Guanylate cyclase

Overview
NameGuanylate cyclase
Smed IDSMED30007202
Length (bp)3482
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanylate cyclase (SMED30007202) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30007202) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanylate cyclase (SMED30007202) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30007202) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007202

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007202SMESG000068881.1 SmedASXL_011840SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30007202SMESG000068881.1 dd_Smed_v4_14331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30007202SMESG000068881.1 dd_Smed_v6_14331_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30007202SMESG000068881.1 OX_Smed_1.0.22515ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 770 bits (1987), Expect = 0.000e+0
Identity = 435/1034 (42.07%), Postives = 608/1034 (58.80%), Query Frame = 2
Query:  305 CLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNS--IIVTDHLKVLFRKIFQMYNWSRVKLI---YEQTFLNFCRSV--GTLFDSENYKNKTFKSVVL----LNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNN------QKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSVEES---NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAIL--LFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSN-IGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            C  +  PL   V L  +  P V+ GP C Y+ AP+ R    W +P++T  GA  +   +K +EY+  TR       + D +  L R++     W R  L+   Y       C  +  G      +  N T   +      L+  T L   M  +  V+ +C  P++ R ++L A +      +YVF ++D+             ++PW  + D  +V+  A++A+++   +T + P++ EY  F+K++K+   E++    E    N     FHD LLLY  A+ +T+A   T  +G  IT++MWNR+ QG+TG + ID +GDR  D+S+ DMD + G F++V NY G  Q  + V G+ ++W      PPP  P CG++ ++    +    T+ ++ +   L  L  LI  F+IY++++ + EL +  W + W++VE       L    S           R   S RG               S  G ++ +                             + F  TA YKGN+VA+K+++  K++E+ R +L E+K ++++ NEH+ RF+G C D P   +LTEYCP+GSLQDILENE I LDWMF++SL  DI +GM++LH+  I  HGNLKSSNC+VD RFVLKI D+GLE  R     L     +  Y   LWTAPE+LR  +   ++ S   DVYSFGII QE+  R+GVF++  ++L PK+I+E VT+ +  P+RP L+      E L  ++++ W ED   RP F+ I+  +R  N+  +S NILDNLLSRMEQYANNLEELV +RT+ YLEEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFTALSAESTPMQV+ LLN LYT FD++I++FDVYKVETIGDAYMV SGLP RNG +H  E+ARM+LA L A+  F+I H+P +++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  LKIH+S ++  VL  F  F +  RG V MKGKG   TYWL GE
Sbjct:   92 CSDTAAPLA-AVDLKWEHNPAVFLGPGCVYAAAPVGRFTAHWRVPLLT-AGAPALGFGVK-DEYALTTRAGPSYAKLGDFVAALHRRL----GWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPW-ERGDGQDVS--ARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAFRVVLNYNGTSQELVAVSGRKLNW--PLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGSLSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGS-----------RLTLSGRG---------------SNYGSLLTTEGQ-------------------------FQVFAKTAYYKGNLVAVKRVN-RKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFRD----LDPEQGHTVYAKKLWTAPELLRMASP-PVRGSQAGDVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEE-LGLLMQRCWAEDPQERPPFQQIRLTLRKFNRE-NSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGE 1054          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR2 (natriuretic peptide receptor 2 [Source:HGNC Symbol;Acc:HGNC:7944])

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 297/512 (58.01%), Postives = 375/512 (73.24%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNI-GPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            + F  T  +KGNVVA+K ++  K++E+ R +L E+K ++++   H+ RFIG C+D P   ++TEYCP+GSLQDILEN+ INLDWMF++SL+ D+ +GM +LH++I   HG+LKSSNC+VDSRFVLKI D+GL   R T E    +D +A Y   LWTAPE+L     +      KADVYSFGII QE+  R+G FYL  ++L PK+IV+ V   Q   +RP +   ++ +E L  ++ + W +D + RPDF  IKG +R  NK G + +ILDNLL RMEQYANNLE+LV +RT+ YLEEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFTALSAESTPMQV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG  H  EIARM+LA L A+  F+I H+P+ ++ LRIG+H+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  LKIH+S  + D L     F +  RG V MKGKG   TYWL GE
Sbjct:  535 QIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAE---PDDSHALYAKKLWTAPELL-SGNPLPTTGMQKADVYSFGIILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQL-NEELVLLMERCWAQDPAERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGE 1039          

HSP 2 Score: 159.073 bits (401), Expect = 8.226e-39
Identity = 118/434 (27.19%), Postives = 201/434 (46.31%), Query Frame = 2
Query:  335 TVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNW-SRVKLIYEQTFLN---FCRSVGTLFDSENYKNKTFKSVVLLNAETLLEID---MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTN------NQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG---SVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIG-KKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFAL--INGFYIYKRVKFQAELNAMNWLIPWDNVE--TREKRHR 1570
             V L +   P +  GP C Y  A +AR    W +P++T  GA       K++ Y TL R         L      +   +NW +R  L+Y     +      ++  +F++    N + +  V        E     + +   +V +C   E +  ILL+A + N  NG+YVF  +D+              +PW   N T E     +EA++++L +T + P + EY+ F   +  R  E +G        N   G F+D +LLYA  LN+T+    T E+G  I  KM  R   G+TG + +D+N DR  D+ +  M D D+G F+  A+Y G +KQ++    G+ I WV  K  PP   P C ++  +    K    T++++ +   + F +  ++ F I++++  + EL +M W I W+ ++    E+ H+
Sbjct:   84 AVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLLT-AGAVASGFSAKNDHYRTLVRTGP--SAPKLGEFVVTLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPW-QDNRTREQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELGPSLMNLIAGCFYDGILLYAEVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWW--TGRPIPWV--KGAPPSDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSERYHK 509          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2F (guanylate cyclase 2F, retinal [Source:HGNC Symbol;Acc:HGNC:4691])

HSP 1 Score: 459.529 bits (1181), Expect = 3.499e-142
Identity = 312/903 (34.55%), Postives = 471/903 (52.16%), Query Frame = 2
Query:  701 ETLLEIDMGSENAVVVLCVEP-----ESVRRILLKAHKLNFINGEYVFINID-LLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQL-YIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSD-TLPNSELFTKRFQYSKRGLAKFDEESDVLIG-NPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGS-----KKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTF-QRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIP 3364
            + L  I       ++++C+       E+   +L  AH L   +G YVF+  D LL S      P+    +    N K +EAY ++LT+T +  E   Y+ F +        +    ++ +   G  ++S+   A A+N+ M  N      + +     N    G    M  D NG+  ++Y +LD +     +++ + Y    ++  +   G  I +   +  PP +   C +      +  I      ++ +  ++    INGF  + R +              + ++  +  +R+   + D T  N    +KR     R    F   S+V  G +P L+       P+                  +N N+         A+Y+G+ V LK+         K ++   + + E+  +K+L +E+I   +G   D+    ++TE+C +GSL+DIL N+ + LDWMFK SLL D+ +GM YLH     HG LKS NC+VD RFVLK+ D+G   +    E L  ++E +    LLWTAPE+LR      L  S   DVYSF II QEV+ R   F + D  L  ++I+  + K   +       E+        ++++Q W E    RP F  I    +  NKG  + NI+D++L  +EQY++NLE+L+ +RTE+   EK+KTE LL  MLP SVA  L +  TV  E +++V++YFSDIVGFT +SA S P++V++LLN LYT FD+II S DVYKVETIGDAYMV SGLP+RNG  H  EIA MSL  LS++  F++ H P   V +RIG+HSGPV AGVVGL MPRYCLFGDTVNTASRMES GLP +IH+S  +V +L+   + + +  RG+  +KGKG + T+WL G+    + P+P
Sbjct:  231 KALQRIHQADRIRIIIMCMHSALIGGETQMHLLECAHDLKMTDGTYVFVPYDALLYSLPYKHTPYRVLRN----NPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSR-NMQFHGFNQLMRTDSNGNGISEYVILDTNLKE--WELHSTYTVDMEMELLRFGGTPIHFPGGR--PPRADAKCWFAEGKICHGGIDPAFAMMVCLTLLIALLSINGFAYFIRRRI-------------NKIQLIKGPNRILLTLEDVTFINPHFGSKR---GSRASVSFQITSEVQSGRSPRLSFSSGSLTPAT----------------YENSNI---------AIYEGDWVWLKKFSLGDFGDLKSIKSRASDVFEM--MKDLRHENINPLLGFFYDSGMFAIVTEFCSRGSLEDILTNQDVKLDWMFKSSLLLDLIKGMKYLHHREFVHGRLKSRNCVVDGRFVLKVTDYGFNDIL---EMLRLSEEESSMEELLWTAPELLRAPRGSRL-GSFAGDVYSFAIIMQEVMVRGTPFCMMD--LPAQEIINRLKKPPPVYRPVVPPEH--APPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKT-NIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQNLSEGYEVELRGRTELKGKGTEETFWLIGKKG-FMKPLP 1071          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2D (guanylate cyclase 2D, retinal [Source:HGNC Symbol;Acc:HGNC:4689])

HSP 1 Score: 418.698 bits (1075), Expect = 4.011e-127
Identity = 237/530 (44.72%), Postives = 331/530 (62.45%), Query Frame = 2
Query: 1823 ALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCL----DAPQH-W-----LLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQR-FIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIPESCEF 3379
             +Y+G+ V LK+  G + + I         K++ L +E++  ++G+ L    + P   W     +++E+C +GSLQD+L   +I LDWMFK SLL D+ +G+ YLH     HG LKS NC+VD RFVLKI D G  +L   ++ L E        + LWTAPE+LR    +  + +   DV+S  II QEVV R+  + +  + L P+++V+ V     +  RP +S ++   E +  +++Q W E   LRP       + + +NKG  + NI+D++L  +EQY++NLE+L+ +RTE+   EK+KT+ LL  MLP SVA  L     V  E +E V++YFSDIVGFT +SA S P++V++LLN LYT FD+II S DVYKVETIGDAYMV SGLPQRNG  H  EIA MSL  LSA+  F++ H P   V +RIG+HSGP  AGVVGL MPRYCLFGDTVNTASRMES GLP +IH++  +V +LR     + +  RG+  +KGKG + T+WL G       PIP+  + 
Sbjct:  553 GVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDLLAQREIKLDWMFKSSLLLDLIKGIRYLHHRGVAHGRLKSRNCIVDGRFVLKITDHGHGRLLEAQKVLPEPPRA---EDQLWTAPELLRDPA-LERRGTLAGDVFSLAIIMQEVVCRSAPYAM--LELTPEEVVQRVRSPPPL-CRPLVSMDQAPVECIL-LMKQCWAEQPELRPSMDHTFDLFKNINKGRKT-NIIDSMLRMLEQYSSNLEDLIRERTEELELEKQKTDRLLTQMLPPSVAEALKTGTPVEPEYFEQVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGTFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNLSTVGILRALDSGYQVELRGRTELKGKGAEDTFWLVGRRG-FNKPIPKPPDL 1072          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2C (guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:4688])

HSP 1 Score: 386.726 bits (992), Expect = 1.315e-115
Identity = 218/506 (43.08%), Postives = 307/506 (60.67%), Query Frame = 2
Query: 1901 IEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQIN------LDWMFKFSLLQDICRGMIYLHSN-IGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRP--FLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMM-RYLNKGGDSGN--ILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVL-RTFQRFIISKRGQVNMKGKGYQTTYWLHG-EDSVIVDPIPESCE 3376
            IE+ K+  ++  ++ +F G        + + EYC +GSL+++L N+ I+      +DW FK S+L DI +GM YLHS+    HG LKS+NC+VDSR V+KI DFG   +   K+ L             WTAPE LR+        S K DVYS+GII QE++ R   FY        ++I        + P+RP  FL   E     +  +++  W+ED   RPDF+ I+  + +      D  N   +D L+ R++ Y+ NLE LV +RT+ Y  E+ + + L + +LP+ V   L     V  E YE V+IYFSDIVGFT +   STPM+V+++LN +Y +FD I++  DVYKVETIGDAYMV SGLP+RNG+ H  +IA+M+L  LS +  F++ H P   + +RIG+HSGP  AGVVG+KMPRYCLFGDTVNTASRMES GLPL+IH+S  ++ +L RT  +F+   RG+  +KG+G +TTYWL G +D     P P + E
Sbjct:  531 IELNKLLQIDYYNLTKFYGTVKLDTMIFGVIEYCERGSLREVL-NDTISYPDGTFMDWEFKISVLYDIAKGMSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKDL-------------WTAPEHLRQA-----NISQKGDVYSYGIIAQEIILRKETFYTLSCRDRNEKIFRVENSNGMKPFRPDLFLETAEEKELEVYLLVKNCWEEDPEKRPDFKKIETTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVEERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYSTPMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEILSFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRIHVSGSTIAILKRTECQFLYEVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVE 1017          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 553.903 bits (1426), Expect = 4.014e-177
Identity = 276/525 (52.57%), Postives = 379/525 (72.19%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKK----VEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLEN-DEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKV---QLIPYRPFLSE------NEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHG 3334
            + +  TA++KG VVA+K+L+   K    ++++R  L+E+KK+K+L ++HI RF G C+D P + ++TEYCPKGSL+DILENE+I LD + K+SLL D+ +G+ +LH S I  HG LKSSNC+VDSRFVLK+ DFGL +L   +E  LE   E+AYY+ +LWTAPE+LR +    +  + K D+YSF II  E+++R GVF L + +L P +IV+ V K       P RP++SE      ++  ++ L  ++   W ED   RP+  +++  +R LN+  ++ N++DNLL RMEQYANNLE LV +RT++YL EK+K E+LL+ +LP ++A  LI    V AESY+ V+IYFSDIVGFT+LS++STPMQV+ LLN LY  FD ++++F VYKVETIGDAYMV SGLP+R  D H  +IA+MSL+ L  +  F I H+P+++++LRIG+HSG V AGVVG KMPRYCLFGDTVNT+SRMESNGLPLKIH+S+Q+ D+L     F +  RG V MKGKG QTTYWL G
Sbjct:  681 QIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPM-GTQKGDIYSFAIILHEMMFRKGVFALENEDLSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRG 1203          

HSP 2 Score: 228.024 bits (580), Expect = 1.064e-60
Identity = 149/422 (35.31%), Postives = 223/422 (52.84%), Query Frame = 2
Query:  392 YSLAPIARLLPFWD--IPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSENYKN-KTFKSVVLLNAETLLEIDMGSE------------------NAVVVLCVEPESVRRILLKAHKLNF-INGEYVFINIDLLTSKTNNQKPWYSKNDTD-EVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKY------GSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIY--KRVKFQAELNAMNWLIPWDNVETREKR 1564
            Y+LAP+AR+  FW   +P+ T      +       E+  LTR+     +  L  L  +I + + W     ++        R+ G    SE Y +    K++++ N  +   + M SE                  + +++LC  P++VR I+L AH L    +GEYVFINID+ T  ++ ++PW   NDT+ E N KAKEAYR+L T++ +R + +EY+NF   VK R ++KY      G   E N F+  F+D++LLYA+ALN+T+   L   NG  IT +MW RT  GITG +SID NGDR +DYS+LD+D     F  VA Y G       V GQ + WV  K  PP   P+CGY++  CP    G      + M + LL  ++ G +I+  +R K + EL AM+W I W+ ++  E +
Sbjct:  112 YALAPVARISKFWGQGVPVFTTTAL--VDELGDRNEFPLLTRMMGSYKS--LGKLVTRIAERFEWQHYFFMFNDEVARGPRNKGR---SECYFSLSAIKNLIMNNKTSTWNVKMFSEFEADRLQYRALLSEASVMSNLIILCASPDTVREIMLAAHDLGMATSGEYVFINIDVSTG-SHAEQPWIRANDTNNEENEKAKEAYRALKTISLRRSDLDEYKNFELRVKERADQKYNYTNITGKDYEMNNFISAFYDAVLLYAIALNETIQSGLDPRNGHNITSRMWGRTFVGITGNVSIDHNGDRYSDYSLLDLDPVQNRFVEVAYYSGASNQLKTV-GQ-LHWVGGK--PPTDLPICGYDKSKCPQ---GYPLHVYLLMGSFLLILVLVGLFIFFWRRYKLEQELAAMSWKIRWEELDGEESQ 518          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 553.903 bits (1426), Expect = 6.881e-177
Identity = 276/525 (52.57%), Postives = 379/525 (72.19%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKK----VEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLEN-DEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKV---QLIPYRPFLSE------NEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHG 3334
            + +  TA++KG VVA+K+L+   K    ++++R  L+E+KK+K+L ++HI RF G C+D P + ++TEYCPKGSL+DILENE+I LD + K+SLL D+ +G+ +LH S I  HG LKSSNC+VDSRFVLK+ DFGL +L   +E  LE   E+AYY+ +LWTAPE+LR +    +  + K D+YSF II  E+++R GVF L + +L P +IV+ V K       P RP++SE      ++  ++ L  ++   W ED   RP+  +++  +R LN+  ++ N++DNLL RMEQYANNLE LV +RT++YL EK+K E+LL+ +LP ++A  LI    V AESY+ V+IYFSDIVGFT+LS++STPMQV+ LLN LY  FD ++++F VYKVETIGDAYMV SGLP+R  D H  +IA+MSL+ L  +  F I H+P+++++LRIG+HSG V AGVVG KMPRYCLFGDTVNT+SRMESNGLPLKIH+S+Q+ D+L     F +  RG V MKGKG QTTYWL G
Sbjct:  702 QIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPM-GTQKGDIYSFAIILHEMMFRKGVFALENEDLSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRG 1224          

HSP 2 Score: 240.736 bits (613), Expect = 9.334e-65
Identity = 160/441 (36.28%), Postives = 234/441 (53.06%), Query Frame = 2
Query:  335 TVKLLMKSKPGVWFGPICDYSLAPIARLLPFWD--IPIITPCGASGIFRQMKHEEYSTLTRVNSI--IVTDHLKVLF------RKIFQMYNWSRVKLIYEQTFLNFC------RSVGTLFDS-----ENYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNF-INGEYVFINIDLLTSKTNNQKPWYSKNDTD-EVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKY------GSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIY--KRVKFQAELNAMNWLIPWDNVETREKR 1564
             V+ L++ +     G    Y+LAP+AR+ P+W   IPIITP G +      +  EY  +TR+NS   +V+  +  LF      R IF  ++     +   + FL         R V  +  +     E++     K+         L       N V++LC  P++VR I+L AH L    +GEYVFINID+ T  ++ ++PW   NDT+ E N KAKEAYR+L T++ +R + +EY+NF   VK R ++KY      G   E N F+  F+D++LLYA+ALN+T+   L   NG  IT +MW RT  GITG +SID NGDR +DYS+LD+D     F  VA Y G       V GQ + WV  K  PP   P+CGY++  CP    G      + M + LL  ++ G +I+  +R K + EL AM+W I W+ ++  E +
Sbjct:  110 AVEQLLRKQIDCIIGYAYGYALAPVARMSPYWKNGIPIITPIGLTMSLDDKR--EYQLMTRINSPYKVVSSAVSTLFNTYKWKRHIFMFHHAKAPSVAVGECFLLMASLQHPLRKVMEMQHNFFTFNEDHGANISKAERHNQFRNYLRASSNMAN-VIILCASPDTVREIMLAAHDLGMATSGEYVFINIDVSTG-SHAEQPWIRANDTNNEENEKAKEAYRALKTISLRRSDLDEYKNFELRVKERADQKYNYTNITGKDYEMNNFISAFYDAVLLYAIALNETIQSGLDPRNGHNITSRMWGRTFVGITGNVSIDHNGDRYSDYSLLDLDPVQNRFVEVAYYSGASNQLKTV-GQ-LHWVGGK--PPTDLPICGYDKSKCPQ---GYPLHVYLLMGSFLLILVLVGLFIFFWRRYKLEQELAAMSWKIRWEELDGEESQ 539          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 554.673 bits (1428), Expect = 9.318e-177
Identity = 276/525 (52.57%), Postives = 379/525 (72.19%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKK----VEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLEN-DEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKV---QLIPYRPFLSE------NEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHG 3334
            + +  TA++KG VVA+K+L+   K    ++++R  L+E+KK+K+L ++HI RF G C+D P + ++TEYCPKGSL+DILENE+I LD + K+SLL D+ +G+ +LH S I  HG LKSSNC+VDSRFVLK+ DFGL +L   +E  LE   E+AYY+ +LWTAPE+LR +    +  + K D+YSF II  E+++R GVF L + +L P +IV+ V K       P RP++SE      ++  ++ L  ++   W ED   RP+  +++  +R LN+  ++ N++DNLL RMEQYANNLE LV +RT++YL EK+K E+LL+ +LP ++A  LI    V AESY+ V+IYFSDIVGFT+LS++STPMQV+ LLN LY  FD ++++F VYKVETIGDAYMV SGLP+R  D H  +IA+MSL+ L  +  F I H+P+++++LRIG+HSG V AGVVG KMPRYCLFGDTVNT+SRMESNGLPLKIH+S+Q+ D+L     F +  RG V MKGKG QTTYWL G
Sbjct:  740 QIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPM-GTQKGDIYSFAIILHEMMFRKGVFALENEDLSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRG 1262          

HSP 2 Score: 222.631 bits (566), Expect = 6.537e-59
Identity = 136/342 (39.77%), Postives = 194/342 (56.73%), Query Frame = 2
Query:  707 LLEIDMGSENAVVVLCVEPESVRRILLKAHKLNF-INGEYVFINIDLLTSKTNNQKPWYSKNDTD-EVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKY------GSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIY--KRVKFQAELNAMNWLIPWDNVETREKR-------HRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLI 1681
            L EI + S   V++LC  P++VR I+L AH L    +GEYVFINID+ T  ++ ++PW   NDT+ E N KAKEAYR+L T++ +R + +EY+NF   VK R ++KY      G   E N F+  F+D++LLYA+ALN+T+   L   NG  IT +MW RT  GITG +SID NGDR +DYS+LD+D     F  VA Y G       V GQ + WV  K  PP   P+CGY++  CP   +       + M + LL  ++ G +I+  +R K + EL AM+W I W+ ++  E +        +     +D LP S+   +    S     KFDE+S + I
Sbjct:  280 LREISLQSN--VIILCASPDTVREIMLAAHDLGMATSGEYVFINIDVSTG-SHAEQPWIRANDTNNEENEKAKEAYRALKTISLRRSDLDEYKNFELRVKERADQKYNYTNITGKDYEMNNFISAFYDAVLLYAIALNETIQSGLDPRNGHNITSRMWGRTFVGITGNVSIDHNGDRYSDYSLLDLDPVQNRFVEVAYYSGASNQLKTV-GQ-LHWVGGK--PPTDLPICGYDKSKCPGYPLHV----YLLMGSFLLILVLVGLFIFFWRRYKLEQELAAMSWKIRWEELDGEESQKKNEKKKAKKRKNHNDYLPESDPLLRSTSRSSVNSDKFDEDSLIPI 610          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 504.212 bits (1297), Expect = 2.711e-165
Identity = 257/524 (49.05%), Postives = 366/524 (69.85%), Query Frame = 2
Query: 1811 FITTALYKGNVVALKQLHGSKK----VEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLEN-DEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKV---QLIPYRPFLSE------NEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQR-----FIISKRGQVNMKGKGYQTTY 3322
            +  TA++KG VVA+K+L+   K    ++++R  L+E+KK+K+L ++HI RF G C+D P + ++TEYCPKGSL+DILENE+I LD + K+SLL D+ +G+ +LH S I  HG LKSSNC+VDSRFVLK+ DFGL +L   +E  LE   E+AYY+ +LWTAPE+LR +    +  + K D+YSF II  E+++R GVF L + +L P +IV+ V K       P RP++SE      ++  ++ L  ++   W ED   RP+  +++  +R LN+  ++ N++DNLL RMEQYANNLE LV +RT++YL EK+K E+LL+ +LP ++A  LI    V AESY+ V+IYFSDIVGFT+LS++STPMQV+ LLN LY  FD ++++F VYKVETIGDAYMV SGLP+R  D H  +IA+MSL+ L  +  F I H+P+++++LRIG+HSG V AGVVG KMPRYCLFGDTVNT+SRMESNGL +  + S   +   + F+      F+ +++  +  +GK   T +
Sbjct:  115 YTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPM-GTQKGDIYSFAIILHEMMFRKGVFALENEDLSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLRMFWNFSLYKIYKFKVFKNKIELDFLKNEKESIEFEGKKMVTEF 636          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-7 (Receptor-type guanylate cyclase gcy-7 [Source:UniProtKB/Swiss-Prot;Acc:H2L002])

