Death domain-containing protein

Overview
NameDeath domain-containing protein
Smed IDSMED30007217
Length (bp)2747
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Death domain-containing protein (SMED30007217) t-SNE clustered cells

Violin plots show distribution of expression levels for Death domain-containing protein (SMED30007217) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Death domain-containing protein (SMED30007217) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Death domain-containing protein (SMED30007217) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007217

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007217SMESG000078437.1 SmedASXL_010485SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30007217SMESG000078437.1 dd_Smed_v4_7428_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30007217SMESG000078437.1 dd_Smed_v4_7428_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007217SMESG000078437.1 dd_Smed_v4_7428_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007217SMESG000078437.1 dd_Smed_v4_7428_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30007217SMESG000078437.1 dd_Smed_v4_7428_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30007217SMESG000078437.1 dd_Smed_v6_7428_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007217SMESG000078437.1 dd_Smed_v4_7428_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Death domain-containing protein vs. TrEMBL
Match: A0A1S3IPS7 (uncharacterized protein LOC106166271 OS=Lingula unguis OX=7574 GN=LOC106166271 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.681e-17
Identity = 59/140 (42.14%), Postives = 81/140 (57.86%), Query Frame = 2
Query: 2162 KPRTINYNRINGLSRPRFTNK-----VIEKEPKIISRRSFLALASTIRQGLKLAVYLSIPDNAIAGIGFDALSQMTMNGSN--NTTYKILILWKKMISYNKTKEKDYVEQLVYGLKSIGYENVGELVYEKWMKQQEITID 2560
            +P+T+ Y      S  R T        + KE K +S RS + LA  I QGL LAVYL IPD+ I GIGFDALS    NG +  + TYKIL+ WK+     KTK++  VE+L YGL+ +G  +V  ++ E+  +  E+T D
Sbjct:  573 RPKTVTYRNFESESFMRITQSKRAKISVPKESKTMSGRSLMTLAKEIEQGLTLAVYLDIPDSTITGIGFDALS----NGLSLIDVTYKILMYWKR-----KTKKERQVEELAYGLRGMGRPDVAAVLMERHKQNLELTPD 703          

HSP 2 Score: 83.9593 bits (206), Expect = 9.265e-13
Identity = 127/549 (23.13%), Postives = 235/549 (42.81%), Query Frame = 2
Query:  173 GSNSSLTDEDNIPDVI-----KHKLENLRIETRLINNKLIKLGKNLAVIAKDIAAKRLLKISVQTINFASLSFSQPIIPERGRLITDIFQIDVLSNKSE-----ILPKSELNISYKIKCDNIDNYCYPLIYESQQWKI--LKQYEIENDCIKINNGSFDFITIVKEPPNDIISISPTGGLLYTKLDPLISLRVAKGNFKEEIMCKIQICDMPMENLDQFKPLRDNDLSPFLNMSNLFVIGISDPNSNFVNQASDFRRPITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINEWNFVESNLKFTKNSIEFDIKHFGSFLFVKCRENRELKLCQNMNIVE---NLIQIENGIILTFLWMKSNNWFLWTEIVPVSKIKETRSKLENLGFVYVEQYYEPLKLEETRNNSKYKRKFS--RAELIQRKT----FELLENLQFKLKINGEIE-------QVENYQKKELNPQISNNENIDPADDIPLENDN-NFD---EFDKIGIKEQTQNLENKEQKKPFDISFHKNLSSSNYTVVPIKPVRRS 1723
