiation
GO:0046907intracellular transport
GO:0060021palate development
Vocabulary: cellular component
TermDefinition
GO:0001750photoreceptor outer segment
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005929cilium
GO:0005930axoneme
GO:0016020membrane
GO:0034464BBSome
GO:0036064ciliary basal body
GO:0042995cell projection
GO:0060170ciliary membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 344..364
NoneNo IPR availablePANTHERPTHR16074FAMILY NOT NAMEDcoord: 1..719
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 35..314