HSP 1 Score: 465.307 bits (1196), Expect = 9.759e-145
Identity = 328/1070 (30.65%), Postives = 524/1070 (48.97%), Query Frame = 2
Query:  302 DCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDH-LKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNAETLLEID----------MGSENAVVVLCVEPES--VRRILLKAHKLNFINGEYVFINIDLLTSK------TNNQKP-WYSKNDTDEVNFKAKEAYRS---LLTVTAQRPESEEYRNFIKEVKNRTNEK-YGSVEE--------SNKFLGVFHDSLLLYALALNDTMAMN--LTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPV--EGQIIDWVNKKN-LPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALIN---GFYIYKRVKFQAELNAMN--WLIPW---DNVETREK---RHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFD--EESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEI--CSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIV 3352
            DC+ S      TV L+ K    V  GP  +        +  +++ PII    A G+    + +++        +      L V  R + + Y WS  + +Y            T+ +        F  ++L  +  + +I           + S   ++V C++      R+ LL A +   I  EYV++  D+ +           ++P W     +DE + +A +A++    +  +  Q   +  Y  F +E+  R  E  Y   ++        +  + G  HD++  Y +AL+  +       Y N T   R  + ++  G++G ++I+E G RN    +L +D++    ++   Y+             + + W ++KN   P   P+CG+    CP   +    I +I    +L  A+     G Y   + + Q E+  +N  W IP+     + +++K    H +    S T   S   T  F+   R    F    ESD     P +A    K    R    +       S   L  DNL+                                                 RFIG+CLD PQ   +  +C +GS+ D++    I +D  F +SL++D+  G+++LH S +G HG L S  CL+D R+ +KI ++GL+ LR  + Y          ++LLW+APE+LR      ++ S + DVYS GIIC E++ R GVF + D   +P++I+  + K  L   RP L  +     +  L  ++R  + E  S RP   T++  +R +N   +  N++D++ + +E YA++LEE V++RT++ +EEK+K++ LLY MLPK+VA +L   +TV  E++E V+I+FSD+V FT L+++ TP+QV+ LLN LYT FD IIE  DVYKVETIGD Y+  SGLP RNG+ H+R+IA MSLAFLS++  F++PH P++R+ LRIG++ G V AGVVGL MPR+CLFGD VNTASRMESNG P KIH+S ++  +L     F    RG+V +KGKG   T+WL G+ +  V
Sbjct:   87 DCVESEAA-GMTVDLIEKHNVDVIIGPTMNQPTLAAFIVSNYFNRPII----AWGLVNAAQLDDFERFPNAGILSAGQRSLGVAIRAVLKRYEWS--QFVYAYFTEEDTEKCVTMRNDLQQVVSYFGDIILAYSIQVADISNDGMIEALKKIQSRGRIIVTCMKDGIGLRRKWLLAAEEAGMIGDEYVYVFSDIKSKGYVVPLLGGGERPSWILSTGSDENDTRALKAFKQSIFICDMMGQGSIATNYTIFGQEIIARMKEAPYFCTKDCEGENFTVAATYAGQLHDAVYAYGVALDKMLKAGQIAQYRNATAFMR-YFPQSFIGMSGNVTINEKGTRNPTLFLLALDENNNNTRMATIYVENMSATFNALYSDEGVMWASRKNNARPVDVPLCGFTGNLCPKSFVDEYLIWVIVAIVVLFLAITAAACGIYFSIQARRQ-EIERLNRLWQIPFIHLHQINSKQKGKGEHSVRSLQSGTSTLSSRTTVSFKTESRNFLFFSLQRESDY---EPVVA----KKHAYRPRLDDDKCTFMRSLRNLDQDNLN-------------------------------------------------RFIGLCLDGPQMLSVWRFCSRGSIADVILKATIQMDNFFIYSLIKDMVHGLVFLHGSMVGYHGMLTSKCCLIDDRWQVKISNYGLQDLRSPEMY--------EKKDLLWSAPELLRAE---DIKGSKEGDVYSLGIICAELITRKGVFNMEDRKEDPEEIIYLLKKGGLKSPRPDLEYDHTIEINPALLHLVRDCFTERPSERPSIETVRSQLRGMNSSRND-NLMDHVFNMLESYASSLEEEVSERTKELVEEKKKSDVLLYRMLPKTVADKLKLGQTVEPETFEQVTIFFSDVVQFTTLASKCTPLQVVNLLNDLYTIFDGIIEKHDVYKVETIGDGYLCVSGLPHRNGNEHVRQIALMSLAFLSSLQFFRVPHLPSERINLRIGMNCGSVVAGVVGLTMPRFCLFGDAVNTASRMESNGKPGKIHVSAEANRMLHLVGGFDTESRGEVIIKGKGVMETFWLTGQGTGAV 1079          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG31183 (gene:FBgn0051183 transcript:FBtr0346151)

HSP 1 Score: 795.423 bits (2053), Expect = 0.000e+0
Identity = 451/1023 (44.09%), Postives = 626/1023 (61.19%), Query Frame = 2
Query:  374 FGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQ----------TFLNFCRSVGTLFDSENYKNKTFKSVVLLNAE-TLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFIN-GEYVFINIDLLTS-KTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSVEESNK----FLGVFHDSLLLYALALNDTMAMNLTYE----NGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLH-GSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHS-NIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLEND-----EYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLE--PKQIVEFVT-----KVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            FG  C+Y LAPI+R    W +P++T  G +  F + K E YSTLTR+    V ++L  + R I   +NW+R  LIY+            FL       T+ +   Y+   F +     A+ T +  ++  ++ +V++C +P+S+R+I+L A +LN I+ GEYVFINI+L +  +    +PWY KNDTD  N +A++AY ++LTVT ++P   EY     E+K    EKY      N+    F+  F D +LLYA ALN+++  + T      NGT + R+MWNR+  GITG ++ID NGDR + YS+LDM+  TG F+IVA+++  +  +     + I W   +   PP  P+CGY+   CP+  +    I  I +  +++   +  F+ Y+    +AE+N+M+W +  ++V  R+                         ++RGL                      S  S V   +      E    +  D     + FI   +++ + VA+K +   + +  + R+L++E+K++K+L ++H+ +F G CLD  + +LLTEYCPKGSLQDILENEQ  LDWMF+ SL+ DI RGM +LHS +I  HGNLKSSNC+VDSRFVLKI DFGL  LR T+ + LE+D      +AY+  LLWTAPE+LR       + + K DVY+FGII  E+  R G FYL     E  P++I+E V      ++Q  P+RP L  N      +  IIR+ W ED + RPDF T+K M+R  NK  ++GNI+DNLL RME YANNLEELV +RT+ Y EEK+K E LLY +LP+SVA QLI  + V AE+++ V+IYFSDIVGFTA+SAESTPMQV++ LN LYT FDSI+E+FDVYKVETIGDAYMV SGLP RNG+ H REIAR++LA L A+  F+I H+P  R++LRIG+H+G   AGVVGLKMPRYCLFGDTVNTASRMESNG  LKIH+SE + + L  F  F+ ++RG V MKGKG   TYWL GE
Sbjct:  164 FGLPCEYVLAPISRYADVWQVPVLTTGGNAKEFNK-KSESYSTLTRLKGAQV-NNLGNVVRAILNSFNWTRTALIYQNENAKVKGNSVCFLCLAAIHDTIEEHSVYQ-LGFDTSTWTKADITRMLKNVAMQSRIVIMCADPQSIRQIMLTAEELNMIDSGEYVFINIELFSRVQYLTSQPWYDKNDTDLNNERAQKAYTAMLTVTPKQPNDNEYTRVSNEIKAIAAEKYNYTFSDNEPISAFVTSFFDGVLLYANALNESIREDPTMLTRPINGTDMVRRMWNRSFTGITGNVTIDANGDRLSAYSLLDMNPTTGRFEIVAHFLHNRLEF--EANKEIHWAGDREEAPPDRPICGYDGALCPDNSLPGYAILSIVLGTMVVVMAVCFFFGYRHYIAEAEINSMSWKVSLEDVMFRDA------------------------AERGLRG--------------------SFHSLVKQSSQLTLMSEDMVSINGDR----QIFIPVGMFRKSKVAIKPVEVDNVQGLLTRSLMLELKRMKDLQHDHLVKFYGACLDQRRSFLLTEYCPKGSLQDILENEQFQLDWMFRLSLMHDIVRGMQFLHSSDIRSHGNLKSSNCVVDSRFVLKITDFGLHTLRRTR-FDLESDGGNCNSHAYWSKLLWTAPELLRVEHNRPPEGTQKGDVYAFGIIVHEITTRQGPFYLGRCAYEKSPQEIIELVKGYNPHRMQK-PFRPELEPNGDTKADINGIIRRCWAEDPAERPDFNTLKSMIRRFNKDNETGNIVDNLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDVYKVETIGDAYMVVSGLPIRNGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEGE 1131          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG31183 (gene:FBgn0051183 transcript:FBtr0083187)

HSP 1 Score: 795.423 bits (2053), Expect = 0.000e+0
Identity = 451/1023 (44.09%), Postives = 626/1023 (61.19%), Query Frame = 2
Query:  374 FGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQ----------TFLNFCRSVGTLFDSENYKNKTFKSVVLLNAE-TLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFIN-GEYVFINIDLLTS-KTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSVEESNK----FLGVFHDSLLLYALALNDTMAMNLTYE----NGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLH-GSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHS-NIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLEND-----EYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLE--PKQIVEFVT-----KVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            FG  C+Y LAPI+R    W +P++T  G +  F + K E YSTLTR+    V ++L  + R I   +NW+R  LIY+            FL       T+ +   Y+   F +     A+ T +  ++  ++ +V++C +P+S+R+I+L A +LN I+ GEYVFINI+L +  +    +PWY KNDTD  N +A++AY ++LTVT ++P   EY     E+K    EKY      N+    F+  F D +LLYA ALN+++  + T      NGT + R+MWNR+  GITG ++ID NGDR + YS+LDM+  TG F+IVA+++  +  +     + I W   +   PP  P+CGY+   CP+  +    I  I +  +++   +  F+ Y+    +AE+N+M+W +  ++V  R+                         ++RGL                      S  S V   +      E    +  D     + FI   +++ + VA+K +   + +  + R+L++E+K++K+L ++H+ +F G CLD  + +LLTEYCPKGSLQDILENEQ  LDWMF+ SL+ DI RGM +LHS +I  HGNLKSSNC+VDSRFVLKI DFGL  LR T+ + LE+D      +AY+  LLWTAPE+LR       + + K DVY+FGII  E+  R G FYL     E  P++I+E V      ++Q  P+RP L  N      +  IIR+ W ED + RPDF T+K M+R  NK  ++GNI+DNLL RME YANNLEELV +RT+ Y EEK+K E LLY +LP+SVA QLI  + V AE+++ V+IYFSDIVGFTA+SAESTPMQV++ LN LYT FDSI+E+FDVYKVETIGDAYMV SGLP RNG+ H REIAR++LA L A+  F+I H+P  R++LRIG+H+G   AGVVGLKMPRYCLFGDTVNTASRMESNG  LKIH+SE + + L  F  F+ ++RG V MKGKG   TYWL GE
Sbjct:  164 FGLPCEYVLAPISRYADVWQVPVLTTGGNAKEFNK-KSESYSTLTRLKGAQV-NNLGNVVRAILNSFNWTRTALIYQNENAKVKGNSVCFLCLAAIHDTIEEHSVYQ-LGFDTSTWTKADITRMLKNVAMQSRIVIMCADPQSIRQIMLTAEELNMIDSGEYVFINIELFSRVQYLTSQPWYDKNDTDLNNERAQKAYTAMLTVTPKQPNDNEYTRVSNEIKAIAAEKYNYTFSDNEPISAFVTSFFDGVLLYANALNESIREDPTMLTRPINGTDMVRRMWNRSFTGITGNVTIDANGDRLSAYSLLDMNPTTGRFEIVAHFLHNRLEF--EANKEIHWAGDREEAPPDRPICGYDGALCPDNSLPGYAILSIVLGTMVVVMAVCFFFGYRHYIAEAEINSMSWKVSLEDVMFRDA------------------------AERGLRG--------------------SFHSLVKQSSQLTLMSEDMVSINGDR----QIFIPVGMFRKSKVAIKPVEVDNVQGLLTRSLMLELKRMKDLQHDHLVKFYGACLDQRRSFLLTEYCPKGSLQDILENEQFQLDWMFRLSLMHDIVRGMQFLHSSDIRSHGNLKSSNCVVDSRFVLKITDFGLHTLRRTR-FDLESDGGNCNSHAYWSKLLWTAPELLRVEHNRPPEGTQKGDVYAFGIIVHEITTRQGPFYLGRCAYEKSPQEIIELVKGYNPHRMQK-PFRPELEPNGDTKADINGIIRRCWAEDPAERPDFNTLKSMIRRFNKDNETGNIVDNLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDVYKVETIGDAYMVVSGLPIRNGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEGE 1131          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG3216 (gene:FBgn0034568 transcript:FBtr0273396)

HSP 1 Score: 687.952 bits (1774), Expect = 0.000e+0
Identity = 416/1054 (39.47%), Postives = 596/1054 (56.55%), Query Frame = 2
Query:  305 CLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCG------------ASGIFRQM---KHE---------EYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNA------ETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRT----NEKYGSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGY--NRKNCPNRKIGAGTISLITMAAILLFALINGFY-----IYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQH--WLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKST-KADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLH 3331
            C  +R P      +  +     + GP C ++L P+ARL  +W+ PIIT  G             SGI  ++   K+E         +Y TLTR++       L ++F  + + +NW+ V L+ +++ L F  +VG   +    +      V  LN       E  L+ D      VV+L V    VR+ +L AH L   NGE+VF+++++  S+    K W  K   DE + KA++AY +LL V+  +P S ++++F   V+       N  +G  EE N F+G F+D + L  +ALN+T+       +G  ITR+MWNRT +GITG + ID+NGDR+ADYS+LD+D   G F +VA+Y G  ++Y  V G+ I W   +  PPP  P CG+  N  +C       G  S I  +   L   +   +     + K++K   ELN M+W +  D+V                +    +F      SK GL + D E      N SL    + S  + +           SFT L        + + T   +KG  VA+K+++  KKV++   LL E+K+ +++++E+  RF+G C+D P+    +LTEYC +GSL+D+LENE I LDW F+ SL+ DI +GM YLH S++  HG L+S NCL+D RFVLKI DFGL  L    +++ + +   YY  LLW APE+L  TT      +T + DVYSFGII +E+V R G +  +   ++   I+  V   Q   +RP + E E C   L  ++ + W ++   RP F TI+  +R + KG    N++D+LL+RMEQYANNLE LV ++T Q   EK++TE+LLY +LP+ VA QL+  + V  E +  V+IYFSDIVGFT L A S+PM V+  LN LY+TFD II  +DVYKVETIGDAY+V SGLP+ NGD H REIA M+L  L A+  F + HKP  ++++RIG+HSG VCAGVVG KMP YCLFGDTVNTASRMES G P KIH+S  +  +L  F  F + +RG V +KGKG  TTYWL+
Sbjct:  141 CSGARAP-GLAADMYFQDDVIAFIGPACAFALEPVARLAAYWNKPIITGMGDQPPSSEGELTVTSGILGRIHKWKNENTGMFKDKSKYPTLTRMSYCQC--RLILVFASVIRQFNWNHVALLVDRSEL-FSWTVGKNLEYGLRQEGLLSFVKELNGNEEEVYENYLK-DASMYARVVILSVRGVLVRKFMLAAHSLGMTNGEWVFLDVEIFQSEYWGDKGWEMK---DEHDAKARKAYEALLRVSLLQPTSPKFQDFADNVRENALYDYNYTFGEGEEVNFFIGAFYDGVYLLGMALNETLTEGGDIRDGVNITRRMWNRTFEGITGHVRIDDNGDRDADYSILDLDPINGKFSVVAHYSGVHKVYSAVHGKKIHWPGGREEPPPDVPPCGFLGNSTDC------VGNFSTIMYSVFGLLLFLGLVFLVICLLQKQMKLSKELNNMSWRVRPDDV---------------LIEMGGMFG-----SKGGLQRLDVE------NISLQQFGIHSGRASIA----------SFTSLPP------QVYTTIGQFKGERVAIKKVN-VKKVDLTPQLLWEIKQARDVSHENTVRFVGACIDLPRPTVLILTEYCSRGSLKDVLENEAIELDWNFRMSLIHDIVKGMNYLHNSDVAAHGKLRSCNCLIDGRFVLKISDFGLRTLTTPSDFVRDQN---YYLKLLWIAPELLPLTTIPGCCPATQRGDVYSFGIILEEIVNRGGPYQEARQQMDVHTILHKVR--QCNGFRPLIRERE-CPPDLLELMEKCWADNQEERPTFSTIRSNIRTIMKGF-CENLMDDLLNRMEQYANNLESLVEEKTRQLSLEKQRTEELLYQILPRPVAQQLMAGDLVEPEEFSSVTIYFSDIVGFTELCARSSPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVVSGLPEPNGDKHAREIALMALDILRAVSSFNLRHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDVELKGKGTVTTYWLN 1130          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG10738 (gene:FBgn0036368 transcript:FBtr0302487)

HSP 1 Score: 544.658 bits (1402), Expect = 3.151e-173
Identity = 360/973 (37.00%), Postives = 514/973 (52.83%), Query Frame = 2
Query:  572 YNWSRVKLIY-----------EQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNA-ETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEK-----------YGSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITG-EMSIDENGDRNADYSVLDMD-------------KDTGIF-------KIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETRE-KRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYR--NLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQ--LIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGED 3340
            +NW++V  +Y            +T L+     G         N  +    + N  E L+E    +    ++L    E V  ++    +     G+Y  + ID+        + +      ++V   A +A++S L +      S  +  F  EV N+  E+           +G V++ +      +D++ LYA AL + +       NG+ I   +     +   G  + IDENGD   +Y+VL                +  G F         ++  +   +L+ P     IDWV      P + P CG+  + C N     G IS       LL   +    +Y+  +++ EL+++ W I +  V+  E +R + + K +  L N     +R            + +  LI            R S+V           S +   + +      F    LYKG + A+K++   K V+I R +  E+K +++  +++IC FIG C D P   +++EYC +GSL+DILENE + LD MF  S++ DI RG+IYLH S I  HG L +SNCLVDSR+V+K+ DFGL   +   E    + ++   +   LL+ APE+LR+     +  + + D YSFGI+  E+  R G F   +  L P Q ++ V + Q  L PYRP L   E   + +   +R+ W E    RPDF+TI+  +R L KG    NI DN+++ ME+YANNLE LV+ RT+Q  EEK+KT+ LL+ MLP+ VA QL +   V  E YE VSIYFSDIVGFTA+SAE TP+QV++ LN LYT FDSII  +DVYKVETIGDAYMV SGLP RNGD+H  EIA MSL  LSA+ EF+I H+P  R+ LRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMES+G+PLKIH S Q   +L     +  ++RG ++MKGKG Q TYWL GED
Sbjct:  178 FNWTQVSFLYLDDASGQYQPVAETILSTLTDAGVSIRDIRTWNTIYHHGFMDNPFEALVEQTYANTRIYLILGHYYEHVGLMVSLQRRGILSKGDYFVVGIDIEQYDPAKPEKYLRGLLLEDVEPLAVQAFQSYLGIVPT--ASVSFATFANEV-NKYMERPPFNFPNPLGPFGGVKQISAEAAYLYDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLARGSVRNGRNQTVLGLRPVGTFIHRNSSLSSISKALPNLKLFSP-----IDWVGGTR--PAAAPRCGFGGEKCVNY---TGEISAAIAGGALLLLSLVSLVLYRNWRYEQELDSLLWKIDFREVQIHENEREQQSQKQTRHLLNH--LPRRLP---------PQSTHPLI------------RTSQV-----------SLSSNPDADFRYTTIFTPIGLYKGQLYAIKKVR-KKSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICIISEYCTRGSLKDILENEDVKLDNMFIASMVADIIRGVIYLHDSPIRFHGALCTSNCLVDSRWVVKLTDFGLFAFKQGIEDSSTDMQHMSAKCLKLLYRAPELLRQGPSSLVMGTQRGDAYSFGILLYEMHVRRGPF--GETGLTPMQCLQKVLQPQDYLNPYRPSLQPLETAFDCVSECLRECWAERPEDRPDFKTIRTKLRPLRKGMRP-NIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGED 1099          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG10738 (gene:FBgn0036368 transcript:FBtr0304792)