            G      DED +P V      K    NL +  +L       +  N     KD     LL  S + I+  SL+  +        L ++IF  +    K +     ILP  E++ +Y    D +     P   E+ +W+   +   + E   +   + +     IV     +   ISP G +   K+   IS+R  K   +  ++C IQI       L   K     +   FL  +++F    + P         DF+RP+TM+LPL     S+ EE   ++++I             + K++  W  +E+ LKFT+ ++ FD+K F  F   K R  R+  L + + I+E   N I++++   +  + ++   W +  + V   K  +  +K +  G+V ++      + E+  N+S + R  S  R + +++K+     E  +  +  LK+ GE++         EN  + E++ +  N+EN    ++   +ND  NFD   + + IG+K      ++++ K+ +D  F  +L   +Y    I+PV  +
Sbjct:   18 GHGEERKDEDAVPPVQCSPWKKGGDFNLPLHGKLT------IPPNCLQGKKDAITCTLLTPSDRNIHMPSLTRDE-------HLASEIFLFEFNGTKMKGSLVFILPYYEVDYTY---YDIVLKQKKP---EADEWESIDMTSSDAEKRLVTFESETLGAFAIVSRLKLESFDISPQGCIYNAKIGKYISIRFPKKATETPLLCGIQIHPTDQNQLQVIKSEHPTEFYEFLGATDIFEFRHNGPRP-------DFKRPVTMKLPL----TSVFEEDE-NTEDIC-----------IMLKTVKGWEVLENPLKFTRQNVSFDVKIFTKFCIAKSRPGRQRCLPEALKIIEERSNKIKVDH---VAMVKLEQKYWSILVQCVQKDKRDDIVAKRKEKGWVEIK--LPETETEQDDNSSGFPRFNSRRRHKPVEQKSGCKDTEYADGKEILLKLQGEVQVKVKPVAPPEN--EMEVDGEGENDENKASEEN---KNDKVNFDLQSKLNSIGLK------DDEKPKEDYDSLFFNSLLPESYKKYEIEPVHST 508          
BLAST of Death domain-containing protein vs. TrEMBL
Match: K1PQA4 (Death domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10007323 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.611e-15
Identity = 79/314 (25.16%), Postives = 142/314 (45.22%), Query Frame = 2
Query:  581 DC-IKINNGSFDFITIVKEPPNDIISISPTGGLLYTKLDPLISLRVAKGNFKEEIMCKIQICDMPMENLDQFKPLRDNDLSPFLNMSNLFVIGISDPNSNFVNQASDFRRPITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINEWNFVESNLKFTKNSIEFDIKHFGSFLFVKCRENRELKLCQNMNIVENLIQIENGIILTFLWMKSNNWFLWTEIVPVSKIKETRSKLENLGFVYVEQYYEPLKLEETRNNSKYKRKFSRA--ELIQRKTFELLENLQFK------LKINGEIEQVENYQ 1495
            DC +++         +   P  +I  ++P G L    +   IS+R  K    +   C IQI  +P + L   K L   + +  +  +    +  S P          F+R ++++LPLP  V   +EE+N D                 LQK+ N W  V+S  KFT+ ++ FD K    F  ++ + +R+ +L     ++EN    E G I+ FL ++   WFL  E +P SK++    ++   GF +V +  E +K +E  N  +  +KF +   +L    T E+ + ++++      +K+N E   +EN +
Sbjct:  176 DCSVELEVDRLGIFIVTFTPKKEIFDVTPQGCLYNAHISRYISVRFPKKAHDKPFQCAIQINPIPSDKLQLAKELSPGETADLILATEFIDLIPSTP--------CVFKRAVSVKLPLPTGVE--VEEENDD--------------IAVLQKTENGWELVDSKYKFTRTTVTFDTKSLTKFCVMQSKPDRKKRLPPAAQVLENRNNREKGEIVAFLNLQEKLWFLVLECMPQSKLESRVKEMSEKGFKHVVK--EIVKKDEGTNFFRRPQKFQQPTRQLQVPPTCEINDGMKWEFSVVDDIKVNSESNYMENRE 463          

HSP 2 Score: 80.8777 bits (198), Expect = 8.245e-12
Identity = 43/114 (37.72%), Postives = 71/114 (62.28%), Query Frame = 2
Query: 2225 VIEKEPKIISRRSFLALASTIRQGLKLAVYLSIPDNAIAGIGFDALSQMTMNGSN--NTTYKILILWKKMISYNKTKEKDYVEQLVYGLKSIGYENVGELVYEKWMKQQEITID 2560
            +IE+E K++S +S   L+  + +GL LAV+L++PD+ I G+GFDA+S    NG +  + TYKIL+ WK+M    K K+   V  L   L+ +G E +  +V+E+    +E++ D
Sbjct:  585 IIERESKVLSGKSLRNLSKLVPEGLTLAVHLNLPDSTITGLGFDAIS----NGLSMADVTYKILLYWKRMC---KDKKDGAVNSLTNALRDMGREEIANIVFERHRDNKELSPD 691          
BLAST of Death domain-containing protein vs. TrEMBL