HSP 1 Score: 543.117 bits (1398), Expect = 1.006e-172
Identity = 359/972 (36.93%), Postives = 509/972 (52.37%), Query Frame = 2
Query:  572 YNWSRVKLIY-----------EQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNA-ETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEK-----------YGSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITG-EMSIDENGDRNADYSVLDMD-------------KDTGIF-------KIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYR--NLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQ--LIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGED 3340
            +NW++V  +Y            +T L+     G         N  +    + N  E L+E    +    ++L    E V  ++    +     G+Y  + ID+        + +      ++V   A +A++S L +      S  +  F  EV N+  E+           +G V++ +      +D++ LYA AL + +       NG+ I   +     +   G  + IDENGD   +Y+VL                +  G F         ++  +   +L+ P     IDWV      P + P CG+  + C N     G IS       LL   +    +Y+  +++ EL+++ W I +  V+  E                    +R Q S+    K    +  LI            R S+V           S +   + +      F    LYKG + A+K++   K V+I R +  E+K +++  +++IC FIG C D P   +++EYC +GSL+DILENE + LD MF  S++ DI RG+IYLH S I  HG L +SNCLVDSR+V+K+ DFGL   +   E    + ++   +   LL+ APE+LR+     +  + + D YSFGI+  E+  R G F   +  L P Q ++ V + Q  L PYRP L   E   + +   +R+ W E    RPDF+TI+  +R L KG    NI DN+++ ME+YANNLE LV+ RT+Q  EEK+KT+ LL+ MLP+ VA QL +   V  E YE VSIYFSDIVGFTA+SAE TP+QV++ LN LYT FDSII  +DVYKVETIGDAYMV SGLP RNGD+H  EIA MSL  LSA+ EF+I H+P  R+ LRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMES+G+PLKIH S Q   +L     +  ++RG ++MKGKG Q TYWL GED
Sbjct:  178 FNWTQVSFLYLDDASGQYQPVAETILSTLTDAGVSIRDIRTWNTIYHHGFMDNPFEALVEQTYANTRIYLILGHYYEHVGLMVSLQRRGILSKGDYFVVGIDIEQYDPAKPEKYLRGLLLEDVEPLAVQAFQSYLGIVPT--ASVSFATFANEV-NKYMERPPFNFPNPLGPFGGVKQISAEAAYLYDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLARGSVRNGRNQTVLGLRPVGTFIHRNSSLSSISKALPNLKLFSP-----IDWVGGTR--PAAAPRCGFGGEKCVNY---TGEISAAIAGGALLLLSLVSLVLYRNWRYEQELDSLLWKIDFREVQIHEN-------------------EREQQSQ----KQTRSTHPLI------------RTSQV-----------SLSSNPDADFRYTTIFTPIGLYKGQLYAIKKVR-KKSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICIISEYCTRGSLKDILENEDVKLDNMFIASMVADIIRGVIYLHDSPIRFHGALCTSNCLVDSRWVVKLTDFGLFAFKQGIEDSSTDMQHMSAKCLKLLYRAPELLRQGPSSLVMGTQRGDAYSFGILLYEMHVRRGPF--GETGLTPMQCLQKVLQPQDYLNPYRPSLQPLETAFDCVSECLRECWAERPEDRPDFKTIRTKLRPLRKGMRP-NIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGED 1086          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 728.013 bits (1878), Expect = 0.000e+0
Identity = 438/1032 (42.44%), Postives = 598/1032 (57.95%), Query Frame = 2
Query:  305 CLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCR----SVGTLFDSENYKNKTFKSVVLLNAETLLEID-----MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLL--TSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG-SVEES--NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKN--CPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRG-LAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDS 3343
            C  S  PL   V L     P  + GP CDYS +P+AR    W++P+IT  GA    R +    YS++T +        L     ++ + + W +  ++      N  R    +V   +      N T   +V    E  L  D     +  +  VV +C + E+ R+++++  +  F   EY F  IDL   + +++  +PW ++ D D+    AKEA++S+  +T + P++ EY++F+ ++K    + +  +VE+S  N   G FHD ++LY+ ALNDTM  + +   G  + ++MWNRT  G+TG + +DENGDR  D+++ DM D  TG ++IV+ Y G ++  I   G  + W+  K  PPP  P CG+   N  C  + +    +  I +  I +  +    +IY+++K + EL A  W + W++++       L    S         T   + S  G L   D       GN  +                         TG    N+  IK            V  K++  ++KV      L E+K ++++ NEH+ RFIG C+D P   +LTEYCP+GSLQD++E+E I LDWMF++SL+ DI +GM +LH S I  HGNLKSSNC+VDSRFVLKI D+GLE           +D +A+Y   LWTAPE+LR         + K DVYSFGII QE+    GVFYL    L PK+I+E V + +    RP L   +  SE + +++ + W ED + RPDF  IK ++R  N  G   NILDNLLSRMEQYANNLEELV +RT+ Y EEKRK E LLY +LP SVA QL R E V AE+++ V+IYFSDIVGFTALSAESTPM+V+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H REIARMSLA L A+  F+I H+PN ++ LRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  LKIH+SE +  VL+ F  F +  RG V MKGKG   TYWL GE S
Sbjct:  104 CSDSVAPLV-AVDLKFSYNPWAFIGPGCDYSSSPVARFTTHWEVPMIT-SGA----RALGFNLYSSITNIGP--THKKLGEFVLRMHRHFGWDKHAMLMFNDNKNDDRPCYFAVEGPYTQMREDNITADDLVFNEDEEPLRYDELLRDISHKARVVYVCCKWETFRKLMVEFWRQGFPQEEYAFFFIDLFGRSLQSHPARPW-ARGDADDN--AAKEAFKSVKILTYREPQNPEYKDFVSKLKTEAMDMFNFNVEDSLMNLISGSFHDGVMLYSHALNDTMDRSGSRPPGDVVNKRMWNRTYHGVTGLVQLDENGDREIDFALWDMTDTKTGDYQIVSVYNGSQKQMILEPGMKVHWL--KGRPPPDIPECGFKNDNPACLAKTVTMHQMISIVVCFIFIIIVTVTVFIYRKLKLENELTAQLWRVHWEDIQMSNTEKVLRRACSK-------LTISLRGSNYGSLLTMD-------GNFQIYAK----------------------TGYYKGNITAIK-----------YVNKKRIELTRKV------LFELKHMRDVQNEHLTRFIGACIDPPNICILTEYCPRGSLQDLMESEGITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDSRFVLKITDYGLESFHKDSNL---DDVHAFYARQLWTAPELLRADNPPAC-GTQKGDVYSFGIILQELALLKGVFYLEGPCLSPKEIIERVVEGRWPYLRPLLCP-QSHSEEMGQLMLRCWSEDVNERPDFSQIKVLLRK-NNCGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGEMVQAEAFDSVTIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLEAVHSFRIRHRPNLQLRLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDVEMKGKGRMRTYWLLGEIS 1063          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 728.013 bits (1878), Expect = 0.000e+0
Identity = 438/1032 (42.44%), Postives = 598/1032 (57.95%), Query Frame = 2
Query:  305 CLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCR----SVGTLFDSENYKNKTFKSVVLLNAETLLEID-----MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLL--TSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG-SVEES--NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKN--CPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRG-LAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDS 3343
            C  S  PL   V L     P  + GP CDYS +P+AR    W++P+IT  GA    R +    YS++T +        L     ++ + + W +  ++      N  R    +V   +      N T   +V    E  L  D     +  +  VV +C + E+ R+++++  +  F   EY F  IDL   + +++  +PW ++ D D+    AKEA++S+  +T + P++ EY++F+ ++K    + +  +VE+S  N   G FHD ++LY+ ALNDTM  + +   G  + ++MWNRT  G+TG + +DENGDR  D+++ DM D  TG ++IV+ Y G ++  I   G  + W+  K  PPP  P CG+   N  C  + +    +  I +  I +  +    +IY+++K + EL A  W + W++++       L    S         T   + S  G L   D       GN  +                         TG    N+  IK            V  K++  ++KV      L E+K ++++ NEH+ RFIG C+D P   +LTEYCP+GSLQD++E+E I LDWMF++SL+ DI +GM +LH S I  HGNLKSSNC+VDSRFVLKI D+GLE           +D +A+Y   LWTAPE+LR         + K DVYSFGII QE+    GVFYL    L PK+I+E V + +    RP L   +  SE + +++ + W ED + RPDF  IK ++R  N  G   NILDNLLSRMEQYANNLEELV +RT+ Y EEKRK E LLY +LP SVA QL R E V AE+++ V+IYFSDIVGFTALSAESTPM+V+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H REIARMSLA L A+  F+I H+PN ++ LRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  LKIH+SE +  VL+ F  F +  RG V MKGKG   TYWL GE S
Sbjct:  104 CSDSVAPLV-AVDLKFSYNPWAFIGPGCDYSSSPVARFTTHWEVPMIT-SGA----RALGFNLYSSITNIGP--THKKLGEFVLRMHRHFGWDKHAMLMFNDNKNDDRPCYFAVEGPYTQMREDNITADDLVFNEDEEPLRYDELLRDISHKARVVYVCCKWETFRKLMVEFWRQGFPQEEYAFFFIDLFGRSLQSHPARPW-ARGDADDN--AAKEAFKSVKILTYREPQNPEYKDFVSKLKTEAMDMFNFNVEDSLMNLISGSFHDGVMLYSHALNDTMDRSGSRPPGDVVNKRMWNRTYHGVTGLVQLDENGDREIDFALWDMTDTKTGDYQIVSVYNGSQKQMILEPGMKVHWL--KGRPPPDIPECGFKNDNPACLAKTVTMHQMISIVVCFIFIIIVTVTVFIYRKLKLENELTAQLWRVHWEDIQMSNTEKVLRRACSK-------LTISLRGSNYGSLLTMD-------GNFQIYAK----------------------TGYYKGNITAIK-----------YVNKKRIELTRKV------LFELKHMRDVQNEHLTRFIGACIDPPNICILTEYCPRGSLQDLMESEGITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDSRFVLKITDYGLESFHKDSNL---DDVHAFYARQLWTAPELLRADNPPAC-GTQKGDVYSFGIILQELALLKGVFYLEGPCLSPKEIIERVVEGRWPYLRPLLCP-QSHSEEMGQLMLRCWSEDVNERPDFSQIKVLLRK-NNCGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGEMVQAEAFDSVTIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLEAVHSFRIRHRPNLQLRLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDVEMKGKGRMRTYWLLGEIS 1063          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr2 (natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZDB-GENE-141030-2])

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 420/1017 (41.30%), Postives = 574/1017 (56.44%), Query Frame = 2
Query:  359 KPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWS-RVKLIY------EQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNAETLLEIDMGS---ENAVVVLCVEPESVRRILLKAHKLNFINGE-YVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSVEESNKF---LGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIG--KKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGA-GTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNV--ETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKST-KADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDS 3343
            KP  + GP C YS+A + R    W +P+IT  G +  F   K EE+ T+ R      T  L      +   +NWS R  +I+      ++        + T+   EN    T  +    + +T    DM +   +N  +V    P      ++K  +    + E Y    +D+     +   P   +    + N   K  ++S+  VT Q P+S EY  F KE+  R  + +    E +      G FHD  +LYA AL++ +A  ++  +G  IT +M NR + G+TG +SID+   R  D+S+  M +  +G + IV +Y G  K+ L+ P E   I W   K  PP  +P CG++   C    +   G +++ +  A+++F  I+ F IY+++K + EL  M W I W+ +  E+  K H+                 R   S+RG               S  G ++ +                             + F  T  +KGN+VA+K ++  K++E+ R +L E+K ++++   H+ RFIG C+D P   ++TEYCP+GSLQDILENE INLDWMF++SL+ DI +GM YLH S IG HGNLKSSNC+VDSRFVLKI D+GL   R + E     D +A Y   LWTAPE+L    + H  + T K DVYSFGII QE+  RNG FY+  ++L PK+I++ V   Q   +RP    +  C E L  ++   W ED + RPDF  IK  +   NK       L   LSRMEQYANNLE LV +RT+ YLEEKRK E+LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFT++SAESTP+QV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H REIA MSLA L  +  F+I H+PN ++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMES G  L+IHMS  + +VL  F  F +  RG V MKGKG   TYWL GE +
Sbjct:  108 KPDAFIGPGCTYSVASVGRFASHWKLPLITAGGPAYGFD--KWEEFKTIVRTGP--TTKKLGDFVNYLHGQFNWSSRALMIFHDLKQDDRPHYFLSEGIYTVLREENI---TVLAFPYEDEQTYNYKDMITFIKDNGRIVYICGPLPTFFQIMKLFEDEVKSPEDYAIFYLDVFAESLSGDVPMPWQGSDIQWNDPIK-LFQSVFVVTYQEPDSPEYTAFRKELHKRAIQDFNVQLEPSMMDFIAGCFHDGFVLYAKALSEALADGVSQNDGINITARMQNRRLWGVTGLVSIDQKNARFTDFSLWAMTNLKSGQYAIVGHYNGTSKEILWSPTEK--IQW--PKGCPPLDYPPCGFS--PCKEDHLPVLGIVAVGSGLALIIFG-ISSFLIYRKLKLEKELAGMLWRIRWEELQFESPNKYHKRA-------------GSRLTLSQRG---------------SSYGSLITAHGK-------------------------YQLFAKTGYFKGNLVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNYLHNSYIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---NEDSHALYAKKLWTAPELL--IYDRHPPQGTQKGDVYSFGIILQEIALRNGPFYVEGMDLSPKEIIQKVRNGQKPYFRPTTDNSRHCEE-LTILMEGCWSEDPAERPDFSHIKVFIAKFNKQHQYSQYL---LSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIAGMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALRIHMSSATKEVLDEFGYFELQLRGDVEMKGKGKMRTYWLLGEKT 1046          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: si:dkey-37g12.1 (si:dkey-37g12.1 [Source:ZFIN;Acc:ZDB-GENE-090312-145])

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 410/1041 (39.39%), Postives = 579/1041 (55.62%), Query Frame = 2
Query:  284 YADADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSEN-------YKN--KTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKND---TDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG----SVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPN--RK--IGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRG-TKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGED 3340
            Y   D +C   R P      L  + K   + GP C    A  A+L  FW+I +I+P  A   F  +  + Y TLTRV        L   F +I + + W  + +IY+          G  + +E+       Y++   +       N   +L  +M     ++V+    + VR +L++AHK    NG++VF   +        QK  +   D    D  +  AK+AY++L  ++  +P  + Y+ F + V +R+   +G      E+ +    + HD++ LYA ALN+T+A N    +G  +TR+MWNRTI+GI G+++ID +GDR  +Y +  +       ++VANY G    Y  V+G  I W      PP   P CG+  + C N  RK  I  G I+ +  A  L   ++     Y++ K   E + M W I  ++V   E         S T+P     +K  Q S   +                    ++ +PS                               TA+YKG + ++  ++  +   +N  LL E+K+ ++L + ++C+FIG  L+  Q ++LTEYCPKGSLQDIL+NE I LDW FKFSL+ DI +GM YLH S +  HG+L SS+C+VDSRFVLK+ DFGL  +R    E    +D +     LLW APE+LR++  I    + K DVYSF II QEVVYR G FY+ + +  P++IVE V      P RP++   E C E L  ++   W+E  + RPDF  I+  ++  +  G S NILD+LLSRMEQYA NLEE+V++RT +  EEK++ E LL  MLP+SVA QLI  +TV AE+Y+ V+IYFSDI GFTA+SA  TPMQV+ +LN LYT FD+II+  +VYKVETIGDAYMV SGLP RNGD H +EIARMSLA +  +  F  PH P +++ +RIG+HSGP  AGVVGLKMPRYCLFGDTVNTASRMES GLPLKIH+S  +  +L TF+ F    RG +++KGKG+  T+WL GED
Sbjct:   65 YHYVDDECNDLRGP-GKIAALYNRHKYSAFIGPSCSNVCAVTAKLAAFWNIAVISPVCADQQF--LDKKAYPTLTRVFGPFTK--LGAFFVEICKQFGWQHIGIIYDGKPTWAIPVEGIKYQAEHNNITVAKYQDIHSSLSQGSTSNWSRVLN-EMAQVARIIVISAHGKVVRSLLIEAHKKGLTNGDFVFFCFE-----PYKQKVLFGSFDWEQGDSYDSMAKQAYQALFFLSLYKPSDKRYQAFSENVISRSKIDFGYTYAQTEKVSVLAAIAHDTVWLYAHALNETLAENGNPYDGLAVTRRMWNRTIKGIQGDVTIDASGDRELNYMMKQIRGSNNQCQVVANYFGT---YKAVKGVQILWPGGLTSPPKDSPDCGFRGELCINLERKFLIALGIIAGLMAAGTLAICVL-----YRKYKLPEEASKMLWTINANDVIMMEHH-------SSTVPEKSHRSKPLQASLESIIC-----------------SMQDKPSAHR----------------------------TAVYKGTICSVSFVN-LRSTHLNSELLAELKQFRDLTHYNLCKFIGAALETSQPFILTEYCPKGSLQDILQNESIKLDWTFKFSLMLDIVKGMDYLHHSPLQYHGHLSSSSCVVDSRFVLKVTDFGLNSVRRLDTEQSPGSDPWT---ALLWRAPELLRQS--IPANGTQKGDVYSFAIIAQEVVYRRGPFYIPNSHFSPREIVERVRAGGCSPSRPYIDRAE-CVEELESLVVSCWRETPAERPDFSYIRTAIKKNSPHGVSENILDDLLSRMEQYACNLEEIVSERTAELQEEKKRAEGLLTQMLPRSVASQLIAGKTVRAETYDCVTIYFSDIEGFTAMSASLTPMQVVNVLNDLYTYFDNIIDYHNVYKVETIGDAYMVVSGLPIRNGDDHAKEIARMSLAIVQGLRSFHSPHVPEQQLRVRIGVHSGPCVAGVVGLKMPRYCLFGDTVNTASRMESYGLPLKIHVSSSTKSLLDTFRNFRCELRGDIHIKGKGWVRTFWLLGED 1027          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: si:dkey-37g12.1 (si:dkey-37g12.1 [Source:ZFIN;Acc:ZDB-GENE-090312-145])

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 401/1031 (38.89%), Postives = 570/1031 (55.29%), Query Frame = 2
Query:  284 YADADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSEN-------YKN--KTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKND---TDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG----SVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPN--RK--IGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRG-TKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGY 3310
            Y   D +C   R P      L  + K   + GP C    A  A+L  FW+I +I+P  A   F  +  + Y TLTRV        L   F +I + + W  + +IY+          G  + +E+       Y++   +       N   +L  +M     ++V+    + VR +L++AHK    NG++VF   +        QK  +   D    D  +  AK+AY++L  ++  +P  + Y+ F + V +R+   +G      E+ +    + HD++ LYA ALN+T+A N    +G  +TR+MWNRTI+GI G+++ID +GDR  +Y +  +       ++VANY G    Y  V+G  I W      PP   P CG+  + C N  RK  I  G I+ +  A  L   ++     Y++ K   E + M W I  ++V   E         S T+P     +K  Q S   +                    ++ +PS                               TA+YKG + ++  ++  +   +N  LL E+K+ ++L + ++C+FIG  L+  Q ++LTEYCPKGSLQDIL+NE I LDW FKFSL+ DI +GM YLH S +  HG+L SS+C+VDSRFVLK+ DFGL  +R    E    +D +     LLW APE+LR++  I    + K DVYSF II QEVVYR G FY+ + +  P++IVE V      P RP++   E C E L  ++   W+E  + RPDF  I+  ++  +  G S NILD+LLSRMEQYA NLEE+V++RT +  EEK++ E LL  MLP+SVA QLI  +TV AE+Y+ V+IYFSDI GFTA+SA  TPMQV+ +LN LYT FD+II+  +VYKVETIGDAYMV SGLP RNGD H +EIARMSLA +  +  F  PH P +++ +RIG+HSGP  AGVVGLKMPRYCLFGDTVNTASRMES GLPLKIH+S  +  +L TF+ F    RG +++K + +
Sbjct:   65 YHYVDDECNDLRGP-GKIAALYNRHKYSAFIGPSCSNVCAVTAKLAAFWNIAVISPVCADQQF--LDKKAYPTLTRVFGPFTK--LGAFFVEICKQFGWQHIGIIYDGKPTWAIPVEGIKYQAEHNNITVAKYQDIHSSLSQGSTSNWSRVLN-EMAQVARIIVISAHGKVVRSLLIEAHKKGLTNGDFVFFCFE-----PYKQKVLFGSFDWEQGDSYDSMAKQAYQALFFLSLYKPSDKRYQAFSENVISRSKIDFGYTYAQTEKVSVLAAIAHDTVWLYAHALNETLAENGNPYDGLAVTRRMWNRTIKGIQGDVTIDASGDRELNYMMKQIRGSNNQCQVVANYFGT---YKAVKGVQILWPGGLTSPPKDSPDCGFRGELCINLERKFLIALGIIAGLMAAGTLAICVL-----YRKYKLPEEASKMLWTINANDVIMMEHH-------SSTVPEKSHRSKPLQASLESIIC-----------------SMQDKPSAHR----------------------------TAVYKGTICSVSFVN-LRSTHLNSELLAELKQFRDLTHYNLCKFIGAALETSQPFILTEYCPKGSLQDILQNESIKLDWTFKFSLMLDIVKGMDYLHHSPLQYHGHLSSSSCVVDSRFVLKVTDFGLNSVRRLDTEQSPGSDPWT---ALLWRAPELLRQS--IPANGTQKGDVYSFAIIAQEVVYRRGPFYIPNSHFSPREIVERVRAGGCSPSRPYIDRAE-CVEELESLVVSCWRETPAERPDFSYIRTAIKKNSPHGVSENILDDLLSRMEQYACNLEEIVSERTAELQEEKKRAEGLLTQMLPRSVASQLIAGKTVRAETYDCVTIYFSDIEGFTAMSASLTPMQVVNVLNDLYTYFDNIIDYHNVYKVETIGDAYMVVSGLPIRNGDDHAKEIARMSLAIVQGLRSFHSPHVPEQQLRVRIGVHSGPCVAGVVGLKMPRYCLFGDTVNTASRMESYGLPLKIHVSSSTKSLLDTFRNFRCELRGDIHIKVQSF 1017          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 296/501 (59.08%), Postives = 369/501 (73.65%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGK 3304
            + F  T  +KGNVVA+K ++  K++E+ R +L E+K ++++   H+ RF+G C+D P   ++TEYCP+GSLQDILENE INLDWMF+ SL+ DI +GM +LH S IG HGNLKSSNC+VDSRFVLKI D+GL   R + E    +D YA Y   LWTAPE+LR T       + K DVYSFGII QE+  RNG FY+  ++L PK+IV+ V   Q   +RP + +    SE L  ++ + W E+   RPDF  IK  +   NK G S +ILDNLLSRMEQYANNLE+LV +RT+ YLEEKRK E+LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFT++SAESTPMQV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H REIARMSLA L A+  F+I H+PN ++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  L+IH+S  + +VL  F  F +  RG + MK K
Sbjct:  184 QIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---ADDAYALYAKKLWTAPELLRMTRP-PAPGTQKGDVYSFGIILQEIALRNGCFYIQGMDLSPKEIVQKVRNGQRPYFRPTV-DISCHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNKEG-STSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 677          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 296/501 (59.08%), Postives = 369/501 (73.65%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGK 3304
            + F  T  +KGNVVA+K ++  K++E+ R +L E+K ++++   H+ RF+G C+D P   ++TEYCP+GSLQDILENE INLDWMF+ SL+ DI +GM +LH S IG HGNLKSSNC+VDSRFVLKI D+GL   R + E    +D YA Y   LWTAPE+LR  T      + K DVYSFGII QE+  RNG FY+  ++L PK+IV+ V   Q   +RP + +    SE L  ++ + W E+   RPDF  IK  +   NK G S +ILDNLLSRMEQYANNLE+LV +RT+ YLEEKRK E+LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFT++SAESTPMQV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H REIARMSLA L A+  F+I H+PN ++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  L+IH+S  + +VL  F  F +  RG + MK K
Sbjct:   54 QIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---ADDAYALYAKKLWTAPELLR-MTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMDLSPKEIVQKVRNGQRPYFRPTV-DISCHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNKEG-STSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 547          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 296/501 (59.08%), Postives = 369/501 (73.65%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGK 3304
            + F  T  +KGNVVA+K ++  K++E+ R +L E+K ++++   H+ RF+G C+D P   ++TEYCP+GSLQDILENE INLDWMF+ SL+ DI +GM +LH S IG HGNLKSSNC+VDSRFVLKI D+GL   R + E    +D YA Y   LWTAPE+LR  T      + K DVYSFGII QE+  RNG FY+  ++L PK+IV+ V   Q   +RP + +    SE L  ++ + W E+   RPDF  IK  +   NK G S +ILDNLLSRMEQYANNLE+LV +RT+ YLEEKRK E+LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFT++SAESTPMQV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H REIARMSLA L A+  F+I H+PN ++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  L+IH+S  + +VL  F  F +  RG + MK K
Sbjct:  139 QIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---ADDAYALYAKKLWTAPELLR-MTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMDLSPKEIVQKVRNGQRPYFRPTV-DISCHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNKEG-STSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 632          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 296/501 (59.08%), Postives = 369/501 (73.65%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGK 3304
            + F  T  +KGNVVA+K ++  K++E+ R +L E+K ++++   H+ RF+G C+D P   ++TEYCP+GSLQDILENE INLDWMF+ SL+ DI +GM +LH S IG HGNLKSSNC+VDSRFVLKI D+GL   R + E    +D YA Y   LWTAPE+LR  T      + K DVYSFGII QE+  RNG FY+  ++L PK+IV+ V   Q   +RP + +    SE L  ++ + W E+   RPDF  IK  +   NK G S +ILDNLLSRMEQYANNLE+LV +RT+ YLEEKRK E+LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFT++SAESTPMQV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H REIARMSLA L A+  F+I H+PN ++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  L+IH+S  + +VL  F  F +  RG + MK K
Sbjct:  107 QIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---ADDAYALYAKKLWTAPELLR-MTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMDLSPKEIVQKVRNGQRPYFRPTV-DISCHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNKEG-STSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 600          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 296/501 (59.08%), Postives = 369/501 (73.65%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGK 3304
            + F  T  +KGNVVA+K ++  K++E+ R +L E+K ++++   H+ RF+G C+D P   ++TEYCP+GSLQDILENE INLDWMF+ SL+ DI +GM +LH S IG HGNLKSSNC+VDSRFVLKI D+GL   R + E    +D YA Y   LWTAPE+LR T       + K DVYSFGII QE+  RNG FY+  ++L PK+IV+ V   Q   +RP + +    SE L  ++ + W E+   RPDF  IK  +   NK G S +ILDNLLSRMEQYANNLE+LV +RT+ YLEEKRK E+LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFT++SAESTPMQV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H REIARMSLA L A+  F+I H+PN ++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  L+IH+S  + +VL  F  F +  RG + MK K
Sbjct:  212 QIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---ADDAYALYAKKLWTAPELLRMTRP-PAPGTQKGDVYSFGIILQEIALRNGCFYIQGMDLSPKEIVQKVRNGQRPYFRPTV-DISCHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNKEG-STSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 705          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr1 (natriuretic peptide receptor 1 [Source:MGI Symbol;Acc:MGI:97371])

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 431/1041 (41.40%), Postives = 609/1041 (58.50%), Query Frame = 2
Query:  290 DADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRV--NSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSENYKNKTFKSV-VLLNAETLLEID----------MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNN------QKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSVEES---NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFA--LINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSN-IGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            +A   C  +  PL   V L  +  P V+ GP C YS AP+ R    W +P++T  GA  +   +K +EY+  TR   + + + D +  L R++     W    L+     L   R     F  E    +  + + + +N +  +E D          +  +  V+ +C  P++ R ++L A        +YVF ++D+             +KPW   +  D    +A++A+++   +T + P++ EY  F+K++K   ++K+    E    N     FHD LLLY  A+ +T+A   T  +G  IT++MWNR+ QG+TG + ID NGDR+ D+S+ DMD +TG F++V N+ G  Q  + V    + W      PPP  P CG++ ++    +    T+ ++ +   L     LI  F+IY++++ + EL +  W + W++++       L    S           R   S RG               S  G ++ +                             + F  TA YKGN+VA+K+++  K++E+ R +L E+K ++++ NEH+ RF+G C D P   +LTEYCP+GSLQDILENE I LDWMF++SL  DI +GM++LH+  IG HGNLKSSNC+VD RFVLKI D+GLE  R  +        +  +   LWTAPE+LR  +    + S   DVYSFGII QE+  R+GVFY+  ++L PK+I+E VT+ +  P+RP +       E L +++++ W ED   RP F+ I+  +R  NK  +S NILDNLLSRMEQYANNLEELV +RT+ YLEEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFTALSAESTPMQV+ LLN LYT FD++I++FDVYKVETIGDAYMV SGLP RNG +H RE+ARM+LA L A+  F+I H+P +++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  L+IH+S ++  VL  F  F +  RG V MKGKG   TYWL GE
Sbjct:   83 NAAGVCSDTAAPLA-AVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLT-AGAPALGIGVK-DEYALTTRTGPSHVKLGDFVTALHRRL----GWEHQALVLYADRLGDDRPC--FFIVEGLYMRVRERLNITVNHQEFVEGDPDHYTKLLRTVQRKGRVIYICSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPWERDDGQDR---RARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYW--PLGYPPPDIPKCGFDNEDPACNQDHFSTLEVLALVGSLSLVSFLIVSFFIYRKMQLEKELVSELWRVRWEDLQPSSLERHLRSAGS-----------RLTLSGRG---------------SNYGSLLTTEGQ-------------------------FQVFAKTAYYKGNLVAVKRVN-RKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAIGSHGNLKSSNCVVDGRFVLKITDYGLESFRDPEP----EQGHTLFAKKLWTAPELLRMASP-PARGSQAGDVYSFGIILQEIALRSGVFYVEGLDLSPKEIIERVTRGEQPPFRPSMDLQSHLEE-LGQLMQRCWAEDPQERPPFQQIRLALRKFNKE-NSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGE 1050          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 296/512 (57.81%), Postives = 374/512 (73.05%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNI-GPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            + F  T  +KGNVVA+K ++  K++E+ R +L E+K ++++   H+ RFIG C+D P   ++TEYCP+GSLQDILEN+ INLDWMF++SL+ D+ +GM +LH++I   HG+LKSSNC+VDSRFVLKI D+GL   R T E    +D +A Y   LWTAPE+L     +      KADVYSF II QE+  R+G FYL  ++L PK+IV+ V   Q   +RP +   ++ +E L  ++ + W +D + RPDF  IKG +R  NK G + +ILDNLL RMEQYANNLE+LV +RT+ YLEEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFTALSAESTPMQV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG  H  EIARM+LA L A+  F+I H+P+ ++ LRIG+H+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  LKIH+S  + D L     F +  RG V MKGKG   TYWL GE
Sbjct:  535 QIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAE---PDDSHALYAKKLWTAPELL-SGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQL-NEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGE 1039          

HSP 2 Score: 161.77 bits (408), Expect = 7.557e-40
Identity = 121/441 (27.44%), Postives = 204/441 (46.26%), Query Frame = 2
Query:  287 ADADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNW-SRVKLIYEQTFLN---FCRSVGTLFDSENYKNKTFKSVVLLNAETLLEID---MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTN------NQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG---SVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIG-KKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFAL--INGFYIYKRVKFQAELNAMNWLIPWDNVE 1549
            ++ D  C     PL   V L +   P +  GP C Y  A +AR    W +P++T  GA       K+E Y TL R         L      +   +NW +R  L+Y     +      ++  +F++    N + +  V        E     + +   +V +C   E +  ILL+A + N  NG+YVF  +D+              +PW   N T E     +EA++++L +T + P + EY+ F   +  R  E +G   +    N   G F+D +LLYA  LN+T+    T E+G  I  KM  R   G+TG + +D+N DR  D+ +  M D D+G F+  A+Y G +KQ++    G+ I WV  K  PP   P C ++  +    K    T++++ +   + F +  ++ F I++++  + EL +M W I W+ ++
Sbjct:   69 SELDGACSEYLAPLR-AVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLLT-AGAVASGFAAKNEHYRTLVRTGP--SAPKLGEFVVTLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPW-QDNRTQEQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWW--TGRPIPWV--KGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQ 500          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 296/512 (57.81%), Postives = 374/512 (73.05%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNI-GPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            + F  T  +KGNVVA+K ++  K++E+ R +L E+K ++++   H+ RFIG C+D P   ++TEYCP+GSLQDILEN+ INLDWMF++SL+ D+ +GM +LH++I   HG+LKSSNC+VDSRFVLKI D+GL   R T E    +D +A Y   LWTAPE+L     +      KADVYSF II QE+  R+G FYL  ++L PK+IV+ V   Q   +RP +   ++ +E L  ++ + W +D + RPDF  IKG +R  NK G + +ILDNLL RMEQYANNLE+LV +RT+ YLEEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFTALSAESTPMQV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG  H  EIARM+LA L A+  F+I H+P+ ++ LRIG+H+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  LKIH+S  + D L     F +  RG V MKGKG   TYWL GE
Sbjct:  101 QIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAE---PDDSHALYAKKLWTAPELL-SGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQL-NEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGE 605          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Gucy2g (guanylate cyclase 2g [Source:MGI Symbol;Acc:MGI:106025])

HSP 1 Score: 489.96 bits (1260), Expect = 6.317e-154
Identity = 341/1042 (32.73%), Postives = 518/1042 (49.71%), Query Frame = 2
Query:  374 FGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSV----GTLFDSENYK-NKTFKSVVLLNAETLLE---IDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPES----EEYRNFIKEVKNRT--NEKYGSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFI--TRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPV------EGQIIDWVNKKNLP------PPSFPVCGYNRKNCPNRK--IGAGTISLITMAAILLF------ALINGFYIYK-RVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINR-NLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQL-IPYRPFLSENEICSEG-LCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIPESCE 3376
            FGP C  +   I  L   W+IP+    G     +    + +   T V  +     +  + R+  +   W  + +    +  +    V    G + D   +  N T       ++  LL+    +M     V++L    E  RRIL  A  L    GE+VFI +  L         W      D+V  +  + Y S+  +           + +R  + +   R        S ++ + +    HD+LLLYA  + +       + +G  +  T +    T+QGITG + +D  G R+ DYSV  + +            G + L++P       +  I  W N  N        P   P CG++   C  +   +   T+++  +   + F      A I G  +++ R K Q+      W I +D++ T   +H+L+H+ +           R   S     K   +           G +VK                      Q++ L     F    LY+GN VAL  +    +  + +  +  EV  +  L +E+I  F GVC + P   ++T+YC KGSLQD++ N    +DW+FK S   DI  G+++LH S +  HGNLK SNCLVDS   LK+  FGL + +    +   N E   +  L WTAPE+LR   E     + + DVYSF I+ ++++++       D+   P++I+  +   +  +P RP L E++   +G +  ++R+ W E   LRP F +IK  +R  +  G   +ILD+++ ++E YAN+LEE+V +RT + + EKRK E LL +MLP  V  QLI  ++V  E +E V+I+FSDIVGFT L + S+P+QV++LLN LY+ FD  I+S DVYKVETIGDAYMV SGLP RNG  H  EIA M+L  LS    FQI H P +R++LRIG+H+GPV AGVVG+ MPRYCLFGDTVN ASRMES+ LPL+IH+S+ +   L     + + KRG +++KGKG QTT+WL G+D   V P+PE  E
Sbjct:  119 FGPACPEAAEVIGLLASEWNIPLFDFVGQMAALK----DHFWCDTCVTLVPPKQEISAVLRESLRYLGWEHIGVFGGSSADSSWEQVDEMWGAVEDGLQFHFNITASMRYNSSSSDLLQEGLRNMSYVARVIILICSSEDARRILQAAVDLGLDTGEFVFILLQQLEDSF-----WKEVLTKDKV-IRFPKVYESVFLIAPSAYGGGIGDDGFRKQVSQELRRPPFQSSITSEDQVSPYSAYLHDALLLYAQTVEEMRKAEKDFRDGRQLISTLRAGQVTLQGITGPVLLDSQGKRHVDYSVYALQES-----------GNRSLFLPFLHYDSFQKVIRPWRNDSNTSWPHGSLPEYKPGCGFHNDLCKTKPPTVAGMTVTVTAVIPTVTFLVLASAAAITGLMLWRLRGKVQSHPGDTWWQIRYDSI-TLLPQHKLSHRGTPV--------SRRNVSDTSTVKASAD----------CGSLVKRH--------------------QDEELF----FAPVGLYQGNQVALCYIGDEAEAWVKKPTVRREVCLMCELKHENIVPFFGVCTEPPNICIVTQYCKKGSLQDVMRNSDHEIDWIFKLSFAYDIVNGLLFLHGSPLRSHGNLKPSNCLVDSHMQLKLSGFGLWEFKHGSTWRSYNQEATDHSELYWTAPELLR-LRESPCSGTPQGDVYSFAILLRDLIHQQAHGPFEDLEAAPEEIISRIKDPRAPVPLRPSLLEDK--GDGRIVALVRECWDESPELRPIFPSIKKTLREASPRGHV-SILDSMMGKLETYANHLEEVVEERTRELVAEKRKVEKLLSTMLPSFVGEQLIAGKSVEPEHFESVTIFFSDIVGFTKLCSLSSPLQVVKLLNDLYSLFDHTIQSHDVYKVETIGDAYMVASGLPIRNGAQHADEIATMALHLLSVTTHFQIGHMPEERLKLRIGLHTGPVVAGVVGITMPRYCLFGDTVNMASRMESSSLPLRIHVSQSTAGALLAAGGYHLQKRGTISVKGKGEQTTFWLKGKDGFPV-PLPEFTE 1091          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 484.952 bits (1247), Expect = 9.946e-153
Identity = 243/436 (55.73%), Postives = 318/436 (72.94%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNI-GPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSG 3109
            + F  T  +KGNVVA+K ++  K++E+ R +L E+K ++++   H+ RFIG C+D P   ++TEYCP+GSLQDILEN+ INLDWMF++SL+ D+ +GM +LH++I   HG+LKSSNC+VDSRFVLKI D+GL   R T E    +D +A Y   LWTAPE+L     +      KADVYSF II QE+  R+G FYL  ++L PK+IV+ V   Q   +RP +   ++ +E L  ++ + W +D + RPDF  IKG +R  NK G + +ILDNLL RMEQYANNLE+LV +RT+ YLEEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFTALSAESTPMQV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG  H  EIARM+LA L A+  F+I H+P+ ++ LRIG+H+G
Sbjct:  535 QIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAE---PDDSHALYAKKLWTAPELL-SGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQL-NEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTG 963          

HSP 2 Score: 161.77 bits (408), Expect = 8.433e-40
Identity = 121/441 (27.44%), Postives = 204/441 (46.26%), Query Frame = 2
Query:  287 ADADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNW-SRVKLIYEQTFLN---FCRSVGTLFDSENYKNKTFKSVVLLNAETLLEID---MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTN------NQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG---SVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIG-KKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFAL--INGFYIYKRVKFQAELNAMNWLIPWDNVE 1549
            ++ D  C     PL   V L +   P +  GP C Y  A +AR    W +P++T  GA       K+E Y TL R         L      +   +NW +R  L+Y     +      ++  +F++    N + +  V        E     + +   +V +C   E +  ILL+A + N  NG+YVF  +D+              +PW   N T E     +EA++++L +T + P + EY+ F   +  R  E +G   +    N   G F+D +LLYA  LN+T+    T E+G  I  KM  R   G+TG + +D+N DR  D+ +  M D D+G F+  A+Y G +KQ++    G+ I WV  K  PP   P C ++  +    K    T++++ +   + F +  ++ F I++++  + EL +M W I W+ ++
Sbjct:   69 SELDGACSEYLAPLR-AVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLLT-AGAVASGFAAKNEHYRTLVRTGP--SAPKLGEFVVTLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPW-QDNRTQEQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWW--TGRPIPWV--KGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQ 500          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P18293|ANPRA_MOUSE (Atrial natriuretic peptide receptor 1 OS=Mus musculus OX=10090 GN=Npr1 PE=1 SV=2)

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 431/1041 (41.40%), Postives = 609/1041 (58.50%), Query Frame = 2
Query:  290 DADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRV--NSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSENYKNKTFKSV-VLLNAETLLEID----------MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNN------QKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSVEES---NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFA--LINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSN-IGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            +A   C  +  PL   V L  +  P V+ GP C YS AP+ R    W +P++T  GA  +   +K +EY+  TR   + + + D +  L R++     W    L+     L   R     F  E    +  + + + +N +  +E D          +  +  V+ +C  P++ R ++L A        +YVF ++D+             +KPW   +  D    +A++A+++   +T + P++ EY  F+K++K   ++K+    E    N     FHD LLLY  A+ +T+A   T  +G  IT++MWNR+ QG+TG + ID NGDR+ D+S+ DMD +TG F++V N+ G  Q  + V    + W      PPP  P CG++ ++    +    T+ ++ +   L     LI  F+IY++++ + EL +  W + W++++       L    S           R   S RG               S  G ++ +                             + F  TA YKGN+VA+K+++  K++E+ R +L E+K ++++ NEH+ RF+G C D P   +LTEYCP+GSLQDILENE I LDWMF++SL  DI +GM++LH+  IG HGNLKSSNC+VD RFVLKI D+GLE  R  +        +  +   LWTAPE+LR  +    + S   DVYSFGII QE+  R+GVFY+  ++L PK+I+E VT+ +  P+RP +       E L +++++ W ED   RP F+ I+  +R  NK  +S NILDNLLSRMEQYANNLEELV +RT+ YLEEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFTALSAESTPMQV+ LLN LYT FD++I++FDVYKVETIGDAYMV SGLP RNG +H RE+ARM+LA L A+  F+I H+P +++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  L+IH+S ++  VL  F  F +  RG V MKGKG   TYWL GE
Sbjct:   83 NAAGVCSDTAAPLA-AVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLT-AGAPALGIGVK-DEYALTTRTGPSHVKLGDFVTALHRRL----GWEHQALVLYADRLGDDRPC--FFIVEGLYMRVRERLNITVNHQEFVEGDPDHYTKLLRTVQRKGRVIYICSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPWERDDGQDR---RARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYW--PLGYPPPDIPKCGFDNEDPACNQDHFSTLEVLALVGSLSLVSFLIVSFFIYRKMQLEKELVSELWRVRWEDLQPSSLERHLRSAGS-----------RLTLSGRG---------------SNYGSLLTTEGQ-------------------------FQVFAKTAYYKGNLVAVKRVN-RKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAIGSHGNLKSSNCVVDGRFVLKITDYGLESFRDPEP----EQGHTLFAKKLWTAPELLRMASP-PARGSQAGDVYSFGIILQEIALRSGVFYVEGLDLSPKEIIERVTRGEQPPFRPSMDLQSHLEE-LGQLMQRCWAEDPQERPPFQQIRLALRKFNKE-NSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGE 1050          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P18910|ANPRA_RAT (Atrial natriuretic peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Npr1 PE=1 SV=1)

HSP 1 Score: 771.541 bits (1991), Expect = 0.000e+0
Identity = 434/1041 (41.69%), Postives = 612/1041 (58.79%), Query Frame = 2
Query:  290 DADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRV--NSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSENYKNKTFKSV-VLLNAETLLEID----------MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNN------QKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG-SVEES--NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAIL--LFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSN-IGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            +A   C  +  PL   V L  +  P V+ GP C YS AP+ R    W +P++T  GA  +   +K +EY+  TR   + + + D +  L R++     W    L+     L   R     F  E    +  + + + +N +  +E D          +  +  V+ +C  P++ R ++L A        +YVF ++D+      +      QKPW   +  D     A++A+++   +T + P++ EY  F+K++K   ++K+  +VE+   N     FHD LLLY  A+ +T+A   T  +G  IT++MWNR+ QG+TG + ID NGDR+ D+S+ DMD +TG F++V NY G  Q  + V    + W      PPP  P CG++ ++    +    T+ ++ +   L  +  LI  F+IY++++ + EL +  W + W++++       L    S           R   S RG               S  G ++ +                             + F  TA YKGN+VA+K+++  K++E+ R +L E+K ++++ NEH+ RF+G C D P   +LTEYCP+GSLQDILENE I LDWMF++SL  DI +GM++LH+  I  HGNLKSSNC+VD RFVLKI D+GLE  R  +        +  +   LWTAPE+LR  +    + S   DVYSFGII QE+  R+GVFY+  ++L PK+I+E VT+ +  P+RP +       E L +++++ W ED   RP F+ I+  +R  NK  +S NILDNLLSRMEQYANNLEELV +RT+ YLEEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFTALSAESTPMQV+ LLN LYT FD++I++FDVYKVETIGDAYMV SGLP RNG +H RE+ARM+LA L A+  F+I H+P +++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  LKIH+S ++  VL  F  F +  RG V MKGKG   TYWL GE
Sbjct:   83 NAAGVCSDTAAPLA-AVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLT-AGAPALGIGVK-DEYALTTRTGPSHVKLGDFVTALHRRL----GWEHQALVLYADRLGDDRPC--FFIVEGLYMRVRERLNITVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPWERGDGQDR---SARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYW--PLGYPPPDVPKCGFDNEDPACNQDHFSTLEVLALVGSLSLISFLIVSFFIYRKMQLEKELVSELWRVRWEDLQPSSLERHLRSAGS-----------RLTLSGRG---------------SNYGSLLTTEGQ-------------------------FQVFAKTAYYKGNLVAVKRVN-RKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFRDPEP----EQGHTLFAKKLWTAPELLRMASP-PARGSQAGDVYSFGIILQEIALRSGVFYVEGLDLSPKEIIERVTRGEQPPFRPSMDLQSHLEE-LGQLMQRCWAEDPQERPPFQQIRLALRKFNKE-NSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGE 1050          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P16066|ANPRA_HUMAN (Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1)

HSP 1 Score: 770 bits (1987), Expect = 0.000e+0
Identity = 435/1034 (42.07%), Postives = 608/1034 (58.80%), Query Frame = 2
Query:  305 CLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNS--IIVTDHLKVLFRKIFQMYNWSRVKLI---YEQTFLNFCRSV--GTLFDSENYKNKTFKSVVL----LNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNN------QKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSVEES---NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAIL--LFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSN-IGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            C  +  PL   V L  +  P V+ GP C Y+ AP+ R    W +P++T  GA  +   +K +EY+  TR       + D +  L R++     W R  L+   Y       C  +  G      +  N T   +      L+  T L   M  +  V+ +C  P++ R ++L A +      +YVF ++D+             ++PW  + D  +V+  A++A+++   +T + P++ EY  F+K++K+   E++    E    N     FHD LLLY  A+ +T+A   T  +G  IT++MWNR+ QG+TG + ID +GDR  D+S+ DMD + G F++V NY G  Q  + V G+ ++W      PPP  P CG++ ++    +    T+ ++ +   L  L  LI  F+IY++++ + EL +  W + W++VE       L    S           R   S RG               S  G ++ +                             + F  TA YKGN+VA+K+++  K++E+ R +L E+K ++++ NEH+ RF+G C D P   +LTEYCP+GSLQDILENE I LDWMF++SL  DI +GM++LH+  I  HGNLKSSNC+VD RFVLKI D+GLE  R     L     +  Y   LWTAPE+LR  +   ++ S   DVYSFGII QE+  R+GVF++  ++L PK+I+E VT+ +  P+RP L+      E L  ++++ W ED   RP F+ I+  +R  N+  +S NILDNLLSRMEQYANNLEELV +RT+ YLEEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFTALSAESTPMQV+ LLN LYT FD++I++FDVYKVETIGDAYMV SGLP RNG +H  E+ARM+LA L A+  F+I H+P +++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  LKIH+S ++  VL  F  F +  RG V MKGKG   TYWL GE
Sbjct:   92 CSDTAAPLA-AVDLKWEHNPAVFLGPGCVYAAAPVGRFTAHWRVPLLT-AGAPALGFGVK-DEYALTTRAGPSYAKLGDFVAALHRRL----GWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPW-ERGDGQDVS--ARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAFRVVLNYNGTSQELVAVSGRKLNW--PLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGSLSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGS-----------RLTLSGRG---------------SNYGSLLTTEGQ-------------------------FQVFAKTAYYKGNLVAVKRVN-RKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFRD----LDPEQGHTVYAKKLWTAPELLRMASP-PVRGSQAGDVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEE-LGLLMQRCWAEDPQERPPFQQIRLTLRKFNRE-NSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGE 1054          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P55202|ANPRB_ANGJA (Atrial natriuretic peptide receptor 2 OS=Anguilla japonica OX=7937 GN=npr2 PE=2 SV=1)