Match: A0A267DP82 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000188g4 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 9.183e-15
Identity = 68/255 (26.67%), Postives = 118/255 (46.27%), Query Frame = 2
Query:  536 ESQQWKILKQYEIENDCIK-INNGSFDFITIVKEPPNDIISISPTGGLLYTKLDPLISLRVAKGNFKEEIMCKIQICDMPMENLDQFKPLRDNDLSPFLNMSNLFVIGISDPNSNFVNQASDFRRPITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINE-WNFVE--SNLKFTKNSIEFDIKHFGSFLFVKCRENRELKLCQNMNIVENLIQIENGIILTFLWMKSNNWFLWTEIVPVSKIKE 1288
            +S++W  ++  E +N  I  I   S  ++ I+  P ++   +SP G LL  KLDP++S+R+ K    E + C   I  +P  + ++    R    S  +++ +L       P  NF     +F+RPIT++LPLP W++S     +                FY  +  + E W  ++  S+LK TKNSI F+ +H   + F      +  +    M ++ +L     G IL F  ++   W L  +  P ++I E
Sbjct:  236 DSERWTTMEVTEEDNKSITCIVTASGIYVAILS-PLSETFQVSPNGALLNLKLDPIVSVRIPKRGCSEALDCCFSI--IPFSD-ERLTLARRTHPSQTMDIRSL------SPVYNFNYPGGEFKRPITLKLPLPQWLLS---SGDSAGAPASAADSASVTIFYQPRPGLAEPWRILDPGSSLKLTKNSISFEARHLTRYCFASVSPTKAQRASLAMPLLCSLNTAMEGEILLFAKLEDRRWRLCVDCAPRNEIVE 477          

HSP 2 Score: 75.8702 bits (185), Expect = 3.804e-10
Identity = 43/134 (32.09%), Postives = 67/134 (50.00%), Query Frame = 2
Query: 2126 KLYYKKNILVEEKPRTINYNRINGLSRPRFTNKVIEKEPKIISRRSFLALASTIRQGLKLAVYLSIPDNAIAGIGFDALSQMTMNGSNNTTYKILILWKKMISYNKTKEKDYVEQLVYGLKSIGYENVGELVYE 2527
            +L  + N L   + R  ++ R+    R +       +E K +S RS   L+  +RQGL LAV+L +P++AI GIGFD LS        + TYKIL  WK+ +     +      QL   L S+G  ++  ++ E
Sbjct:  711 RLRLRVNELDAAQARIESFQRLTAPRR-QLQAPTSTRESKALSVRSLQTLSEHVRQGLTLAVHLCLPESAITGIGFDVLSAGGATSVASVTYKILTRWKRSVPL--PERGSMARQLADALASMGRPDLARVLLE 841          
BLAST of Death domain-containing protein vs. TrEMBL
Match: R7TUB7 (Death domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_221462 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.911e-14
Identity = 69/282 (24.47%), Postives = 130/282 (46.10%), Query Frame = 2
Query:  662 PTGGLLY-TKLDPLISLRVAKGNFKEEIMCKIQICDMPMENLDQFKPLRD--NDLSPFLNMSNLFVIGISDPNSNFVNQASDFRRPITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINEWNFVESNLKFTKNSIEFDIKHFGSFLFVKCRENRELKLCQNMNIVENLIQIENGIILTFLWMKSNNWFLWTEIVPVSKIKETRSKLENLGFVYVEQYYEPLKLEET-----RNNSKYKRKF---SRAELIQRKTFELLENLQFKLKINGEI 1474
            P  G LY + L   +S+R  K     +I C+IQI  +  +N+     LRD  +D++  L  S++F I  S         A ++RR +T++LPLP      +++++F   +I             +Q +   W  +E+ +KFTK+S+ FD K    +     +  R  +L +    +E    +  G ++ FL ++   W LW E +P+ ++     K    GFV V    + L+ E+      R   + +RK    +  + ++RK  + +    F + ++G++
Sbjct:  275 PVQGCLYNSTLSHQVSVRFPKKATDVDITCEIQITSLNRDNMPNL--LRDFPHDMADLLVASDIFTIKPS--------VAREYRRALTIKLPLPQ-----MDDEDFPKDDI-----------GVMQMTDAGWELIEAPIKFTKSSVMFDTKFLTKYCVALAKPGRRKRLKEAFKHLEAENCVVRGDVVAFLHLQEKLWTLWMECIPIERLAAVTEKRLKQGFVKVRVTEDYLQQEDASKPVFRQTWRSRRKQPVETEEKKVKRKDLDFVNGKVFNVDVSGDV 530          

HSP 2 Score: 84.7297 bits (208), Expect = 5.633e-13
Identity = 51/136 (37.50%), Postives = 81/136 (59.56%), Query Frame = 2