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 422/1027 (41.09%), Postives = 584/1027 (56.86%), Query Frame = 2
Query:  359 KPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKL---------------IYEQTFLNFCRSVGTL--FDSENYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKT--NNQKPWYSK--NDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG-SVEES--NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKN--CPNRKIGA-GTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNV--ETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKST-KADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDS 3343
            KP  +FGP C YS+A + R +  W +P+IT    +  F     EEY T+ R    + T  L      +   +NW+                   I E  FL   R   T+     ++ KN  ++ ++           + S   +V +C   ++    +           +Y    +D+        + KPW S   N TD +       ++S+  +TA+ P++ EY+ F +E+  R  +++   +E S  +   G F+D  +LYA ALN+T+A   +  +G  IT+KM NR   G+TG +S D+N DR+ D+++  M +  TG + IVA Y G  +  +  E + I W   K  PP   P C ++     C   ++   G +++ +  A+++F  I+ F IY+++K + EL  M W I W+ +  E+  K H+                 R   S+RG               S  G ++ +                             + F  T  +KGN+VA+K ++  K++E+ R +L E+K ++++   H+ RFIG C+D P   ++TEYCP+GSLQDILENE INLDWMF++SL+ DI +GM +LH S IG HGNLKSSNC+VDSRFVLKI D+GL   R + E     D +A Y   LWTAPE+L    + H  + T K DVYSFGII QE+  RNG FY+  ++L PK+IV+ V   Q   +RP  ++    SE L  ++   W ED + RPDF  IK  +  LNK G S +IL+NLLSRMEQYANNLE LV +RT+ YLEEKRK E+LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFT++SAESTP+QV+ LLN LYT FD+II++FDVYKVETIGDAYMV S    RNG +H REIA MSLA L  +  F+I H+PN ++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  LKIH+S  + +VL  F  F +  RG V MKGKG   TYWL GE +
Sbjct:  101 KPDAFFGPGCVYSVASVGRFVNHWKLPLITAWAPAFGFDS--KEEYRTIVRTG--LSTTKLGEFAHYLHSHFNWTTRAFMLFHDLKVDDRPYYFISEGVFLVLRRENITVEAVPYDDQKNSDYREMI---------SSLKSNGRIVYICGPLDTFLEFMRIFQNEGLPPEDYAIFYLDMFAKSILDKDYKPWESSDINWTDPIKL-----FKSVFVITAKEPDNPEYKAFQRELHARAKQEFSVQLEPSLEDIIAGCFYDGFMLYAQALNETLAEGGSQNDGINITQKMQNRRFWGVTGLVSTDKNNDRDIDFNLWAMTNHKTGQYGIVAYYNGTNKEIVWSETEKIQW--PKGSPPLDNPPCVFSMDEPFCNEDQLPVLGIVAVGSGLALIIFG-ISSFLIYRKLKLEKELAGMLWRIRWEELQFESPNKYHKCA-------------GSRLTISQRG---------------SSYGSLITAHGK-------------------------YQLFAKTGYFKGNLVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNFLHNSYIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---NEDSHALYAKKLWTAPELL--IYDRHPPQGTQKGDVYSFGIILQEIALRNGPFYVDGMDLSPKEIVQKVRNGQKPYFRP-TTDTSCHSEELSILMEGCWAEDPADRPDFSYIKIFVMKLNKEG-STSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSDSQSRNGKLHAREIAGMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSATKEVLDEFGYFDLQLRGDVEMKGKGKMRTYWLLGEKT 1045          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P46197|ANPRB_BOVIN (Atrial natriuretic peptide receptor 2 OS=Bos taurus OX=9913 GN=NPR2 PE=2 SV=1)

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 297/512 (58.01%), Postives = 375/512 (73.24%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNI-GPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            + F  T  +KGNVVA+K ++  K++E+ R +L E+K ++++   H+ RFIG C+D P   ++TEYCP+GSLQDILEN+ INLDWMF++SL+ D+ +GM +LH++I   HG+LKSSNC+VDSRFVLKI D+GL   R T E    +D +A Y   LWTAPE+L     +      KADVYSFGII QE+  R+G FYL  ++L PK+IV+ V   Q   +RP +   ++ +E L  ++ + W +D + RPDF  IKG +R  NK G + +ILDNLL RMEQYANNLE+LV +RT+ YLEEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFTALSAESTPMQV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG  H  EIARM+LA L A+  F+I H+P+ ++ LRIG+H+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  LKIH+S  + D L     F +  RG V MKGKG   TYWL GE
Sbjct:  535 QIFANTGHFKGNVVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIIASHGSLKSSNCVVDSRFVLKITDYGLASFRSTAE---PDDSHALYAKKLWTAPELL-SGNPLPTTGMQKADVYSFGIILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQL-NEELVLLMERCWAQDPAERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGE 1039          

HSP 2 Score: 157.918 bits (398), Expect = 9.361e-38
Identity = 119/441 (26.98%), Postives = 205/441 (46.49%), Query Frame = 2
Query:  287 ADADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNW-SRVKLIYEQTFLN---FCRSVGTLFDSENYKNKTFKSVVLLNAETLLEID---MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSK------TNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG---SVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIG-KKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFAL--INGFYIYKRVKFQAELNAMNWLIPWDNVE 1549
            ++ D  C     PL   V L +   P +  GP C Y  A +AR    W +P++T    +  F   K E Y TL R         L      +   +NW +R  L+Y     +      ++  +F++    N + +  V        E     + +   +V +C   E +  ILL+A + N  NG+YVF  +D+           +  +PW   N T E     +EA++++L +T + P + EY+ F   +  R  E +G   +    N   G F+D +LLYA  LN+T+    T E+G  I  KM  R  +G+TG + +D+N DR  D+ +  M D  +G F+  A+Y G +KQ++    G+ I WV  K +PP   P C ++  +    K    T++++ +   + F +  ++ F I++++  + EL +M W I W+ ++
Sbjct:   69 SELDGACSEYLAPLR-AVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLLTAGAVASGF-SAKSEHYRTLVRTGP--SAPKLGEFVVMLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRSMGRPW-QDNRTREQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAEVLNETIQEGGTREDGLRIVEKMQGRRYRGVTGLVVMDKNNDRETDFVLWAMGDLVSGDFQPAAHYSGAEKQIWW--TGRPIPWV--KGVPPLDNPPCAFDMDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQ 500          
BLAST of Guanylate cyclase vs. TrEMBL
Match: G4V651 (Guanylate cyclase OS=Schistosoma mansoni OX=6183 GN=Smp_142620 PE=3 SV=1)

HSP 1 Score: 1039.25 bits (2686), Expect = 0.000e+0
Identity = 536/1030 (52.04%), Postives = 688/1030 (66.80%), Query Frame = 2
Query:  368 VWFGPICDYSLAPIARL-LPFWDIPIITPCGASGIFRQMKHE-EYSTLTRVNSIIVTDHLKVLFRKIFQMYNW-----SRVKLIYEQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNAETLLEIDMGSE--------------NAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG---SVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRK-IGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRK-TTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDI-NLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIPESCE 3376
            V FGP+ D++LA  AR     +++PI+ P   +G   Q+  + EY  LTRV  +     L+ +F    + Y W     + + ++  +        VG    +  +++   +  ++  A  LL + +  E                +++LC +PE VR I+L+AHKLN +NG+Y F N+DLL+S+T  ++PWY +  + E N +A++AYR+L+TVT  +P+S EYR F +EV+ R    Y       E   F+G FHD++ LYALALND +A   T  NGT IT++MWNRT +G+TG + ID NGDRNADYS+LDM+  TG F++V NY G  +    V G+ IDW+N  N PP   P CG++   C N   I  G +  +    ++  +L+ G   Y+R KFQAEL AMNW+IPWD ++  EK                            L ++  ESD  I +P+ + D ++   S            E+ T    ++    + F  TA Y  ++VALK L    ++E ++ L IEVKKVK+LN +HICR IGVCL+ P   ++ EYCPKGSLQD+LENEQI LDWMFKFSL+QDICRG++YLH   GPHGNLKSSNCLVDSRFVLKI DFGL  +RG      E   + ++RNLLWTAPE+L    T I+ ++S K DVYSF I+CQE+VYR GVFY+ +  N EP  IV+ V   +  P+RP L   E CSE L ++I Q+W +D S+RPDF++IK  MR LNK GDS N+LDNLLSRMEQYANNLEELV QRT QYLEEK+KTEDLLYSMLP+SVA QL RN+ VTAES+EMV+IYFSDIVGFT+LSAESTPMQV+ELLNRLYT FD IIE+FD YKVETIGDAYMV SGLPQRNG+ H RE+ARMS+AFL AIFEFQIPH+P KR+ELRIGIHSGPVCAGVVG KMPRYCLFGDTVNT+SRMESNGLPLKIH+S+Q+ DVL+TF+ FI+++RG V MKGKG Q TYWLHGED  IVDPIP   +
Sbjct:  147 VIFGPLNDFTLANAARFSTAMYNVPIVAP---AGFAHQLSDKLEYGMLTRV--LFTYSDLEWVFGNTLKHYGWLPDQQTPIAIVTTRNVRRREGVVGHTGMAGVFQHLILQKFLVKAAYKLLSVTLDDEFDVTDRFLKRLPDSARIIILCTDPEVVRDIMLEAHKLNMVNGDYAFFNMDLLSSQTKLKRPWYRETSSPEENERARQAYRALMTVTLLKPDSPEYRTFTEEVRARALRDYDFSYRDSEVTPFIGTFHDAVKLYALALNDALAKGGTITNGTLITQEMWNRTFKGVTGVVRIDANGDRNADYSLLDMNPVTGDFEVVVNYFGNDKSLSTVLGRTIDWINTDNQPPLHTPPCGFDGSECHNSHFIHIGIVGAVVFILLMTMSLVLGIIFYRRAKFQAELRAMNWIIPWDALQVTEKH---------------------------LRRYRRESD--IRSPNQSSDPLRKISS------------ETCTAAAANS----QMFARTAFYMKSIVALKPLRRQTRMEPSKALSIEVKKVKDLNCDHICRLIGVCLEVPHQCIVYEYCPKGSLQDVLENEQIKLDWMFKFSLMQDICRGVMYLHQIFGPHGNLKSSNCLVDSRFVLKITDFGLPHIRGPPPLESEVGSFIFHRNLLWTAPELLPDGDTTIYPRESIKGDVYSFAIVCQEIVYRKGVFYIQNFKNCEPDFIVKEVKAHRKPPFRPTLDSLEGCSEDLVQLICQAWDDDPSVRPDFQSIKLSMRKLNKAGDSNNVLDNLLSRMEQYANNLEELVEQRTAQYLEEKKKTEDLLYSMLPRSVAKQLFRNQPVTAESFEMVTIYFSDIVGFTSLSAESTPMQVVELLNRLYTLFDGIIENFDAYKVETIGDAYMVASGLPQRNGNKHAREVARMSIAFLKAIFEFQIPHRPEKRLELRIGIHSGPVCAGVVGQKMPRYCLFGDTVNTSSRMESNGLPLKIHISQQTFDVLKTFKSFIMTERGLVEMKGKGRQKTYWLHGEDCYIVDPIPPGAQ 1126          
BLAST of Guanylate cyclase vs. TrEMBL
Match: V4BNJ3 (Guanylate cyclase (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_191857 PE=3 SV=1)

HSP 1 Score: 956.051 bits (2470), Expect = 0.000e+0
Identity = 510/1044 (48.85%), Postives = 666/1044 (63.79%), Query Frame = 2
Query:  293 ADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIY------------------EQTFLNFCRSVGTL-----FDSENYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSV----EESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRK-IGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYL-HSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            ADS+C  +  PL     + MK    V+ GP CDY++APIAR    WDIPII+     G F   K  EY  LTRV            F  + Q + W+RV L Y                  E  ++ +    G       FD +N +    +  +L   E +          V+VLC  P++VR I++KAH+LNF NGEYVF NIDL +SK  +++PWY +NDT+E N KA++AY +L+TVT ++P S EYR F +EVK R    Y +     EE N F+G FHD++LLY+LALN+T+  N++  NG+ IT++MWNRT +GITG +SID NGDRNADYS+LDM+ +   F++VANY G K+ Y PV G+ I W      PPP  P CG++   CP  +      I +I + +I+L  LI  F+IY+ +K +AEL  MNW + W+                                           D++ G+P      ++ + SRV+              L ++NL     ++++++++G +VA+K++     + I + LL+E+K++K+L N+H  RFIG C+D     +LTEYCPKGSLQD+LENEQI LDWMF++S++QDI RGM YL  + I  HGNLKS+NC+VDSRFV+KI DFGL  LR   E   E D +A Y   LWTAPE+LR       + + K DVYSF IICQE+VYR GVFYL++++L P++I + V       +RP L E +   + L  +IR+ W ED   RPDF  +K ++R LNK GD GNILDNLLSRMEQYANNLE LV +RT  YLEEKRK EDLLYSMLPK VAGQLIR E+V AES+E V+IYFSDI GFTALSA STPMQVI+LLN LYTTFDSIIE FDVYKVETIGDAYMV SGLP RNG++H RE+ARMSLA L+A+  F+I H+PN++++LRIGIH+G V AGVVGLKMPRYCLFGDTVNT+SRMESNGLPL+IH+S Q+ +VL  F  F +  RG+V MKGKG  TTYWL+GE
Sbjct:   72 ADSNCSETLGPL---AAIDMKESVHVFIGPACDYAVAPIARFSYAWDIPIISGGAMVGAFENKK--EYKLLTRVMGPYA--RAGDFFFTMCQNFQWNRVGLWYHNYPPGSTKGKSNCFFALEAIYMKWQTMYGVEVWNRDFDEDNVRPGDHEKTLLQAKENI---------RVIVLCASPDAVRNIMIKAHELNFDNGEYVFFNIDLFSSKNASERPWYRENDTEERNDKARKAYDALMTVTLRKPNSPEYRMFSEEVKKRAKTMYNNFTYGEEEVNSFVGAFHDAVLLYSLALNETLEANISISNGSHITQRMWNRTFEGITGTVSIDANGDRNADYSLLDMNPENSKFEVVANYYGNKKKYEPVVGKDIHWAGGLTSPPPDTPTCGFDGSKCPPEEPFPEYGIVIIVLGSIILIVLIAAFFIYRHIKLEAELAEMNWRVRWE-------------------------------------------DIIFGSPE-KNHKLERQGSRVSLNR---------VKLDSNNL-----YLSSSVFQGAIVAIKKID-RHSITIQKPLLLEIKRIKDLQNDHTVRFIGACIDPSNLCVLTEYCPKGSLQDVLENEQIKLDWMFRYSIMQDIVRGMTYLTGTEIKSHGNLKSTNCVVDSRFVVKITDFGLHHLRSQTEGP-EEDTFAAYNRKLWTAPELLRMQHRPP-EGTHKGDVYSFAIICQEIVYRMGVFYLANLDLSPQEIFDKVKNGMKPYFRPTLEEFDCPCDELAGVIRKCWAEDPLERPDFPALKSIIRKLNKDGDKGNILDNLLSRMEQYANNLEALVAERTSDYLEEKRKAEDLLYSMLPKVVAGQLIRGESVAAESFESVTIYFSDICGFTALSAASTPMQVIDLLNDLYTTFDSIIEHFDVYKVETIGDAYMVVSGLPVRNGNLHAREVARMSLALLNAVLSFKIRHRPNEQLKLRIGIHTGYVVAGVVGLKMPRYCLFGDTVNTSSRMESNGLPLRIHVSPQTKEVLDNFGTFDLELRGEVEMKGKGKVTTYWLNGE 1038          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A210PTL8 (Guanylate cyclase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT22877 PE=3 SV=1)

HSP 1 Score: 952.199 bits (2460), Expect = 0.000e+0
Identity = 506/1049 (48.24%), Postives = 672/1049 (64.06%), Query Frame = 2
Query:  296 DSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTF-------LNFCRSVGTLFD---------------SENYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEK-----YGSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCP-NRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNV--ETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYL-HSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHL---QKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPY-RPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            DS+C  +  PL   + L +     V+FGP+CDY++APIAR   +W+IP+I+       F      EY  LTR+      +   VL  ++ + +NW+ V L + +          N   +V  +F                 EN+ N+     +LL A T   I        VVLC   +SVR I++KAH+LNF NGEYVF+NIDL +SK  ++KPWY ++DT E N KA++AY +L+TVT ++P S EY++F +EVK R   K     YG  EE N F+G FHD+++LYA+ALN+T+  NL+  NGT IT+ MWNRT  GITG +SID+NGDRNADYS+LDM+   G F++VANY G  + Y P   + I W   +N PPP  P CG++   CP +       I +I + ++L+  L+  F+IY+ +K +AEL  MNW + W+++   + E   +L  + S    N ++                      + + + + D +    S V                        + F  T  YKG ++A+K +H +  + +N+ LLIEVK++K+L N+HI RFIG C+D P   +LTEYC KGSLQD+LENEQI LDWMF++SL+QDI RGM YL +S+I  HGN+KS+NC+VD RFVLKI DFGL  LRG  + + E   YA+YR  LWTAPE+LR    +H    + + K DVYSF IICQE+VYR+GVFYL++++L P++I + V K  L PY RP L E +   + L  +IR+ W ED   RPDF+ +K  +R LNK GD GNILDNLLSRMEQYANNLE LV +RT  YLE+K+K EDLLY MLPKSVA  L+R E   AE+Y  V+IYFSDI GFTA+S+ESTPMQV++LLN LYT FDS+IE+FDVYKVETIGDAYMV SGLP RNG++H REIARMS++ L+A   F+I H+PN++++LRIGIH+GPV AGVVGLKMPRYCLFGDTVNT SRMESNGLPL+IH+S  + +VL TF  F +  RG V MKGKG   TYWL GE
Sbjct:   92 DSECSETIGPLK-AIDLYVDRDVDVFFGPVCDYAVAPIARFSGYWNIPVISAGATVKAFDN--KTEYRLLTRIQGAYAKNAEFVL--EVAKAFNWTNVGLFFHENMGGGRKGKSNCYFTVEPIFYKLKNQLKFQPKYEQFDENFPNEYDFGELLLKASTYTRI--------VVLCASADSVRDIMIKAHELNFDNGEYVFLNIDLFSSKNESEKPWYREDDTAERNEKARKAYEALMTVTLRKPTSPEYKHFSEEVKKRAESKDRNFTYGE-EEVNSFVGAFHDAVILYAIALNETLTRNLSITNGTEITKLMWNRTFDGITGTVSIDDNGDRNADYSLLDMNPKNGKFEVVANYYGNNKEYKPEPDKKIYWAGGRNSPPPDTPTCGFDGSKCPPSEPFPEYGIVIIVLGSLLVIVLVTAFFIYRHIKLEAELAEMNWRVRWEDIMFGSMENDKKLKRQGSSVSLNRKMS---------------------LASSTCSVDTIAVHLSDVGQR---------------------QLFTKTGYYKGAIMAIKSIHKTS-LTVNKPLLIEVKRIKDLQNDHIVRFIGACIDPPNMCILTEYCQKGSLQDVLENEQIKLDWMFRYSLMQDILRGMTYLFNSDIRSHGNMKSTNCVVDGRFVLKITDFGLHALRGPPDDV-EEGMYAFYRTQLWTAPELLR----MHYRPPEGTQKGDVYSFAIICQEIVYRSGVFYLANLDLSPEEIHQKV-KNGLKPYFRPTLEEADCPCDELAEVIRKCWSEDPMERPDFQALKSTIRKLNKDGDKGNILDNLLSRMEQYANNLEALVEERTSDYLEQKKKAEDLLYMMLPKSVACNLMRGEICHAETYNCVTIYFSDICGFTAMSSESTPMQVVQLLNDLYTAFDSVIENFDVYKVETIGDAYMVVSGLPMRNGNLHAREIARMSISLLNATMSFKIRHRPNEQLKLRIGIHTGPVVAGVVGLKMPRYCLFGDTVNTTSRMESNGLPLRIHVSPCTKEVLDTFTTFDLELRGPVEMKGKGTVITYWLKGE 1077          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A1I8HCY1 (Guanylate cyclase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 950.658 bits (2456), Expect = 0.000e+0
Identity = 519/1084 (47.88%), Postives = 690/1084 (63.65%), Query Frame = 2
Query:  296 DSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARL--LPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNW----------------------SRVKLIYEQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNAETLLEI--DMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSV---EESNKFLGVFHDSLLLYALALNDTMAMNLTYE-------NGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREK--RHRLTHKVS------DTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVK----------SRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLH-GSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLEND-EYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINL-EPKQIVEFVTKVQLIPYRPFLSE-----NEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPI 3361
            DS C  S  P+     LL++ K  +  GP C ++LA +AR   +P +  PI+T  G +   R     EY  L RV      D ++ +   +FQ +NW                      +R ++   Q+ +  C  +   F  E Y  +  +   + NA+   EI   M  E  +VVLC +P++VR I++KA +L FINGEYVF NIDL +S+    +PW  +NDT E N KA  AYR+L+T+T ++P S EYRNF ++VK+    KY      EE N F+G FHD+++LYALA+NDT+     YE       NG+ IT KM NRT +GITG +SI+ NGDR+ADYS+LDMDK+T  F +VA+Y G +Q Y  V G+ IDW N+ NLPP   P CG++   C        T +++ +  ++    +    IY++++ ++EL+AMNW IPW  +E  E+    R T +        D  P      +  Q+  +   K  +   +L GN    G   K           + S   +  +S+ S ++  G+    +   + F  TA YKG +VALK L   +K++E+   LL+EVK+VK+L ++++ RFIG CLDAP   L++EYCPKGSLQD+LEN+ +NLDWMFKFSL+ DICRGMIYLH N G HGNLKSSNCLVDSRF LKI DFGL+ LRGTK+Y  + D EY+ YRN LWTAPE+LR  T    + + + DVYSF IICQE++YR GVF++SD +  EP++IVE V ++    YRP L       ++  SE L   +R  WQED + RP F +IK  +   NK  +SGNILDNLL RMEQY+NNLE LV +RT+ YLEEK+K E+LLY MLPKSVA  L+R E+VTAE ++ V+IYFSDI GFTALS+ESTP++V+ LLN LYT FD IIE +D YKVETIGDAYMV SGLP RNG +H REI+RM+L+FL  I+ F+I HKP+ +++LRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIH+S  + ++L     F+ + RG+V MKGKG Q TYWLHGE   IVDP+
Sbjct:   34 DSKCDYSVAPVLGV--LLLQQKIDLMLGPYCSFALAAVARYNRMPHYRRPILTTGGVASALRD--KAEYFNLIRVGPSF--DGVEKMLYLVFQRFNWKPRDVQTILFIELPDEDVKEKRTRDEIGVTQSRI-LCHGIEKHFVQEKYIVRRLQ-YEMHNAQFKSEIFRVMRDEIRLVVLCADPDTVREIMIKAQELGFINGEYVFFNIDLFSSEKLTLQPWRRENDTHERNEKAARAYRALMTITLRKPSSPEYRNFSQQVKSIAKSKYNFTYPEEEVNSFVGAFHDAVILYALAINDTV-----YEHGFEGIANGSLITEKMKNRTFEGITGTVSINANGDRDADYSLLDMDKNTRNFVVVAHYYGNRQKYELVPGKEIDWYNEDNLPPRDIPKCGFDYSMCKQDLSKVATYAVVVLLVLICVLSVVIAVIYRKLRLESELHAMNWRIPWSELEPMERIAAGRRTSESGKDLQQQDEEPEQSQPHRHHQHRGQSHQKRTDSVRILFGNSHNEGSTSKKNRDEKKHQNDQHSGAAAEEMSLVSVDTIAGVPLSQIPVTQLFTKTAYYKGALVALKPLSLRNKRIEVTNKLLMEVKRVKDLTSDNVIRFIGACLDAPNECLVSEYCPKGSLQDVLENDNLNLDWMFKFSLMLDICRGMIYLHHNFGSHGNLKSSNCLVDSRFSLKIADFGLQSLRGTKDYKDKEDAEYSSYRNKLWTAPELLRNPTPPP-EGTKEGDVYSFAIICQEIIYRRGVFFISDYDFPEPQEIVEKVKEISNQMYRPTLDAETNDPDQERSEALINTVRNCWQEDPAARPSFNSIKSRISRFNKDAESGNILDNLLKRMEQYSNNLESLVAKRTDLYLEEKKKAENLLYCMLPKSVATTLLRGESVTAEWFDSVTIYFSDICGFTALSSESTPLEVVTLLNDLYTLFDRIIEQYDCYKVETIGDAYMVVSGLPMRNGILHAREISRMALSFLQNIYSFKIRHKPDVQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISSFTHEILEEIGGFVTTARGEVEMKGKGKQLTYWLHGEGDSIVDPV 1103          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A1I8JDN4 (Guanylate cyclase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 949.503 bits (2453), Expect = 0.000e+0
Identity = 509/1059 (48.06%), Postives = 678/1059 (64.02%), Query Frame = 2
Query:  377 GPICDYSLAPIARLLPFW--DIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNW-----SRVKLIY------------EQTFLNFCRSVGTLFDSE--------------NYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG---SVEESNKFLGVFHDSLLLYALALNDTMAMN--LTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREK-----------RHRLTHKVSDT-LPNSELFTKRFQYSKRG--LAKFDEESDVLIGNPSLA---GDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLH-GSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLEND-EYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINL-EPKQIVEFVTKV--QLIPYRPFLSENEICSEG-----LCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDP 3358
            GP C + LA +AR   ++    PIIT   A+ +      EEY  L RV  +     ++ +   IFQ YNW       + +IY            ++T + F R + T  ++               +  NK F+S V           M  E  +VVLC +P++VR I++KAH+L FINGEYVF NIDL +S+    +PWY K D++E N  A  AYR+L+T+T ++P S EYR+F  +VK    + Y      EE N F+G FHD++LLYALA+NDT+A +      NG+ IT +M +RT +GITG +SI+ NGDRNADYS+LDMDK+T  F +VA+Y G  + Y  V G++IDW +K NLPPP  P CG++   C          ++I +  ++    +    IY++++ ++EL+AMNW I W  +E  E+             RL  + SD+    ++ F    Q  +    L     E      +P++A    DVV S  S            E+  G+    +   + F  TA YKGN+VALKQ++  +K++E+N  +L+E+K+VK+L +++I RFIG CLD+P   L+TEYCPKGSLQDILEN+ +NLDWMFKFSL+ DICRGMIYLH + G HGNLKSSNCLVDSRF LKI DFGL  LRG+KE    +D +Y+ YRN LWTAPE+LR  +    + + + DVYSFGII QE++YR GVFY+SD +  EP+ I+E + +      P+RP LS+  +  +G     L  I+R  W ED + RP+F  +K  +   NK  +SGNILDNLL RMEQY+NNLE LV +RT+QYLEEK+K E+LLY MLPK VA  L++ E+VTAE ++ V+IYFSDI GFTALS+ESTPM+V+ LLN LYT FD IIE +D YKVETIGDAYMV SGLP RNG++H REIARMSL+FL  IF F+I HKP+ +++LRIG+HSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIH+S  +  +L     F+ ++RG+V MKGKG Q TYWLHGE+  IVDP
Sbjct:   37 GPFCTFCLAAVARYNRYYLYQKPIITSGAAANL---EDKEEYYNLIRVGPMNF--DIENMLLAIFQRYNWLPRQQQNLLIIYVPDDETQLHKQRDETRVTFSRLLRTTIENRFSHQHRYILRVKPYSATNKHFQSEVFRC--------MREEVRLVVLCADPDTVREIMIKAHELGFINGEYVFFNIDLFSSERLTSRPWYRKTDSNERNAAASVAYRALMTITLRKPNSTEYRDFSDKVKAAAKQNYSFEYPEEEVNSFVGAFHDAVLLYALAINDTLATHGLAGISNGSLITSRMKSRTFKGITGTVSINANGDRNADYSLLDMDKNTKNFTVVAHYYGNTKRYELVSGKVIDWFSKDNLPPPDVPKCGFDNSRCKKDLSEMAIYAVIVLLVLICVLSVLIGVIYRKLRLESELHAMNWRIAWSELEPTERLAARRRSMASQSSRLRERPSDSGAQRTQTFGNHQQEGEEAQPLNPTPNEQQQQDEDPAIAPKGSDVVSSNDS-----------VETIAGVPLSQIPVAQLFAKTAYYKGNLVALKQIYLRNKRLEVNNKILMEIKRVKDLASDNIVRFIGACLDSPNECLVTEYCPKGSLQDILENDNLNLDWMFKFSLMLDICRGMIYLHHSFGSHGNLKSSNCLVDSRFSLKIADFGLHSLRGSKELKERDDSDYSSYRNKLWTAPELLRNPSTAPAEGTREGDVYSFGIIAQEIIYRKGVFYISDYDFPEPQDIIEKIRQPVGSQPPFRPSLSQELVDLDGERVQALLGIVRSCWHEDPNARPNFNAVKSRISRFNKDAESGNILDNLLKRMEQYSNNLESLVARRTDQYLEEKKKAENLLYCMLPKQVATTLMKGESVTAEWFDSVTIYFSDICGFTALSSESTPMEVVNLLNDLYTLFDRIIEQYDCYKVETIGDAYMVVSGLPGRNGNLHAREIARMSLSFLRNIFSFKIRHKPDAQLKLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISSLTYAILEEIGGFVTTERGEVEMKGKGLQKTYWLHGENDNIVDP 1071          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 389/953 (40.82%), Postives = 553/953 (58.03%), Query Frame = 2
Query:  305 CLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCR----SVGTLFDSENYKNKTFKSVVL-LNAETLLEIDM----GSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLL--TSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG-SVEES--NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGF--YIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSG 3109
            C  S  PL   V L     P  + GP CDY+ +P+AR    W++P++T  GA  +   M    YS++T  N+      L     ++   + W +  ++      N  R    +V   +      N T K +V   + E L   D+         VV +C + ++ R+++++ +K      EYVF  IDL   + ++   KPW   +  DE    AK+A++S+  +T + P++ EY++F+ ++K    +++  S+E+S  N   G FHD +LLY+ ALN++M  +     G  +T+KMWNRT  G+TG + +DENGDR  D+++ DM D ++G+++IV+ Y    +  +   G  + W+  K  PPP  PVCG+   N            +I++ A  +F +I     +IY++VK + EL A  W + W++++       L    S           R   S RG                                    +++ S   L+ +    ++ +  T  YKGN+ A+K ++  K++E+ R +L E+K ++++ NEH+ RFIG C+DAP   +LTEYCP+GSLQD++E E I LDWMF++SL+ DI +GM +LH S I  HGNLKSSNCLVDSRFVLKI D+GL   R  KE  LE D +AYY   LWTAPE++R         + K DVYSFGII QE+    GVFYL      PK+IVE V + +    RP L   +  SE L +++++ W ED + RPDF  IK M+   N+G  S NILDNLLSRMEQYANNLEELV +RT+ Y EEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFTA+SAESTPMQV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H  EIARMSLA L A++ F+I H+P+ ++ LRIGIH+G
Sbjct:  105 CSDSVAPLV-AVDLKFAHDPWAFIGPGCDYASSPVARFTTHWEVPMVT-AGAPALGFNM----YSSIT--NTGPTHKKLGEFVVRMHHNFGWHKYAMVMFHDKKNDDRPCYFAVEGPYTEMTADNITAKDMVFNEDDEPLSYADLINGISQRGRVVYVCCKWDTFRKLMVQFYKQRLPQEEYVFFFIDLFGESLRSRPAKPWARGDADDEA---AKQAFKSVKIMTYREPQNPEYKHFVSKMKRDAKKEFNFSIEDSLMNLIAGGFHDGVLLYSHALNESMDQSGLRPPGHVVTKKMWNRTFHGVTGLVQMDENGDREIDFALWDMTDTESGVYEIVSVYNSSAKQMVLEPGMKVHWL--KGSPPPDIPVCGFKNDNPACLAKTVTMHQMISIVACFIFIIIVTVTVFIYRKVKLENELAAQLWRVYWEDIQISNLDKALRRACS-----------RLTLSLRG------------------------------------SNYGSLLTLEGN----VQIYAKTCYYKGNITAIKYVN-KKRIELTRKVLFELKHMRDVQNEHLNRFIGACIDAPNICILTEYCPRGSLQDLMEIESITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCLVDSRFVLKITDYGLASFR--KESYLE-DTHAYYARKLWTAPELMRDENR-QPCGTQKGDVYSFGIILQELALLKGVFYLDSPPFSPKEIVEHVAEGRWPYLRPLLC-TQSHSEELGQLMQRCWSEDVNERPDFNQIKVMLHKNNRGYGS-NILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTAMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTGEIARMSLALLEAVYSFRIRHRPDLQLRLRIGIHTG 986          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 307/515 (59.61%), Postives = 379/515 (73.59%), Query Frame = 2
Query: 1802 IKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDS 3343
            ++ +  T  YKGN+ A+K ++  K++E+ R +L E+K ++++ NEH+ RFIG C+DAP   +LTEYCP+GSLQD++E E I LDWMF++SL+ DI +GM +LH S I  HGNLKSSNCLVDSRFVLKI D+GL   R  KE  LE D +AYY   LWTAPE++R         + K DVYSFGII QE+    GVFYL      PK+IVE V + +    RP L   +  SE L +++++ W ED + RPDF  IK M+   N+G  S NILDNLLSRMEQYANNLEELV +RT+ Y EEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFTA+SAESTPMQV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H  EIARMSLA L A++ F+I H+P+ ++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  LKIH+SE +  VL+ F  F +  RG + MKGKG   TYWL GE +
Sbjct:  542 VQIYAKTCYYKGNITAIKYVN-KKRIELTRKVLFELKHMRDVQNEHLNRFIGACIDAPNICILTEYCPRGSLQDLMEIESITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCLVDSRFVLKITDYGLASFR--KESYLE-DTHAYYARKLWTAPELMRDENR-QPCGTQKGDVYSFGIILQELALLKGVFYLDSPPFSPKEIVEHVAEGRWPYLRPLLC-TQSHSEELGQLMQRCWSEDVNERPDFNQIKVMLHKNNRGYGS-NILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTAMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTGEIARMSLALLEAVYSFRIRHRPDLQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDIEMKGKGRMRTYWLLGEST 1049          

HSP 2 Score: 152.525 bits (384), Expect = 5.495e-37
Identity = 101/336 (30.06%), Postives = 175/336 (52.08%), Query Frame = 2
Query:  305 CLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCR----SVGTLFDSENYKNKTFKSVVL-LNAETLLEIDM----GSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLL--TSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG-SVEES--NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKI 1267
            C  S  PL   V L     P  + GP CDY+ +P+AR    W++P++T  GA  +   M    YS++T  N+      L     ++   + W +  ++      N  R    +V   +      N T K +V   + E L   D+         VV +C + ++ R+++++ +K      EYVF  IDL   + ++   KPW   +  DE    AK+A++S+  +T + P++ EY++F+ ++K    +++  S+E+S  N   G FHD +LLY+ ALN++M  +     G  +T+KMWNRT  G+TG + +DENGDR  D+++ DM D ++G++++
Sbjct:   82 CSDSVAPLV-AVDLKFAHDPWAFIGPGCDYASSPVARFTTHWEVPMVT-AGAPALGFNM----YSSIT--NTGPTHKKLGEFVVRMHHNFGWHKYAMVMFHDKKNDDRPCYFAVEGPYTEMTADNITAKDMVFNEDDEPLSYADLINGISQRGRVVYVCCKWDTFRKLMVQFYKQRLPQEEYVFFFIDLFGESLRSRPAKPWARGDADDEA---AKQAFKSVKIMTYREPQNPEYKHFVSKMKRDAKKEFNFSIEDSLMNLIAGGFHDGVLLYSHALNESMDQSGLRPPGHVVTKKMWNRTFHGVTGLVQMDENGDREIDFALWDMTDTESGVYEV 406          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 301/512 (58.79%), Postives = 383/512 (74.80%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            + F  TA +KGN+VA+K ++  K++E+ R +L E+K ++++ N+H+ RFIG C+D P   ++TEYCP+GSLQDILENE I LDWMFK+SL+ DI +GM +LH S I  HGNLKSSNC+VD+RFVLKI D+GL   R   +     D ++YY   LW AP++LR +       + K D+YSFGII QEV  R GVFY+   +L PK+IV+ V   +    RP ++  +  SE L +++++ W E+ + RP+F  IK ++R  N+   S +ILDNLLSRMEQYANNLEELV +RT+ YLEEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFT+LSAESTPMQV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H REIARMSLA L A+  F+I H+P+++++LRIGIHSGPVCAGVVGLKMPRYCLFGDTVNT+SRMESNG PLKIH+S  S D+L+ F  F +  RG V MKGKG   TYWL GE
Sbjct:  563 QVFAKTAYFKGNIVAIKYVN-RKRIELTRKVLFELKHMRDVQNDHLTRFIGACIDPPNVSIVTEYCPRGSLQDILENESITLDWMFKYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFRTESD---PEDAHSYYARKLWMAPDLLRMSNPPAC-GTQKGDIYSFGIILQEVALRRGVFYIEGDSLSPKEIVDRVALGEWPYLRPTVN-TQAHSEELGQLMQRCWAEEPAERPEFSHIKVLLRKQNREV-SRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWLLGE 1067          

HSP 2 Score: 182.956 bits (463), Expect = 1.650e-46
Identity = 127/445 (28.54%), Postives = 215/445 (48.31%), Query Frame = 2
Query:  290 DADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSENYKN-----KTFKSVVLLNAETLLEID------------MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQ--KPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG-SVEES--NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKN--CPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVE 1549
            + D  C  S  PL   V L    +P  + GP CDY+ +P+      W +P+IT  GA  +    + + Y+++T  N+      L      I + + WS      +   L F  S   + + E Y          K V +   + + E D            +  E  VV +C  P+  R++++   K N    E+VFI ID+      +Q  +PW   +  DE+   AK+AY+S+  +T + P++ EY++F+ ++K    + +  +V++S  N   G F+D L+LY  ALN+++A +    +   IT +MWNRT  G+TG + ID++GDR  D+++ DM D ++ +F+IVA Y G ++    + G    W       PP  P CG+   N  C  R I    +  I +  IL+       +IY+++K + EL A  W I W++++
Sbjct:  101 NTDGICSESIAPLM-AVDLKFAHEPWAFIGPGCDYTSSPVGLFTTHWGLPMIT-AGAPAVGFSDRSDAYTSIT--NTGPTHKKLGEFALHICRHFGWS------QHALLMFGDS--KMGERECYFAVEGLYTELKEVNITTVDLVFEEDSRPVNYSEHLQKIKEEGRVVFVCCSPDIFRQLMVHFRKANLPQEEFVFIYIDVFGRTLTSQPVQPWARGDADDEL---AKKAYQSVKILTYREPQNPEYKDFVMDLKAGAKKMFNFTVDDSLMNIISGGFYDGLMLYVQALNESLAESHGRPSSKSITERMWNRTYYGVTGLVQIDKHGDRETDFALWDMTDTNSSVFQIVAVYNGTQKQMRTLPGMAFHW--PGGFIPPDMPFCGFKNDNPACIARTITMHQMVSIVVFFILVIIFTITVFIYRKLKLEKELAAQLWRISWEDMQ 528          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 301/512 (58.79%), Postives = 383/512 (74.80%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            + F  TA +KGN+VA+K ++  K++E+ R +L E+K ++++ N+H+ RFIG C+D P   ++TEYCP+GSLQDILENE I LDWMFK+SL+ DI +GM +LH S I  HGNLKSSNC+VD+RFVLKI D+GL   R   +     D ++YY   LW AP++LR +       + K D+YSFGII QEV  R GVFY+   +L PK+IV+ V   +    RP ++  +  SE L +++++ W E+ + RP+F  IK ++R  N+   S +ILDNLLSRMEQYANNLEELV +RT+ YLEEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFT+LSAESTPMQV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H REIARMSLA L A+  F+I H+P+++++LRIGIHSGPVCAGVVGLKMPRYCLFGDTVNT+SRMESNG PLKIH+S  S D+L+ F  F +  RG V MKGKG   TYWL GE
Sbjct:  563 QVFAKTAYFKGNIVAIKYVN-RKRIELTRKVLFELKHMRDVQNDHLTRFIGACIDPPNVSIVTEYCPRGSLQDILENESITLDWMFKYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFRTESD---PEDAHSYYARKLWMAPDLLRMSNPPAC-GTQKGDIYSFGIILQEVALRRGVFYIEGDSLSPKEIVDRVALGEWPYLRPTVN-TQAHSEELGQLMQRCWAEEPAERPEFSHIKVLLRKQNREV-SRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWLLGE 1067          

HSP 2 Score: 182.956 bits (463), Expect = 1.650e-46
Identity = 127/445 (28.54%), Postives = 215/445 (48.31%), Query Frame = 2
Query:  290 DADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSENYKN-----KTFKSVVLLNAETLLEID------------MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQ--KPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG-SVEES--NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKN--CPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVE 1549
            + D  C  S  PL   V L    +P  + GP CDY+ +P+      W +P+IT  GA  +    + + Y+++T  N+      L      I + + WS      +   L F  S   + + E Y          K V +   + + E D            +  E  VV +C  P+  R++++   K N    E+VFI ID+      +Q  +PW   +  DE+   AK+AY+S+  +T + P++ EY++F+ ++K    + +  +V++S  N   G F+D L+LY  ALN+++A +    +   IT +MWNRT  G+TG + ID++GDR  D+++ DM D ++ +F+IVA Y G ++    + G    W       PP  P CG+   N  C  R I    +  I +  IL+       +IY+++K + EL A  W I W++++
Sbjct:  101 NTDGICSESIAPLM-AVDLKFAHEPWAFIGPGCDYTSSPVGLFTTHWGLPMIT-AGAPAVGFSDRSDAYTSIT--NTGPTHKKLGEFALHICRHFGWS------QHALLMFGDS--KMGERECYFAVEGLYTELKEVNITTVDLVFEEDSRPVNYSEHLQKIKEEGRVVFVCCSPDIFRQLMVHFRKANLPQEEFVFIYIDVFGRTLTSQPVQPWARGDADDEL---AKKAYQSVKILTYREPQNPEYKDFVMDLKAGAKKMFNFTVDDSLMNIISGGFYDGLMLYVQALNESLAESHGRPSSKSITERMWNRTYYGVTGLVQIDKHGDRETDFALWDMTDTNSSVFQIVAVYNGTQKQMRTLPGMAFHW--PGGFIPPDMPFCGFKNDNPACIARTITMHQMVSIVVFFILVIIFTITVFIYRKLKLEKELAAQLWRISWEDMQ 528          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr2 (natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZDB-GENE-141030-2])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 376/1023 (36.75%), Postives = 537/1023 (52.49%), Query Frame = 2
Query:  359 KPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIY---------------EQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQ--KPWYSKNDTDEVNFKAK-EAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG-SVEES--NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIG-KKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNV--ETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIV 3352
            +P  + GP C YS+A + R    W +P+IT  G +  F     EE+ TL R      T  L      +   +NW+R  L+                E  ++N      T+       N +++ +V    E+           +V +C   ++   I+    +      +Y    +D      +N+  +PW+    T  + +K   + ++++  +T + P++ EY  F  E+  R  + +   +E S  +   G F+D  +LYA ALN+ +A  ++  +G  IT +M NR+I G+TG +S D+N  R  D+S+  M   T    +  +Y G  K++    +G  I W     +  P   V      +C  R            + +LLF     +   +++K + EL  M W I W+++  E+  K H+                 R   S+RG               S  G ++ +                             + F  T  +KGN+VA+K ++  K++E+ R +L E+K ++++   H+ RF+G C+D P   ++TEYCP+GSLQ         ++     +LL     GM YLH S IG HGNLKSSNC+VDSRFVLKI D+GL   R + +     D +  Y   LWTAPE+L        Q + K D+YSFGII QE+  RNG FY+  ++L PK+I++ V   Q   +RP    +  C E L  ++   W ED + RPDF  IK  +  LNK G S +IL+NLLSRMEQYANNLE LV +RT+ YLEEKR+ E+LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFT+         V+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H REIA MSLA L  +  F+I H+PN ++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMES G  L+IHMS  + +VL  F  F +  RG V MK K      WL  ++ +I+
Sbjct:  106 RPDAFLGPGCVYSVASVGRFASHWKLPLITAGGLAYGFDN--SEEFRTLVRTGP--TTTKLGDFVNSLHAEFNWTRRALLIFHDLKRDDRPHFFLSEGIYINLLAENMTVEVLPYEDNTSYQEIVTFIRES---------GRIVYICGPLQTFFNIMSTFEEEVKNTEDYAIFYLDAFGESLSNEAHQPWH----TSAMQWKDPIKLFQNVFVITFREPDNPEYAAFRTELHKRATQDFNVQLEPSLMDYIAGCFYDGFVLYATALNEALADGVSQNDGINITTRMLNRSIWGVTGLVSTDQNNARYTDFSLWSMSNLTTGQYVAGHYNGTNKEIVWSKKG--IQWAKGIPIDDPRCLV------SCEGR------------SWVLLFFKGLSYIGNRKLKLEKELARMLWRIKWEDLQFESPNKYHKRA-------------GSRLTLSQRG---------------SSYGSLISAHGKH-------------------------QLFAKTGYFKGNLVAIKHVN-KKRIELTRQVLFELKHMRDVQFNHLTRFVGACIDPPNICIVTEYCPRGSLQ---------VNTYASCTLL-----GMNYLHNSYIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSYD---NEDSHELYARKLWTAPELLIYDRPPP-QGTQKGDIYSFGIILQEIALRNGPFYVEAMDLSPKEIIQKVRNGQRPYFRPTTDNSRHCEE-LTILMEGCWAEDPTERPDFSHIKIFITKLNKEG-STSILNNLLSRMEQYANNLENLVEERTQAYLEEKRRAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTS--------NVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIAGMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALRIHMSSATKEVLDEFGYFDLQLRGDVEMKVK------WLFLKEELIL 1003          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006352.1 (pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 gene:ENSPMAG00000005587.1 transcript:ENSPMAT00000006352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 404/882 (45.80%), Postives = 556/882 (63.04%), Query Frame = 2
Query:  737 AVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLT---SKTN---NQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG-SVEES--NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETR--EKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSL-QDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICS-EGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            +VV  C      R+ +++AH      G+YVF  +D  +   S++N   ++KPW   ++ DE   +AKEAY++++ ++ + P++ EY++F+ ++K R  E++  ++E++  N   G F+D++++Y  ALN T++      +G  IT+ MWNRT +G+TGE +ID NGDR  D+S+ D+ D +TG F +V +Y G     I V G  I W       P   P+CG+  + C +       + +I  + ILL   ++ F IY+++K + EL +M W + W+N++    EK  R                 +   S RG               S  G ++ +                     Q  N    KT      Y+GN+VA+K ++  KK+E+ R +L E+K ++++ NEH+ RF+G C+D P   ++TEYCP+GSL QDILENE I LDW+F++SL+ DI +GM++LH S IG HG+LKSSNC+VDSRFVLKI D+GL   R   E     D ++ Y   LWTAPE+LR       Q + K DVYS GII QE+  RNG FY+  ++L PK+IV+ V   Q   +RP  S +E C  E L  ++++ W ED + RPDF  IK ++   NK  +S NILDNLLSRMEQYANNLEELV +RT+ YLEEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFT+LSAESTPMQV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG ++ +EIARMSLA L A+  F+I H+   +++LRIGIH+GPVCAGVVGLKMPR+CLFGDTVNTASRMESNG  LKIH+S+ + +VL  F  F +  RG V MKGKG   TYWL GE
Sbjct:    5 SVVYFCCSAAVFRQTMVQAHAEGMTAGDYVFFYVDPFSESLSESNVSESRKPWKRGDEFDE---QAKEAYKAVMIISYREPQNIEYKDFVVKLKKRAKEQFNFTIEDTLMNLIAGSFYDAIMMYTAALNKTLSSGGGVHDGHAITKHMWNRTYRGVTGEFTIDRNGDRETDFSLWDLTDMNTGEFNVVLSYDGASSKLIEVPGLEIQWPGGS--IPKDVPLCGFENEACISGGFSTMEVLMIVFSLILLIVAVSSFLIYRKLKLEKELASMLWRLRWENIQVSSLEKARRSA-------------GSKLTLSMRG---------------SSCGSLLTT---------------------QGRNQMFAKT----GYYRGNLVAIKPIN-KKKIELTREVLFELKHMRDVLNEHLTRFVGACIDPPNICIVTEYCPRGSLQQDILENESITLDWVFRYSLINDIVKGMLFLHNSVIGSHGSLKSSNCVVDSRFVLKITDYGLASFRSCSEC---EDMHSLYAKKLWTAPELLR-LEHPPPQGTQKGDVYSLGIILQEIALRNGTFYVEGMDLSPKEIVQKVKNGQRPYFRP--STDESCHIEELGLLMQRCWAEDPAERPDFSQIKMLIHKFNK-ENSTNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAETLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLNAKEIARMSLALLDAVKTFKIRHRQEDKLKLRIGIHTGPVCAGVVGLKMPRFCLFGDTVNTASRMESNGEALKIHVSQTTKEVLDEFGCFRLELRGDVEMKGKGKMRTYWLLGE 820          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 283/511 (55.38%), Postives = 368/511 (72.02%), Query Frame = 2
Query: 1832 KGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSN-IGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPY-RPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGD------SGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGED 3340
            +GN+V +  ++  KK+E+ R +L E+K ++++ NEH+ RF+G C+D P   ++TEYCP+GSLQDILENE I+LDWMF++SL+ DI +GM+YLHS+ IG HGNLKSSNC+VDSRFVLKI D+GL  +R   +    +    Y+   LWTAPE+LR   E+  + + K DVYSF II QE+  R+G FYL   +L  K+IV+ V K+   PY RP +      SE L  ++++ W E+ + RPDF  IK +++  +   D      +  ILDNLLSRMEQYANNLEELV +RT+ YLEEK K E LLY +LP SVA QL R ETV AE+++ V+IY SDIVGFTA+SA+STPMQV+  LN LYT FD+II++FDVYKVETIGDAYMV SGLP  NG  H  E+ARM+LA LSA+  F I H+P +R+ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRME+ G   +IH+S  +  +L  +  F++   G V++KGKG   TYWL GE+
Sbjct:    1 QGNLVEIPFIN-RKKIELTRQMLFELKHMRDVQNEHLTRFVGACIDVPNICIITEYCPRGSLQDILENESISLDWMFRYSLMHDIVKGMLYLHSSVIGSHGNLKSSNCVVDSRFVLKITDYGLSSVRAHSK---ADSSANYFEKRLWTAPELLR-LEEVAPRGTQKGDVYSFAIILQEIALRSGPFYLEANHLTAKEIVQRV-KLGEWPYLRPTVDPGG-HSEELGHLMQRCWAEESTERPDFHQIKILLQKFSSQDDGPESPPAFTILDNLLSRMEQYANNLEELVEERTQAYLEEKGKAEALLYQILPHSVAEQLKRGETVPAEAFDSVTIYLSDIVGFTAMSAQSTPMQVVAFLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVHNGTRHAIEVARMALALLSAVRCFHIRHRPAQRLLLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMEAKGEAHRIHLSSTTKAILDEYGGFVVQLHGDVDIKGKGTMRTYWLLGEN 504          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008976.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 466.077 bits (1198), Expect = 4.076e-150
Identity = 252/512 (49.22%), Postives = 342/512 (66.80%), Query Frame = 2
Query: 1814 ITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLR-GTKEYLLE-NDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTK-VQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            I   +Y+GN VALK L  +   ++  N      K++ + +E++  F GVC++ P   ++T+YC KGSL+D+L+     LDWMFK S   DI  GMI+LH S I  HGNLK S CL+DSR  +K+  FG+ + R G K   L+ N+  +++  L WTAPE+LR   ++ +  + K DV+SF I+ +EV+Y         I+LEPK I++ V   + + P RP L+E   C   +  +IRQ W E    RPDF ++  M+R  +  GD  NILDN++S++E+YAN+LEE+V+ RT Q   EK+KT+ LL S+LP  V  QL   +TV  E YE+V+I+F DIVGFTA+SA STP++VI LLN LY   D II+ +DVYKVETIGDAYMV SGLP RNG  H+ EIA MSL FLS+I  F+I H P ++++LRIGI+SGPV AGVVG  MPRYCLFGDTVN ASRMES G PL IH+SE + ++L+    + + +RG +N+KGKG Q TYWL G+
Sbjct:  212 IPIGIYQGNQVALKFLERTHPPDLKSNRF--ALKMREMLHENLVIFFGVCVELPNVCIVTQYCRKGSLKDVLKTSDFELDWMFKTSFAHDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRYGKKGKTLDINNLGSFFIELYWTAPELLR-MEDLPVNGTPKGDVFSFAILMREVIYHEDEGPYVGIHLEPKDIIDQVRDGIAVPPLRPLLTER--CEPRIQALIRQCWDESADRRPDFSSVSRMLRLASPEGDM-NILDNMVSKLEKYANHLEEVVDDRTAQLESEKKKTDRLLSSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEVINLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIATMSLHFLSSIMNFRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKGK 717          