Query: 2153 VEEKPRTINYNRINGLSRPRFTNKVIEKEPKIISRRSFLALASTIRQGLKLAVYLSIPDNAIAGIGFDALSQMTMNGSN--NTTYKILILWKKMISYNKTKEKDYVEQLVYGLKSIGYENVGELVYEKWMKQQEIT 2554
            +++K  T ++ R+  L+RP    + I +E KI++ RS + LA  I QGL LA++L I D+ I G+GFDAL+    NG +  + TY+IL+LWK+  S  + K    V+ LV  L+ +G  +   +V E+    QE+T
Sbjct:  641 IQKKQSTSSFARLTALTRP---PRQIIRESKILTGRSLMNLAKEIEQGLTLAIHLDISDSCITGMGFDALA----NGFSLVDITYRILLLWKRK-SGLRFKGDRQVQALVQALEEMGRRDTARVVAEQHKLNQELT 768          
BLAST of Death domain-containing protein vs. TrEMBL
Match: A0A267DB08 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000188g6 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.201e-13
Identity = 68/255 (26.67%), Postives = 113/255 (44.31%), Query Frame = 2
Query:  536 ESQQWKILKQYEIENDCIK-INNGSFDFITIVKEPPNDIISISPTGGLLYTKLDPLISLRVAKGNFKEEIMCKIQICDMPMENLDQFKPLRDNDLSPFLNMSNLFVIGISDPNSNFVNQASDFRRPITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINE-WNFVE--SNLKFTKNSIEFDIKHFGSFLFVKCRENRELKLCQNMNIVENLIQIENGIILTFLWMKSNNWFLWTEIVPVSKIKE 1288
            +S+ W  ++  E +N  I  I   S  ++ I+  P ++   +SP G LL  KLDP++S+R+ K    E + C   I     E L      R    S  +++ +L       P  NF     +F+RPIT++LPLP W++S     +                FY  +  + E W  ++  S+LK TKNSI F+ +H   + F      +  +    M ++ +      G IL F  ++   W L  +  P ++I E
Sbjct:  170 DSESWTTMEVTEEDNKSITCIVTASGIYVAILS-PLSETFQVSPNGALLNLKLDPIVSVRIPKRGCSEALDCCFSIIPFSDERLTL---ARRKHPSQTMDIRSL------SPVYNFNYPGGEFKRPITLKLPLPQWLLS---SGDSAGAPASAADSASVTIFYQPRPGLAEPWRILDPGSSLKLTKNSISFEARHLTRYCFASVSPTKVQRASLAMPLLCSWNTAMEGEILLFAKLEDRRWRLCVDCAPRNEIVE 411          
BLAST of Death domain-containing protein vs. Planmine SMEST
Match: SMESG000078437.1 (SMESG000078437.1)

HSP 1 Score: 1563.51 bits (4047), Expect = 0.000e+0
Identity = 810/811 (99.88%), Postives = 810/811 (99.88%), Query Frame = 2
Query:  161 MTVKGSNSSLTDEDNIPDVIKHKLENLRIETRLINNKLIKLGKNLAVIAKDIAAKRLLKISVQTINFASLSFSQPIIPERGRLITDIFQIDVLSNKSEILPKSELNISYKIKCDNIDNYCYPLIYESQQWKILKQYEIENDCIKINNGSFDFITIVKEPPNDIISISPTGGLLYTKLDPLISLRVAKGNFKEEIMCKIQICDMPMENLDQFKPLRDNDLSPFLNMSNLFVIGISDPNSNFVNQASDFRRPITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINEWNFVESNLKFTKNSIEFDIKHFGSFLFVKCRENRELKLCQNMNIVENLIQIENGIILTFLWMKSNNWFLWTEIVPVSKIKETRSKLENLGFVYVEQYYEPLKLEETRNNSKYKRKFSRAELIQRKTFELLENLQFKLKINGEIEQVENYQKKELNPQISNNENIDPADDIPLENDNNFDEFDKIGIKEQTQNLENKEQKKPFDISFHKNLSSSNYTVVPIKPVRRSLPEWETLVLTKIDKQSIYENRNSCQSQENPTFASNNIESDIDNDLVAPISQESLKISRLTXXXXXXXXXXXIHLENVNSDSEIKIPLQIFKFYIPVDKMKCYYXXXXXXXXXXXXXXXXXLAIKVEKERQIEKEKLYYKKNILVEEKPRTINYNRINGLSRPRFTNKVIEKEPKIISRRSFLALASTIRQGLKLAVYLSIPDNAIAGIGFDALSQMTMNGSNNTTYKILILWKKMISYNKTKEKDYVEQLVYGLKSIGYENVGELVYEKWMKQQEITIDDCQRCLLQTIF 2593
            MTVKGSNSSLTDEDNIPDVIKHKLENLRIETRLINNKLIKLGKNLAVIAKDIAAKRLLKISVQTINFASLSFSQPIIPERGRLITDIFQIDVLSNKSEILPKSELNISYKIKCDNIDNYCYPLIYESQQWKILKQYEIENDCIKINNGSFDFITIVKEPPNDIISISPTGGLLYTKLDPLISLRVAKGNFKEEIMCKIQICDMPMENLDQFKPLRDNDLS FLNMSNLFVIGISDPNSNFVNQASDFRRPITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINEWNFVESNLKFTKNSIEFDIKHFGSFLFVKCRENRELKLCQNMNIVENLIQIENGIILTFLWMKSNNWFLWTEIVPVSKIKETRSKLENLGFVYVEQYYEPLKLEETRNNSKYKRKFSRAELIQRKTFELLENLQFKLKINGEIEQVENYQKKELNPQISNNENIDPADDIPLENDNNFDEFDKIGIKEQTQNLENKEQKKPFDISFHKNLSSSNYTVVPIKPVRRSLPEWETLVLTKIDKQSIYENRNSCQSQENPTFASNNIESDIDNDLVAPISQESLKISRLTEEEKEFSFFSEIHLENVNSDSEIKIPLQIFKFYIPVDKMKCYYKIKTKEEKQKEEKEIETLAIKVEKERQIEKEKLYYKKNILVEEKPRTINYNRINGLSRPRFTNKVIEKEPKIISRRSFLALASTIRQGLKLAVYLSIPDNAIAGIGFDALSQMTMNGSNNTTYKILILWKKMISYNKTKEKDYVEQLVYGLKSIGYENVGELVYEKWMKQQEITIDDCQRCLLQTIF
Sbjct:    1 MTVKGSNSSLTDEDNIPDVIKHKLENLRIETRLINNKLIKLGKNLAVIAKDIAAKRLLKISVQTINFASLSFSQPIIPERGRLITDIFQIDVLSNKSEILPKSELNISYKIKCDNIDNYCYPLIYESQQWKILKQYEIENDCIKINNGSFDFITIVKEPPNDIISISPTGGLLYTKLDPLISLRVAKGNFKEEIMCKIQICDMPMENLDQFKPLRDNDLSSFLNMSNLFVIGISDPNSNFVNQASDFRRPITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINEWNFVESNLKFTKNSIEFDIKHFGSFLFVKCRENRELKLCQNMNIVENLIQIENGIILTFLWMKSNNWFLWTEIVPVSKIKETRSKLENLGFVYVEQYYEPLKLEETRNNSKYKRKFSRAELIQRKTFELLENLQFKLKINGEIEQVENYQKKELNPQISNNENIDPADDIPLENDNNFDEFDKIGIKEQTQNLENKEQKKPFDISFHKNLSSSNYTVVPIKPVRRSLPEWETLVLTKIDKQSIYENRNSCQSQENPTFASNNIESDIDNDLVAPISQESLKISRLTEEEKEFSFFSEIHLENVNSDSEIKIPLQIFKFYIPVDKMKCYYKIKTKEEKQKEEKEIETLAIKVEKERQIEKEKLYYKKNILVEEKPRTINYNRINGLSRPRFTNKVIEKEPKIISRRSFLALASTIRQGLKLAVYLSIPDNAIAGIGFDALSQMTMNGSNNTTYKILILWKKMISYNKTKEKDYVEQLVYGLKSIGYENVGELVYEKWMKQQEITIDDCQRCLLQTIF 811          
BLAST of Death domain-containing protein vs. Planmine SMEST
Match: SMESG000078437.1 (SMESG000078437.1)

HSP 1 Score: 1552.73 bits (4019), Expect = 0.000e+0
Identity = 807/811 (99.51%), Postives = 808/811 (99.63%), Query Frame = 2
Query:  161 MTVKGSNSSLTDEDNIPDVIKHKLENLRIETRLINNKLIKLGKNLAVIAKDIAAKRLLKISVQTINFASLSFSQPIIPERGRLITDIFQIDVLSNKSEILPKSELNISYKIKCDNIDNYCYPLIYESQQWKILKQYEIENDCIKINNGSFDFITIVKEPPNDIISISPTGGLLYTKLDPLISLRVAKGNFKEEIMCKIQICDMPMENLDQFKPLRDNDLSPFLNMSNLFVIGISDPNSNFVNQASDFRRPITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINEWNFVESNLKFTKNSIEFDIKHFGSFLFVKCRENRELKLCQNMNIVENLIQIENGIILTFLWMKSNNWFLWTEIVPVSKIKETRSKLENLGFVYVEQYYEPLKLEETRNNSKYKRKFSRAELIQRKTFELLENLQFKLKINGEIEQVENYQKKELNPQISNNENIDPADDIPLENDNNFDEFDKIGIKEQTQNLENKEQKKPFDISFHKNLSSSNYTVVPIKPVRRSLPEWETLVLTKIDKQSIYENRNSCQSQENPTFASNNIESDIDNDLVAPISQESLKISRLTXXXXXXXXXXXIHLENVNSDSEIKIPLQIFKFYIPVDKMKCYYXXXXXXXXXXXXXXXXXLAIKVEKERQIEKEKLYYKKNILVEEKPRTINYNRINGLSRPRFTNKVIEKEPKIISRRSFLALASTIRQGLKLAVYLSIPDNAIAGIGFDALSQMTMNGSNNTTYKILILWKKMISYNKTKEKDYVEQLVYGLKSIGYENVGELVYEKWMKQQEITIDDCQRCLLQTIF 2593
            MTVKGSNSSLTDEDNIPDVIKHKLE  +IETRLINNKLIKLGKNLAVIAKDIAAKRLLKISVQTINFASLSFSQPIIPERGRLITDIFQIDVLSNKSEILPKSELNISYKIKCDNIDNYCYPLIYESQQWKILKQYEIENDCIKINNGSFDFITIVKEPPNDIISISPTGGLLYTKLDPLISLRVAKGNFKEEIMCKIQICDMPMENLDQFKPLRDNDLS FLNMSNLFVIGISDPNSNFVNQASDFRRPITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINEWNFVESNLKFTKNSIEFDIKHFGSFLFVKCRENRELKLCQNMNIVENLIQIENGIILTFLWMKSNNWFLWTEIVPVSKIKETRSKLENLGFVYVEQYYEPLKLEETRNNSKYKRKFSRAELIQRKTFELLENLQFKLKINGEIEQVENYQKKELNPQISNNENIDPADDIPLENDNNFDEFDKIGIKEQTQNLENKEQKKPFDISFHKNLSSSNYTVVPIKPVRRSLPEWETLVLTKIDKQSIYENRNSCQSQENPTFASNNIESDIDNDLVAPISQESLKISRLTEEEKEFSFFSEIHLENVNSDSEIKIPLQIFKFYIPVDKMKCYYKIKTKEEKQKEEKEIETLAIKVEKERQIEKEKLYYKKNILVEEKPRTINYNRINGLSRPRFTNKVIEKEPKIISRRSFLALASTIRQGLKLAVYLSIPDNAIAGIGFDALSQMTMNGSNNTTYKILILWKKMISYNKTKEKDYVEQLVYGLKSIGYENVGELVYEKWMKQQEITIDDCQRCLLQTIF