HSP 2 Score: 63.5438 bits (153), Expect = 2.204e-10
Identity = 45/175 (25.71%), Postives = 82/175 (46.86%), Query Frame = 2
Query: 1058 FHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRT---IQGITGEMSIDENGDRNADYSVLDMDKD---TGIFKIVAN-YIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALIN--GFYIYKRVK---FQAELNAMNWLIPWDNV 1546
             HD+ +LYA+A+ + +       +G  + R +         G +G++SID NG+R  DY+V D+ K    TG  +I +  Y   + +    E Q + W + +  PP   P CG+  + C    I    ++L+ + +IL   +I    F  Y  V+    Q  ++   W I ++++
Sbjct:    4 LHDAGILYAMAVRELLRQGGNPRDGRAVIRTIRGSNKIKFYGASGQVSIDVNGERFLDYAVFDLQKKQTATGEMRIASKRYFTFQTINFTPEYQKMGWPDGR--PPSDMPECGFTGELCQEAPISEPDLALVLVGSILSLIVIGTVAFLTYLVVQSRSLQESMDTTWWKINFEDI 176          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008986.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008986.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 438.343 bits (1126), Expect = 1.014e-140
Identity = 241/501 (48.10%), Postives = 328/501 (65.47%), Query Frame = 2
Query: 1859 LHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLR-GTKEYLL----ENDEYAYY-RNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTK-VQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            +HG+ +VEI     I + +++ + +E++  F GVC++ P   ++T+YC KGSL+D+L+     LDWMFK S   DI  GMI+LH S I  HGNLK S CL+DSR  +K+  FG+ + R G K   L    + D +A   + L WTAPE+LR   ++ +  + K DV+SF I+ +E   R          +    I++ V   + + P RP L+E   C   +  +IRQ W E    RPDF ++  M+R  +  G   NILDN++S++E+YAN+LEE+V+ RT Q   EK+KT+ LL S+LP  V  QL   +TV  E YE+V+I+F DIVGFTA+SA STP++VI LLN LY   D II+ +DVYKVETIGDAYMV SGLP RNG  H+ EIA MSL FLS+I  F+I H P ++++LRIGI+SGPV AGVVG  MPRYCLFGDTVN ASRMES G PL IH+SE + ++L+    + + +RG +N+KGKG Q TYWL G+
Sbjct:  135 VHGTDRVEIP----IGIYQMREMLHENLVIFFGVCVELPNVCIVTQYCRKGSLKDVLKTSDFELDWMFKTSFAHDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRYGKKGKTLDINKQEDAWALSSKELYWTAPELLR-MEDLPVNGTPKGDVFSFAILMRESTPREWPTATRANRVPFPDIIDQVRDGIAVPPLRPLLTER--CEPRIQALIRQCWDESADRRPDFSSVSRMLRLASPEGLHMNILDNMVSKLEKYANHLEEVVDDRTAQLESEKKKTDRLLSSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEVINLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIATMSLHFLSSIMNFRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKGK 628          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008942.1 (pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 gene:ENSPMAG00000008084.1 transcript:ENSPMAT00000008942.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 441.425 bits (1134), Expect = 9.789e-137
Identity = 237/514 (46.11%), Postives = 340/514 (66.15%), Query Frame = 2
Query: 1805 KTFITTALYKGNVVALKQLHGSKKVEI-NRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIP-YRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            K F    +Y+GN VALK L  ++  ++ ++ LL E++ ++ L +E++  F GVC++ P   ++T+YC KGSL+D+L+     LD MFK S   DI  GMI+LH S I  HGNLK S CL+DSR  +K+  FG+ + R  K+  + +        L WT+PE+LR      +  + K DV+SFG++ +E++Y         +++EPK+I++ V + +  P  RP L+E   C   +  +I++ W E    RPDF +I  M+R  +  G   +ILDN++S++E+YAN+LEE+V  RT Q   EK+KT+ LL S+LP  V  QL   +TV  E +E V+I+F DIVGFTA+SA S+P++VI LLN LY   D II+ +DVYKVETIGDAYMV SGLP RNG  H+ EI+ MSL FLS+I  F+I H P +++++RIG++SG V AGVVG  MPRYCLFGDTVN ASRMES G PL+IH+SE +  +L++   + + +RG + +KGKG Q TYWL+G+
Sbjct:  543 KMFTPLGIYQGNQVALKFLQRTRPPDLKSKTLLKELQMLRELRHENLVVFFGVCVEMPNICIVTQYCRKGSLKDVLKTSDFELDLMFKTSFAYDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRHGKKGKIMDVNNQDIAELFWTSPELLRMEI-FPVNGTPKGDVFSFGVLMREMIYHEDEGPYVGVDMEPKEIIDQVREGKCSPPLRPLLTER--CEPRIQALIQRCWDESPDRRPDFHSIARMLRSASPEGHR-SILDNMVSKLEKYANHLEEVVEDRTAQLESEKKKTDRLLSSLLPSVVVEQLKAGKTVQPEHFEQVTIFFCDIVGFTAMSAISSPLEVITLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEISIMSLHFLSSIINFRIRHLPKEQLKIRIGVNSGSVVAGVVGNTMPRYCLFGDTVNVASRMESTGYPLRIHVSESTASLLKSIGGYELVERGAIQLKGKGSQLTYWLNGK 1052          

HSP 2 Score: 83.1889 bits (204), Expect = 2.333e-16
Identity = 72/361 (19.94%), Postives = 156/361 (43.21%), Query Frame = 2
Query:  374 FGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDS---ENYKNKTFKSVV-------LLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRT-----NEKYGSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRT---IQGITGEMSIDENGDRNADYSVLDMDK---DTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNC 1393
             GP+C  +      L   W++P++   G +   R      Y T  R+ S +    +  +     + + W+R  ++      +   ++  L+ S   E  ++ T  + +       +L+ + LL  D+ ++  +V+L    E  R +LL+A  L    G+++F+ +         +  ++     + ++ +  +A   ++  T +   S +Y  F++EV+ R           S +E + +    HD+ +LYA+A+ + +       +G  I R +   T     G++G+++ID NG+R  DY+V ++ K    +    ++     +  +    E Q + W   +  PP   P+CG+  + C
Sbjct:   90 LGPVCAEASEVTGLLAAQWNVPMLGFVGHTQ--RMDSSAVYDTYVRIMSPL--QRMGQMLEATMRHFGWTRAAMLGGTAQNSTWANIDELWASVERELARSVTITARIKYDTSDKVLHRQNLL--DISTKARIVILICGSEEAREVLLEAQSLGLATGKFIFLVVQQF------EDSFWKSVAAERLDTQTLQALEPVMLFTIKAYGSSDYELFLQEVRRRLLGPPFYSNLSSDKEVSPYAAYLHDAAILYAMAVRELLRHGGNPRDGRAIVRTIKGSTKVKFYGVSGQVNIDVNGERFLDYAVFNLQKKGNSSQFLPVMVFDTFQGSISFTPEYQKMVW--PEGGPPNDMPICGFLGELC 436          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 73.1738 bits (178), Expect = 1.821e-13
Identity = 51/194 (26.29%), Postives = 96/194 (49.48%), Query Frame = 2
Query: 1829 YKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFY-LSDINL 2407
            +   VVA+K++      E+N +++ E+  +KNLN+ +I ++ G    + + ++L EYC  GSL+ ++      L      + +     G+ YLH     H ++K++N L+ +   +K+ DFG+  +  +    L          L W APEIL          ST +D++S G    E++ +N  ++ L+D N+
Sbjct:   46 HTDQVVAIKEVVYENDEELN-DIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAG-------TLNWMAPEILGNR-----GASTLSDIWSLGATVVEMLTKNPPYHNLTDANI 226          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 72.7886 bits (177), Expect = 2.050e-13
Identity = 53/192 (27.60%), Postives = 92/192 (47.92%), Query Frame = 2
Query: 1835 GNVVALKQLHGS--KKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDIN 2404
            G + A K +  +  K  +  + LL E++  K++++ +I +FI    D    ++L E CP GSL ++L+  ++  +   +F   Q IC  + Y+HS    H +LK  N   DS + LKI DFGL  +   +       +Y       + APE+L      H   S + D++S G++   ++     F   D+N
Sbjct:  104 GEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQ-ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANE----SERKYTICGTPNYIAPEVLMGK---HSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN 287          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: KIN1 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN1 has a paralog, KIN2, that arose from the whole genome duplication [Source:SGD;Acc:S000002529])

HSP 1 Score: 66.2402 bits (160), Expect = 2.684e-11
Identity = 45/162 (27.78%), Postives = 81/162 (50.00%), Query Frame = 2
Query: 1871 KKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQD-ILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGII 2353
            K++  ++  + E    + L + HICR   +C  +   ++L EY   G L D I+++  I      KF+  + I   +IYLH+N   H +LK  N ++     +KI DFGL  +  +++ L     + +  +L + APE+L+           + DV+SFG++
Sbjct:  183 KEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYIIQHGSIREHQARKFA--RGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYDSRKQL-----HTFCGSLYFAAPELLKANPYT----GPEVDVWSFGVV 333          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 65.4698 bits (158), Expect = 3.936e-11
Identity = 53/189 (28.04%), Postives = 98/189 (51.85%), Query Frame = 2
Query: 1835 GNVVALKQLHGSKKVEINRNLLI-EVKKVKNLNNEHICRFIGVCLDAPQH-WLLTEYCPKGSLQDILENEQINLDWMFKFS------LLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGL-EKL--RGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVV 2368
            G+ VA+KQ+  SK+    + L++ E+  +K+  +++I  F+   L      W++ E+   GSL DI+EN   N +     +      ++++ C+G+ +LH     H ++KS N L+D+R  +KI DFG   +L  + +K   +    Y       W APE++++      +   K DV+S GI+  E++
Sbjct:  588 GDKVAIKQMVLSKQPR--KELIVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATMVGTPY-------WMAPEVVKQR-----EYDEKIDVWSLGIMTIEML 762          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 63.929 bits (154), Expect = 1.175e-10
Identity = 43/158 (27.22%), Postives = 80/158 (50.63%), Query Frame = 2
Query: 1904 EVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICR----GMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEV 2365
            E+  +K L++E+I  + G   +     +  EY P GS+  +L N        F+ SL+ +  R    G+ YLH     H ++K +N L+D +  +KI DFG+ K + +     +N   +   ++ W +PE++++T       + KAD++S G +  E+
Sbjct:  504 EMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNY-----GPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISK-KLSPLNKKQNKRASLQGSVFWMSPEVVKQTA-----TTAKADIWSTGCVVIEM 650          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO34275 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SPS9])

HSP 1 Score: 525.013 bits (1351), Expect = 2.720e-175
Identity = 275/521 (52.78%), Postives = 360/521 (69.10%), Query Frame = 2
Query: 1790 NLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSN-IGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEI---CSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGED 3340
            N++  + F T  +YK N+VA+K+++  +++E+ R +  E+K ++ + +E++  F G C++ P   +L +YCPKGSLQDILENE I LD MF  SLL DI +GM YLHS  I  HG LKS NC+VD R+VLKI D+GL K +  ++   E  EYA Y   LWTAPE+LR   +   + + K DVYSFGII QE++ R+G F LS    EP  I+E VT+V+  P+RP LS   +      G+  + +  W+E+   RPDF  I+  +R L  G  S NI+DN+++ +E+YANNLE LV +RT Q  +EKRKTE+LL  MLP SVA  L+  + VTAE+++ VSI+FSDIVGFT+LS+ESTP+QV++LLN LYT FD II ++DVYKVETIGDAYMV SGLP RNG  H  EIA M+L  L  I  F+I H+PN +++LRIGIHSG   AGVVG KMPRYCLFGDTVNTASRMESNG  LKIH+S  +  +L     + I KRG+V +KGKG   TYWL G D
Sbjct:    1 NINQRQIFTTVGIYKSNMVAIKRIN-KRQIELTREIKYEMKLMRTVRHENLVTFTGACVEPPNICILLQYCPKGSLQDILENEDIKLDSMFVNSLLTDIVKGMAYLHSTEIRSHGRLKSPNCVVDGRWVLKITDYGLNKFKSNQDISEEEGEYAMYYRKLWTAPELLR-AADPRPRGTQKGDVYSFGIIVQELLTRSGPFDLSYYTNEPSDIIEKVTRVESPPFRPKLSTIVLEGPTVAGIVDLAKWCWEENPDHRPDFEEIRKTVRKLPMGKQS-NIMDNMVNLLEKYANNLESLVEERTSQLADEKRKTENLLNRMLPPSVAKDLVHGKQVTAENFDEVSIFFSDIVGFTSLSSESTPLQVVDLLNDLYTLFDEIINNYDVYKVETIGDAYMVVSGLPIRNGHQHAGEIATMALHMLREIDSFKIRHRPNDKLKLRIGIHSGSCVAGVVGKKMPRYCLFGDTVNTASRMESNGEALKIHISPSTKRILDELGGYHIQKRGKVFLKGKGTWITYWLVGSD 518          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO30985 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SZ80])

HSP 1 Score: 504.212 bits (1297), Expect = 9.116e-167
Identity = 261/490 (53.27%), Postives = 350/490 (71.43%), Query Frame = 2
Query: 1871 KKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRG-TKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYL-NKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAI-FEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWL 3328
            + ++I+R LL+E+K+++++ ++++ +FIG C+  P   ++ +YC +GSLQDILEN+ + LD +F  SLL DI +GM YLH S+I  HGNLKSSNCLVDSR+VLKI D+GL  LR  +K+  +E +    +R+LLW APEILR  +    + + K DVYSF II QE   R+G +  S   +EPK I+E V K +  PYRP ++     +E L  +++Q W ED  LRPDF  IK  +R + +K G   NI DN+++ ME YA+NLE LV QRT+Q ++EKRKT+ LL S+LP+ VA QL + + V AES+  V+IYFSDIVGFT+LSAESTPMQV+  LN LYT FD II+ +DVYKVETIGDAYMV SGLP RNG  H  EIA+M+L  + A+   F + HKP  +++LR+G H+GPV AGVVG  M RYCLFGDTVNTASRMESNG PL+IH+S+Q+ DVL     F++  RG+V++KGKG   T+WL
Sbjct:   11 RTIDISRQLLLEMKQMRDIRHDNLNQFIGACVGPPNVCIVMQYCSRGSLQDILENDDVKLDLVFIASLLSDIVKGMEYLHNSDIRSHGNLKSSNCLVDSRWVLKITDYGLPLLRSRSKKSTIETN----WRDLLWVAPEILRIPSRPP-KGTHKGDVYSFSIILQEFHTRDGPY--SANYMEPKAIIEKVRKSEFPPYRPIVANLIDGAEELRDLMKQCWAEDPDLRPDFTEIKKTVRRIVDKSGMKKNIFDNMVNMMEIYADNLENLVAQRTDQLVDEKRKTDALLESILPRPVAEQLKKGKAVEAESFNEVTIYFSDIVGFTSLSAESTPMQVVTFLNDLYTIFDDIIQEYDVYKVETIGDAYMVASGLPIRNGRRHAGEIAKMALHLVDAVSHNFIVRHKPEYKLQLRVGCHTGPVVAGVVGNTMARYCLFGDTVNTASRMESNGEPLRIHISQQTKDVLDELGTFVVKSRGKVHLKGKGTVETFWL 493          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO27923 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7T7X3])

HSP 1 Score: 418.313 bits (1074), Expect = 1.284e-135
Identity = 210/430 (48.84%), Postives = 290/430 (67.44%), Query Frame = 2
Query: 2024 ILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEI--HLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSE--NEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMK 3298
            +L N+ I LDWMF+ S   DI  GM  +H S I  HGNLKSSNCL+DSR+  KI D+GL+ LR   +   +  E+A YRNL WT PE+L        H  K+   DVYS+GI+  E++ R+  +  +   L  K ++E V K Q   +RP  S+   E     + ++ +  W  D   RP F  IK  ++  N  G + NI+DN+++ M +Y + LE++V +RT+Q  EEK KT++LLY MLP+ +A +L +   V+AES++ V+I+FSDIVGFT+++A+STP+QV++LLN+LYT FD +++  DVYKVETIGDAYMV SGLP RNG+ H  E+A M+L  LS + +FQIPH P+++V+LRIGIHSG   AGVVGLKMPRYCLFGDTVN ASRMES+GL L+IH+S +  +VL     + + +RG V MK
Sbjct:    2 LLGNDSIKLDWMFRQSFANDIATGMEAIHNSPIQAHGNLKSSNCLIDSRWACKITDYGLDLLRAN-QTPKDIGEFAVYRNLFWTVPELLPLADGFKDHKNKTQAGDVYSYGIVLYEIITRDEPYSTNTDTLSSKDVIELVRKRQEPAFRPQFSKFMEEKSGHKMVQVTQDCWDNDAQKRPTFSAIKKKLK-ANGMGKNLNIVDNMITMMAKYTDQLEDIVEERTKQLAEEKAKTDELLYKMLPRPIADELKKGNPVSAESFQSVTIFFSDIVGFTSVAAQSTPLQVVDLLNQLYTRFDKVVDEHDVYKVETIGDAYMVVSGLPVRNGERHAGEVASMALNLLSEVRDFQIPHIPSRKVQLRIGIHSGSCVAGVVGLKMPRYCLFGDTVNYASRMESSGLALRIHVSPECKEVLDRLGGYHLDERGPVTMK 429          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36182 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA4])

HSP 1 Score: 419.083 bits (1076), Expect = 4.618e-135
Identity = 222/492 (45.12%), Postives = 317/492 (64.43%), Query Frame = 2
Query: 1907 VKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEI--HLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSE--NEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIPE 3367
            +K V++L++ ++ R++GVC+++P   +++ +C +G+LQD+L N+ I LDWMF+ S   DI  GM  +H S I  HGNLKSSNCL+DSR+  KI D+GL+ LR   +   +  E+A Y+NL WTAPE+L           K+   DVYS+GI+  E++ R+  +  +   L  K ++E V K Q   +RP  S+   E     + ++ +  W  D   RP F  IK   + L   G     +  + SR   Y NN  +LV  R    +  KR    LL  +L + +A +L +  +V+AES++ V+I+FSDIVGFT+++A+STP+QV++LLN+LYT FD +++  DVYKVETIGDAYMV SGLP RNG+ H  E+A M+L  LS + +FQIPH P+++V+LRIGIHSG   AGVVGLKMPRYCLFGDTVN ASRMES+GL L+IH+S +  +VL     + + +RG V MKGKG   TY+L G+D     P+P+
Sbjct:    1 MKMVRDLHHANLNRYLGVCVESPNICMVSRFCNRGTLQDLLGNDSIKLDWMFRQSFANDIATGMEAIHNSPIQAHGNLKSSNCLIDSRWACKITDYGLDLLRAN-QTPKDIGEFAVYKNLFWTAPELLPLADGFKDRKNKTQAGDVYSYGIVLYEIITRDEPYSTNTDTLSSKDVIELVRKRQEPAFRPQFSKFMEEKSGHKMVQVTQDCWDNDAQKRPTFSAIK---KKLKANGMGNGKISGMFSR---YYNNFSKLVISRMGVCMALKR----LL--VLSRPIADELKKGNSVSAESFQSVTIFFSDIVGFTSVAAQSTPLQVVDLLNQLYTRFDKVVDEHDVYKVETIGDAYMVVSGLPVRNGERHAGEVASMALNLLSEVRDFQIPHIPSRKVQLRIGIHSGSCVAGVVGLKMPRYCLFGDTVNYASRMESSGLALRIHVSPECKEVLDRLGGYHLDERGPVTMKGKGTIVTYFLTGKDG-FDKPLPD 478          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36203 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA1])