Sbjct:    1 MTVKGSNSSLTDEDNIPDVIKHKLE--KIETRLINNKLIKLGKNLAVIAKDIAAKRLLKISVQTINFASLSFSQPIIPERGRLITDIFQIDVLSNKSEILPKSELNISYKIKCDNIDNYCYPLIYESQQWKILKQYEIENDCIKINNGSFDFITIVKEPPNDIISISPTGGLLYTKLDPLISLRVAKGNFKEEIMCKIQICDMPMENLDQFKPLRDNDLSSFLNMSNLFVIGISDPNSNFVNQASDFRRPITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINEWNFVESNLKFTKNSIEFDIKHFGSFLFVKCRENRELKLCQNMNIVENLIQIENGIILTFLWMKSNNWFLWTEIVPVSKIKETRSKLENLGFVYVEQYYEPLKLEETRNNSKYKRKFSRAELIQRKTFELLENLQFKLKINGEIEQVENYQKKELNPQISNNENIDPADDIPLENDNNFDEFDKIGIKEQTQNLENKEQKKPFDISFHKNLSSSNYTVVPIKPVRRSLPEWETLVLTKIDKQSIYENRNSCQSQENPTFASNNIESDIDNDLVAPISQESLKISRLTEEEKEFSFFSEIHLENVNSDSEIKIPLQIFKFYIPVDKMKCYYKIKTKEEKQKEEKEIETLAIKVEKERQIEKEKLYYKKNILVEEKPRTINYNRINGLSRPRFTNKVIEKEPKIISRRSFLALASTIRQGLKLAVYLSIPDNAIAGIGFDALSQMTMNGSNNTTYKILILWKKMISYNKTKEKDYVEQLVYGLKSIGYENVGELVYEKWMKQQEITIDDCQRCLLQTIF 809          
BLAST of Death domain-containing protein vs. Planmine SMEST
Match: SMESG000007063.1 (SMESG000007063.1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.037e-17
Identity = 56/206 (27.18%), Postives = 99/206 (48.06%), Query Frame = 2
Query:  515 YCY--PLIYESQQWKILKQYEIENDCIKINNGSFDFITIVKEPPNDIISISPTGGLLYTKLDPLISLRVAKGNFKEEIMCKIQICDMPMENLDQFKPLRDNDLSPFLNMSNLFVIGISDPNSNFVNQASDFRRPITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINEWNFVESNLKFTKNSIEFDIKHFGSFLF 1126
            YC+      E+ QW  + +++  ++ IK ++  + +  IV++ P + ISI+  GGL  T++ P++SLR+ K + + +    +Q    P    D+       +L   LN S++   G           +  F+R IT++LPLP W   I        KN   +QK  +     L K    W  +++ + +TKN+  FD K FG+F+ 
Sbjct:  138 YCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFP---------SLQFKRHITIKLPLPVWAEEI-------RKNCENNQKGGE--LMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFIL 325          
BLAST of Death domain-containing protein vs. Planmine SMEST
Match: SMESG000007063.1 (SMESG000007063.1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.080e-17
Identity = 56/206 (27.18%), Postives = 99/206 (48.06%), Query Frame = 2
Query:  515 YCY--PLIYESQQWKILKQYEIENDCIKINNGSFDFITIVKEPPNDIISISPTGGLLYTKLDPLISLRVAKGNFKEEIMCKIQICDMPMENLDQFKPLRDNDLSPFLNMSNLFVIGISDPNSNFVNQASDFRRPITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINEWNFVESNLKFTKNSIEFDIKHFGSFLF 1126
            YC+      E+ QW  + +++  ++ IK ++  + +  IV++ P + ISI+  GGL  T++ P++SLR+ K + + +    +Q    P    D+       +L   LN S++   G           +  F+R IT++LPLP W   I        KN   +QK  +     L K    W  +++ + +TKN+  FD K FG+F+ 
Sbjct:  127 YCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFP---------SLQFKRHITIKLPLPVWAEEI-------RKNCENNQKGGE--LMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFIL 314          
BLAST of Death domain-containing protein vs. Planmine SMEST
Match: SMESG000007063.1 (SMESG000007063.1)

HSP 1 Score: 87.4261 bits (215), Expect = 3.279e-17
Identity = 56/206 (27.18%), Postives = 99/206 (48.06%), Query Frame = 2
Query:  515 YCY--PLIYESQQWKILKQYEIENDCIKINNGSFDFITIVKEPPNDIISISPTGGLLYTKLDPLISLRVAKGNFKEEIMCKIQICDMPMENLDQFKPLRDNDLSPFLNMSNLFVIGISDPNSNFVNQASDFRRPITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINEWNFVESNLKFTKNSIEFDIKHFGSFLF 1126
            YC+      E+ QW  + +++  ++ IK ++  + +  IV++ P + ISI+  GGL  T++ P++SLR+ K + + +    +Q    P    D+       +L   LN S++   G           +  F+R IT++LPLP W   I        KN   +QK  +     L K    W  +++ + +TKN+  FD K FG+F+ 
Sbjct:  129 YCFLISCTTENFQWVAMTKFDFTSEGIKFSSDKWGYFAIVEKQPFENISINFNGGLFNTRVHPMVSLRIPKNSCQADETIYLQYLQNPTSTFDEMSDCYPYELGNILNASSMISFGFP---------SLQFKRHITIKLPLPVWAEEI-------RKNCENNQKGGE--LMLLCKRQGTWESIDARINYTKNTFTFDSKVFGTFIL 316          
The following BLAST results are available for this feature:
BLAST of Death domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IPS71.681e-1742.14uncharacterized protein LOC106166271 OS=Lingula un... [more]
K1PQA41.611e-1525.16Death domain-containing protein OS=Crassostrea gig... [more]
A0A267DP829.183e-1526.67Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
R7TUB72.911e-1424.47Death domain-containing protein OS=Capitella telet... [more]
A0A267DB081.201e-1326.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Death domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Death domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078437.10.000e+099.88SMESG000078437.1[more]
SMESG000078437.10.000e+099.51SMESG000078437.1[more]
SMESG000007063.13.037e-1727.18SMESG000007063.1[more]
SMESG000007063.13.080e-1727.18SMESG000007063.1[more]
SMESG000007063.13.279e-1727.18SMESG000007063.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007217 ID=SMED30007217|Name=Death domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2747bp
GAAAGAGCGATTGCATAAAAAAGACCTATCGTCATTGTTATACTGAATCC
AAATAGAAAATTACACATCGTGATTTGATGTAAATTTCAGTTTTATTTTC
GATTGAAAATTGTTTTTCGATTAGTTGATTTGAAAGTTTTTTGTTTTATT
CTATTGAATTATGACTGTCAAAGGGAGTAATAGTTCACTGACCGATGAAG
ACAATATTCCAGATGTAATCAAGCATAAATTGGAAAATTTAAGAATAGAG
ACGAGACTTATTAATAATAAGCTAATTAAACTTGGGAAAAACTTAGCGGT
CATTGCCAAAGATATTGCTGCTAAAAGACTTCTAAAAATTTCAGTTCAAA
CAATAAATTTTGCCAGCCTATCATTCAGTCAACCTATTATCCCTGAACGT
GGGAGGTTGATAACAGATATCTTTCAGATAGACGTTTTGAGTAACAAAAG
CGAAATACTACCCAAATCAGAGTTAAATATCAGCTATAAAATCAAATGTG
ACAATATTGATAACTATTGTTATCCTTTAATATATGAATCTCAACAATGG
AAGATATTGAAACAATATGAAATAGAAAATGATTGTATTAAAATTAACAA
TGGATCATTTGACTTTATAACAATTGTTAAAGAACCTCCAAATGATATCA
TAAGTATTTCACCTACTGGAGGATTATTGTACACTAAATTAGATCCTCTA
ATCTCGTTGAGAGTCGCCAAAGGAAATTTTAAAGAAGAAATTATGTGCAA
AATTCAGATTTGCGATATGCCTATGGAAAATTTGGATCAATTTAAACCTT
TACGAGATAATGATCTCTCACCATTTCTAAACATGTCAAACCTGTTTGTC
ATTGGGATTTCGGACCCGAATTCAAATTTTGTAAACCAAGCCTCCGATTT
TCGTCGGCCAATTACCATGAGGTTACCGCTACCGGACTGGGTCATTTCAA
TAATAGAAGAACAAAACTTCGATTCAAAAAATATTATTAAAGATCAGAAA
AAAGAAAAACCCGGATTTTATTTTTTACAAAAATCAATTAACGAGTGGAA
TTTTGTTGAGAGTAATTTAAAATTTACTAAAAATTCAATTGAATTTGACA
TCAAACATTTTGGAAGTTTCCTATTTGTCAAATGCCGAGAGAATCGAGAG
TTGAAATTGTGCCAAAATATGAACATTGTGGAAAATCTAATTCAAATCGA
AAATGGAATTATTTTGACATTTTTATGGATGAAATCAAACAACTGGTTTT
TGTGGACTGAAATCGTTCCTGTTTCCAAAATTAAAGAAACTCGGTCAAAA
TTGGAAAATCTAGGATTTGTCTACGTTGAACAATATTATGAACCTCTGAA
ATTGGAGGAAACAAGAAATAATTCCAAGTACAAGCGAAAATTTTCGAGAG
CAGAATTAATACAAAGGAAAACATTTGAATTGCTTGAAAATCTACAATTT
AAATTAAAAATTAATGGCGAAATAGAACAAGTGGAGAATTATCAAAAAAA
AGAACTTAATCCACAAATTAGTAACAATGAAAATATTGACCCAGCAGACG
ATATACCCTTGGAAAATGATAATAACTTCGATGAATTTGATAAAATAGGG
ATCAAAGAACAAACTCAAAATTTGGAAAATAAAGAACAAAAGAAACCTTT
TGATATTTCATTTCATAAAAATTTATCCAGTTCAAATTACACCGTAGTCC
CAATAAAACCGGTAAGAAGAAGTCTTCCTGAATGGGAGACCCTTGTTTTA
ACTAAAATTGATAAACAGTCAATTTATGAAAACAGAAATTCATGTCAATC
TCAAGAAAATCCAACATTTGCATCGAATAATATTGAAAGTGATATTGACA
ACGATTTGGTGGCCCCGATCTCACAAGAGTCACTAAAAATATCAAGATTA
ACCGAGGAAGAGAAAGAATTTAGTTTTTTCTCAGAAATTCACCTTGAAAA
TGTTAATTCAGATTCAGAAATCAAAATTCCTCTACAAATATTTAAATTTT
ATATTCCAGTTGATAAAATGAAGTGTTATTATAAAATTAAAACGAAAGAA
GAAAAACAAAAAGAAGAAAAAGAAATTGAAACACTGGCAATTAAGGTGGA
GAAAGAGCGCCAAATAGAAAAGGAAAAATTATATTACAAAAAAAATATTT
TAGTTGAAGAAAAACCGAGGACAATTAATTATAATCGCATCAATGGATTA
TCAAGGCCAAGATTTACTAATAAGGTAATTGAGAAGGAGCCTAAAATAAT
TTCAAGGCGAAGTTTTTTGGCGCTGGCTTCAACTATTCGACAAGGTTTGA
AATTGGCAGTTTATTTGTCAATTCCAGATAACGCAATCGCAGGAATTGGA
TTCGACGCTCTATCGCAAATGACAATGAATGGGTCCAATAACACTACATA
TAAAATTTTGATTTTATGGAAAAAGATGATATCGTACAATAAAACAAAAG
AAAAGGATTATGTCGAACAGTTGGTATATGGATTGAAATCTATTGGATAC
GAAAATGTCGGTGAATTAGTATACGAAAAATGGATGAAACAACAAGAAAT
TACCATAGATGACTGCCAAAGATGTTTATTGCAAACAATATTTTAAATAA
ATTCTTTTATGAAAAATCACTGATTTCACTACTGATAATCTTGTTACAAT
CAATTTGATGTACTATAAAATTTCTAATGTATATTGATTATATCTCATTG
ATTTTCAATAATTTATATATAATGTAACTGTCCGTCCGTGTGTTGTC
back to top

protein sequence of SMED30007217-orf-1

>SMED30007217-orf-1 ID=SMED30007217-orf-1|Name=SMED30007217-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=812bp
MTVKGSNSSLTDEDNIPDVIKHKLENLRIETRLINNKLIKLGKNLAVIAK
DIAAKRLLKISVQTINFASLSFSQPIIPERGRLITDIFQIDVLSNKSEIL
PKSELNISYKIKCDNIDNYCYPLIYESQQWKILKQYEIENDCIKINNGSF
DFITIVKEPPNDIISISPTGGLLYTKLDPLISLRVAKGNFKEEIMCKIQI
CDMPMENLDQFKPLRDNDLSPFLNMSNLFVIGISDPNSNFVNQASDFRRP
ITMRLPLPDWVISIIEEQNFDSKNIIKDQKKEKPGFYFLQKSINEWNFVE
SNLKFTKNSIEFDIKHFGSFLFVKCRENRELKLCQNMNIVENLIQIENGI
ILTFLWMKSNNWFLWTEIVPVSKIKETRSKLENLGFVYVEQYYEPLKLEE
TRNNSKYKRKFSRAELIQRKTFELLENLQFKLKINGEIEQVENYQKKELN
PQISNNENIDPADDIPLENDNNFDEFDKIGIKEQTQNLENKEQKKPFDIS
FHKNLSSSNYTVVPIKPVRRSLPEWETLVLTKIDKQSIYENRNSCQSQEN
PTFASNNIESDIDNDLVAPISQESLKISRLTEEEKEFSFFSEIHLENVNS
DSEIKIPLQIFKFYIPVDKMKCYYKIKTKEEKQKEEKEIETLAIKVEKER
QIEKEKLYYKKNILVEEKPRTINYNRINGLSRPRFTNKVIEKEPKIISRR
SFLALASTIRQGLKLAVYLSIPDNAIAGIGFDALSQMTMNGSNNTTYKIL
ILWKKMISYNKTKEKDYVEQLVYGLKSIGYENVGELVYEKWMKQQEITID
DCQRCLLQTIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 625..652
NoneNo IPR availableGENE3DG3DSA:2.60.220.30coord: 161..337
e-value: 1.8E-9
score: 39.5