HSP 1 Score: 417.927 bits (1073), Expect = 3.072e-134
Identity = 223/467 (47.75%), Postives = 307/467 (65.74%), Query Frame = 2
Query: 1811 FITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTK-ADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGL 3205
            F   +  K  +VALK L     + + R++LIE+K+V+++ + ++  +IGVC   P   ++++YC +GSLQ+IL N++I+LDW F+ S   DI  GM  +H S+I  HG+L+SS CL+DSR+V K+ DFGL  L+  +    E   +A Y  L W APE+L+     +    T+  DVYSFGII  E++ R   +  ++    P +++E +      P+RP  +  EI +  + +++ Q W +D   RP F  IK  +R L KGG S +I+DN+L  ME Y   LE +V++RT Q  +EK KT++LLY MLP+ +A  L R E V AESY  V+I+FSDIVGFT L+A STP+QV++LLN LYT FD+II+  DVYKVETIGDAYMV SGLP RNG  H  EIA M+L  LS++  F+  H PN+ + LRIGIH+G   AGVVGLKMPRYCLFGDTVN ASRMES G+
Sbjct:   59 FCEHSFIKSYLVALKMLR-KDSLTLTRDMLIEMKQVRDVQHTNLLHYIGVCTTPPNICIVSQYCHRGSLQEILANDEISLDWFFRESFANDIAMGMHVIHTSSIHVHGDLRSSKCLIDSRWVCKVADFGLNLLKANQRPDPEIGVHAQYSRLFWRAPELLQNEKSTNKPVPTQMGDVYSFGIILNELLTREEPYATTE--FAPIEVIERIRCHLNPPFRP-ETPFEIRNRSVTKLMTQCWNDDPQARPTFSDIKRQLRLL-KGGKS-SIVDNMLRLMENYTEQLETIVDERTRQLADEKAKTDELLYKMLPRYIAESLKRGEPVIAESYSSVTIFFSDIVGFTELAAASTPLQVVDLLNDLYTCFDTIIDKHDVYKVETIGDAYMVVSGLPVRNGHRHAGEIATMALNLLSSMGNFRARHLPNRPIHLRIGIHTGSCVAGVVGLKMPRYCLFGDTVNYASRMESTGV 519          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 425/1034 (41.10%), Postives = 605/1034 (58.51%), Query Frame = 2
Query:  293 ADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNW-SRVKLIY----EQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNAETLLE-IDMGSENAVVVLCVEPESVRRILLKAHKLNFINGE-YVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG-SVEES--NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKN--CPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNV--ETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKST-KADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDS 3343
            A   C  SR  +   V   + S+P V+FGP C Y LA + R +  W +P+IT  G +  F ++  +EY T+ R+     T  L      +   +NW SR  +I+    +    ++  S G   + ++  N T  +    N +   E +    EN  ++    P      ++K  +    + E Y    +D+      ++KPW +    D  N    + ++S+  +T   P++ EY++F +++  R    +G ++E S  +   G F+D  +LYA+AL++T+A      NG  ITR+  NR+  G+TG +SID+   RN D  +  M +++TG + +V+ Y G  +  +  + + I W +    PP   P C ++  +  C +     G +++ +  A+++F  I+ F IY+++K + EL  M W + W+++  E+  K H+                 R   S+RG               S  G ++ ++                            + F  T  +KGN+VA+K ++  K++E+ R +L+E+K ++++   H+ RFIG C+D P   ++TEYCP+GSLQDILENE INLDWMF++SL+ DI +GM +LH S  G HGNLKSSNC+VDSRFVLKI D+GL   R + E    +D +A Y   LWTAPE+L    + H  + T K DVYSFGII QE+  RNG FY+  ++L PK+IV+ V   Q   +RP  +++   SE L  ++   W ED + RPDF  IK  M  LNK G S +IL+NLLSRMEQYANNLE LV +RT+ YLEEKRK E+LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFT++SAESTP+QV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H REIA MSLA L  +  F+I H+PN ++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  LKIH+S  + +VL  F  F +  RG V MKGKG   TYWL GE +
Sbjct:   89 APGSCAESRAQVV-VVDAKLYSRPDVFFGPGCVYPLASVGRFVSHWKLPLITAGGPAYGFEKL--DEYKTIVRIGP--STTKLGAFVNVLHTQFNWTSRAVVIFYDLKQDDRPHYFLSEGIFMNLKDEMNMTVSARPYTNEQDYKELVSFIKENGRIIYICGPLETFLSIMKLFQSEIQDPESYAIFYLDVFAESLTHRKPWQNAK-FDWTN--PIQVFKSVFVITYHPPDNPEYKDFQRKLHARAQRDFGVNLEPSLMDYIAGSFYDGFVLYAMALDETLAEGGAQNNGINITRRTQNRSFWGVTGLVSIDKRNARNIDVDLWAMTNQETGEYGVVSYYNGSTKEIVWSQTEKIHWPSCG--PPLDNPPCVFSTDDPSCNDGLPVLGIVAVGSGLALIIFG-ISSFLIYRKLKLEKELAGMLWRVQWEDLQFESPNKYHKRA-------------GSRLTLSQRG---------------SSYGSLITAQGK-------------------------YQLFAKTGYFKGNLVAIKHVN-KKRIELTRQVLMELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNFLHNSYFGCHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---NDDSHALYAKKLWTAPELL--IYDHHPPQGTQKGDVYSFGIILQEIALRNGPFYVESMDLSPKEIVQKVRNGQRPYFRP-TTDSRFHSEELTILMEGCWAEDPAERPDFGHIKIYMAKLNKEG-STSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIASMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFCYFNLELRGDVEMKGKGKMRTYWLLGEKT 1050          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 419/1036 (40.44%), Postives = 590/1036 (56.95%), Query Frame = 2
Query:  293 ADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLT---------VTAQRPESEEYRNFIKEVKNRTNEKYG-SVEES--NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKN--CPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNV--ETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKST-KADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDS 3343
            A   C  SR  +   V   + S+P V+FGP C Y LA + R +  W +P+IT  G +  F ++  +EY T+ R+     T  L      +   +NW+              R+V   +D                                            L +  + ++   E +F+N+    + T + +P+ ++ D  E+    KE  RS  T         +T   P++ EY++F +++  R    +G ++E S  +   G F+D  +LYA+AL++T+A      NG  ITR+  NR+  G+TG +SID+   RN D  +  M +++TG + +V+ Y G  +  +  + + I W +    PP   P C ++  +  C +     G +++ +  A+++F  I+ F IY+++K + EL  M W + W+++  E+  K H+                 R   S+RG               S  G ++ ++                            + F  T  +KGN+VA+K ++  K++E+ R +L+E+K ++++   H+ RFIG C+D P   ++TEYCP+GSLQDILENE INLDWMF++SL+ DI +GM +LH S  G HGNLKSSNC+VDSRFVLKI D+GL   R + E    +D +A Y   LWTAPE+L    + H  + T K DVYSFGII QE+  RNG FY+  ++L PK+IV+ V   Q   +RP  +++   SE L  ++   W ED + RPDF  IK  M  LNK G S +IL+NLLSRMEQYANNLE LV +RT+ YLEEKRK E+LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFT++SAESTP+QV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H REIA MSLA L  +  F+I H+PN ++ LRIGIH+GPVCAGVVGLKMPRYCLFGDTVNTASRMESNG  LKIH+S  + +VL  F  F +  RG V MKGKG   TYWL GE +
Sbjct:   89 APGSCAESRAQVV-VVDAKLYSRPDVFFGPGCVYPLASVGRFVSHWKLPLITAGGPAYGFEKL--DEYKTIVRIGP--STTKLGAFVNVLHTQFNWTS-------------RAVVIFYD--------------------------------------------LKQDDRPHYFLSEGIFMNLKDEMNMTVSARPYTNEQDYKELVSFIKENGRSKFTHQYDTSVFVITYHPPDNPEYKDFQRKLHARAQRDFGVNLEPSLMDYIAGSFYDGFVLYAMALDETLAEGGAQNNGINITRRTQNRSFWGVTGLVSIDKRNARNIDVDLWAMTNQETGEYGVVSYYNGSTKEIVWSQTEKIHWPSCG--PPLDNPPCVFSTDDPSCNDGLPVLGIVAVGSGLALIIFG-ISSFLIYRKLKLEKELAGMLWRVQWEDLQFESPNKYHKRA-------------GSRLTLSQRG---------------SSYGSLITAQGK-------------------------YQLFAKTGYFKGNLVAIKHVN-KKRIELTRQVLMELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNFLHNSYFGCHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---NDDSHALYAKKLWTAPELL--IYDHHPPQGTQKGDVYSFGIILQEIALRNGPFYVESMDLSPKEIVQKVRNGQRPYFRP-TTDSRFHSEELTILMEGCWAEDPAERPDFGHIKIYMAKLNKEG-STSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIASMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFCYFNLELRGDVEMKGKGKMRTYWLLGEKT 998          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 300/515 (58.25%), Postives = 389/515 (75.53%), Query Frame = 2
Query: 1802 IKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDS 3343
            ++ +  T  YKGN+VA+K ++  K++E+ RN+L E+K +++++NEH+ RFIG C+D P   ++TEYCP+GSLQD++E+E + LDWMF++SL+ DI +GM +LH S I  HGNLKSSNC+VDSRFVLKI D+GL+ LR +      +D +AYY   LWTAPE+LR T +  L  + K DVYSFGII QE+    GVFY+    L PK+I++ V +  +   RP L  +   SE L  ++++ W E+   RPDF TIK ++R  ++G  S NILDNLLSRMEQYANNLEELV +RT+ Y EEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFTALSAESTP+QV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H RE+ARM+LA L A+  F+I H+P++++ LRIG+HSGPVCAGVVGLKMPRYCLFGDTVNTASRMES G  LKIH+SE +  VL+ F  F +  RG++ +KGKG+  TYWL GED+
Sbjct:  545 LQIYTKTGYYKGNLVAIKYIN-KKRIELTRNVLFELKHMRDVHNEHLTRFIGACVDPPNMCIITEYCPRGSLQDLMESESMTLDWMFRYSLINDIVKGMTFLHNSVIFSHGNLKSSNCVVDSRFVLKITDYGLQSLRTSS---CPDDTHAYYARKLWTAPELLR-TEDPPLCGTQKGDVYSFGIILQELALLKGVFYIDTHTLIPKEIIQGVIRGGVPLLRPSLCFHS-HSEELGVLMQRCWCEEPGERPDFNTIKILLRKQHRGYGS-NILDNLLSRMEQYANNLEELVEERTQAYNEEKRKAEALLYQILPHSVADQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREVARMALALLDAVKSFKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWLQGEDN 1052          

HSP 2 Score: 148.673 bits (374), Expect = 8.094e-36
Identity = 111/436 (25.46%), Postives = 203/436 (46.56%), Query Frame = 2
Query:  305 CLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSR-VKLIY--------EQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG-SVEES--NKFLGVFHDSLLLYALALNDTMAMN------LTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKN--CPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVE 1549
            C  S  PL   V L +   P  + GP CDYS +P+AR    WD+P++T    +  F +     ++ +T  N+      L     KI + + W     LI+        E+T       + +L    N     +     +N + L++I +     VV LC   +++R ++++  K       YVF  IDL       +KP       D+ +  A+ A+RS+  +T   P++ EY  F++ +K    + +  ++++S  N   G F+D ++LY+ ALN+T++        +    G  +T++MWNRT QG+ G + +D+ GDR  D+++ DM D ++G F++V  Y    +  +  +G    W      PP   P CG+   N  C    +    +  + +  + +  +    +IY+++K + EL A  W + W +++
Sbjct:   87 CSDSAAPLV-AVDLKLSHDPWAFIGPGCDYSSSPVARFTTHWDVPMVTAGARADGFSK-----FAAVT--NTGPTHKKLGEFSLKIQETFGWHHHTMLIFSDNKDDNDERTCYFAIEGLYSLMGKHNITVFDYFVESNINHKELVQI-IQKNGRVVYLCCSWDNMRSLMVQFWKEGVDLENYVFFFIDLFAEGLGGEKPGMPWFRGDQDDHAARLAFRSVKVLTYMEPQNAEYHQFVETLKKDAEKMFNFTIKDSLYNLIAGGFYDGVMLYSRALNETLSKRKPGLRPVQRPKGDMVTQRMWNRTFQGVMGTVEMDKFGDREIDFALWDMTDINSGKFEVVCVYNSSIKELVLQKGLNFQWPGGS--PPLEVPECGFKNDNPACLTSTVTMHQMVAMVICFVFVIIITITIFIYRKLKLENELAAQLWRVSWVDIQ 511          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 300/515 (58.25%), Postives = 389/515 (75.53%), Query Frame = 2
Query: 1802 IKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDS 3343
            ++ +  T  YKGN+VA+K ++  K++E+ RN+L E+K +++++NEH+ RFIG C+D P   ++TEYCP+GSLQD++E+E + LDWMF++SL+ DI +GM +LH S I  HGNLKSSNC+VDSRFVLKI D+GL+ LR +      +D +AYY   LWTAPE+LR T +  L  + K DVYSFGII QE+    GVFY+    L PK+I++ V +  +   RP L  +   SE L  ++++ W E+   RPDF TIK ++R  ++G  S NILDNLLSRMEQYANNLEELV +RT+ Y EEKRK E LLY +LP SVA QL R ETV AE+++ V+IYFSDIVGFTALSAESTP+QV+ LLN LYT FD+II++FDVYKVETIGDAYMV SGLP RNG +H RE+ARM+LA L A+  F+I H+P++++ LRIG+HSGPVCAGVVGLKMPRYCLFGDTVNTASRMES G  LKIH+SE +  VL+ F  F +  RG++ +KGKG+  TYWL GED+
Sbjct:  486 LQIYTKTGYYKGNLVAIKYIN-KKRIELTRNVLFELKHMRDVHNEHLTRFIGACVDPPNMCIITEYCPRGSLQDLMESESMTLDWMFRYSLINDIVKGMTFLHNSVIFSHGNLKSSNCVVDSRFVLKITDYGLQSLRTSS---CPDDTHAYYARKLWTAPELLR-TEDPPLCGTQKGDVYSFGIILQELALLKGVFYIDTHTLIPKEIIQGVIRGGVPLLRPSLCFHS-HSEELGVLMQRCWCEEPGERPDFNTIKILLRKQHRGYGS-NILDNLLSRMEQYANNLEELVEERTQAYNEEKRKAEALLYQILPHSVADQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREVARMALALLDAVKSFKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWLQGEDN 993          

HSP 2 Score: 77.0258 bits (188), Expect = 8.127e-14
Identity = 93/427 (21.78%), Postives = 168/427 (39.34%), Query Frame = 2
Query:  305 CLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNW-SRVKLIY--------EQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKN--CPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVE 1549
            C  S  PL   V L +   P  + GP CDYS +P+AR    WD+P++T  GA    R     +++ +T  N+      L     KI + + W     LI+        E+T       + +L    N     +     +N + L++I +     VV LC   +++R ++++  K       YVF  IDL       +KP       D+ +  A+ A+R                                V   + F     +S  +Y L+   T     ++      +  +W     G+ G + +D+ GDR  D+++ DM D ++G F++          ++P +G    W      PP   P CG+   N  C    +    +  + +  + +  +    +IY+++K + EL A  W + W +++
Sbjct:   87 CSDSAAPLV-AVDLKLSHDPWAFIGPGCDYSSSPVARFTTHWDVPMVT-AGA----RADGFSKFAAVT--NTGPTHKKLGEFSLKIQETFGWHHHTMLIFSDNKDDNDERTCYFAIEGLYSLMGKHNITVFDYFVESNINHKELVQI-IQKNGRVVYLCCSWDNMRSLMVQFWKEGVDLENYVFFFIDLFAEGLGGEKPGMPWFRGDQDDHAARLAFR--------------------------------VRHPSIF-----NSFSVYNLS---TTITPQSFMQIKMCSEPVWCVVSAGVMGTVEMDKFGDREIDFALWDMTDINSGKFEVK---------HLP-KGLNFQWPGGS--PPLEVPECGFKNDNPACLTSTVTMHQMVAMVICFVFVIIITITIFIYRKLKLENELAAQLWRVSWVDIQ 452          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc2 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125799])

HSP 1 Score: 586.26 bits (1510), Expect = 0.000e+0
Identity = 298/513 (58.09%), Postives = 376/513 (73.29%), Query Frame = 2
Query: 1802 IKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLH-SNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGE 3337
            ++ F  T  YKGN+VA+K  +  K++E+NR +L E+K ++++ NEH+ RFIG C+D P   ++TEYCP+GSLQDILEN+ I L+WMFKFSL+ DI +GM++LH S I  HG LKSSNC+VD+RFVLKI D+GL   R  +E  + +D ++YY   LW APE+LR       Q + K DVYSF II QEV  R G FYL    L PK+IV+ V        RP +       E L +++++ W E+ + RPDF  I+ ++R  NK   + NILDNLLSRMEQYANNLEELV +RT+ Y EEKRK E LLY +LP SVA QL R ETV AE+++ VSIYFSDIVGFTALSAESTPM+V+ LLN LYT FD++I++FDVYKVETIGDAYMV SGLP RNG +H REIARM+LA L  +  F+I H+P ++++LRIGIHSGPVCAGVVGLKMPRYCLFGDTVNT+SRMES+G  LKIH+S  + DVL  F  F +  RG +++KGKG  TTYWL GE
Sbjct:  553 LQVFAKTGYYKGNIVAIKYTN-KKRIELNRKVLFELKHMRDVQNEHLTRFIGACVDPPNICIITEYCPRGSLQDILENDSITLEWMFKFSLINDIVKGMVFLHNSVIFSHGKLKSSNCVVDNRFVLKITDYGLSTFR--QESDVGSDSHSYYAQKLWMAPELLRMENPPP-QGTQKGDVYSFSIILQEVALRRGAFYLDGDPLSPKEIVDRVILGDWPCLRPSIDPQSHSPE-LGQLMQRCWAEEPTERPDFNHIRLLLRKHNKESRT-NILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVSIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMALALLDTVRTFRIRHRPEQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESSGEALKIHVSAATRDVLIEFNSFQLELRGDIDIKGKGKMTTYWLLGE 1059          

HSP 2 Score: 177.948 bits (450), Expect = 6.051e-45
Identity = 124/441 (28.12%), Postives = 217/441 (49.21%), Query Frame = 2
Query:  275 LKYYADADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSR-VKLIYEQTFLN--FCR-SVGTLFDSENYKNKTFKSVVL------LNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYG-SVEES--NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDM-DKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKN--CPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVE 1549
             K   +++  C  S  PL   V L    KP  + GP C Y+ +P+      WD+P+IT  GA  I        Y T+T  N+      L     +I + + W   V L++     +   C  ++  L++     N + +  V       +N   +L  D+ +   V+ +C  P+  RR++++  K +  + +YVF+ IDL     +N++PW   +  D +   AK+A++S+  ++ + P+++EY+ F++++K      +  SV++S  N   G F+D L+LYA ALN+T  +      G  I+ KMWNRT  G+TG + +D +GDR  D+++ D+ D ++  F+IV  Y   ++   PV G  + W+      P   P CG+   N  C  + I    +  IT+  I    L    +I +++K + EL A  W I WD+++
Sbjct:   92 FKSSENSNGICSESVAPLV-AVDLEFAYKPWAFIGPGCSYTASPVGLFTTHWDVPLIT-AGAPAI--AFLDGIYPTIT--NTGPTHKKLGRFALRICEHFGWREYVTLMFSDNKEDDRPCYFAMEGLYEELKSINISLQDSVFEENKPPINYSQILA-DIQNIGRVMFVCCSPDVFRRLMIEFWKADLPHEQYVFLYIDLFAVSLSNKQPWARGDQDDTI---AKDAFQSVKILSYREPQNQEYQQFVRDLKADAKTSFNYSVQDSLMNIIAGGFYDGLMLYAHALNETALVPGARPPGKLISGKMWNRTFHGVTGLLHLDVSGDRETDFALWDLVDTNSSSFQIVVVYNSFEEQVTPVPGTSVRWLGGAR--PLDVPKCGFKNDNPACLTKTITIHQMVSITLFFIFTMTLTIAIFICRKMKLEKELVAQLWRISWDDIQ 520          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000068881.1 (SMESG000068881.1)

HSP 1 Score: 2133.61 bits (5527), Expect = 0.000e+0
Identity = 1038/1041 (99.71%), Postives = 1039/1041 (99.81%), Query Frame = 2
Query:  263 FYSKLKYYADADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIPESCEFSK 3385
            F  KLKYYADADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEY+NFIKEVKNRTNEKYGSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVNSINISINSWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIPESCEFSK
Sbjct:   77 FIRKLKYYADADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYQNFIKEVKNRTNEKYGSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVNSINISINSWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIPESCEFSK 1117          

HSP 2 Score: 166.392 bits (420), Expect = 2.015e-41
Identity = 79/79 (100.00%), Postives = 79/79 (100.00%), Query Frame = 3
Query:   36 MKSKDLSHLFILFYSFAVFIIICKSDITDNFPNANPDYPLAIIMIPDDIRHNFNKNLMLSAFDIALEKIRTWNIHPFIR 272
            MKSKDLSHLFILFYSFAVFIIICKSDITDNFPNANPDYPLAIIMIPDDIRHNFNKNLMLSAFDIALEKIRTWNIHPFIR
Sbjct:    1 MKSKDLSHLFILFYSFAVFIIICKSDITDNFPNANPDYPLAIIMIPDDIRHNFNKNLMLSAFDIALEKIRTWNIHPFIR 79          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000068881.1 (SMESG000068881.1)

HSP 1 Score: 2070.82 bits (5364), Expect = 0.000e+0
Identity = 1005/1006 (99.90%), Postives = 1006/1006 (100.00%), Query Frame = 2
Query:  368 VWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIPESCEFSK 3385
            VWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEY+NFIKEVKNRTNEKYGSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVNSINISINSWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIPESCEFSK
Sbjct:   53 VWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLNFCRSVGTLFDSENYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYQNFIKEVKNRTNEKYGSVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPSRVNSINISINSWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIPESCEFSK 1058          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000056411.1 (SMESG000056411.1)

HSP 1 Score: 1103.2 bits (2852), Expect = 0.000e+0
Identity = 562/1064 (52.82%), Postives = 738/1064 (69.36%), Query Frame = 2
Query:  296 DSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLI-----YEQTFLNFCRSVGTLF---DSENYKNKTFKSVVLLNA---------ETLLEIDMGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSVEES---NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRF-------QYSKRGLAKFDEESDVLIGNPSLAGDVVKSRPS-------------RVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLS-DINLEPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIP 3364
            DSDCL +  PLY +V   +K  P V FGPICDY +APIARL+ FW+ P+IT       F   +  E+ TLTRV S  +  +   L  ++F  Y W++ K I     Y  T   +C  +G        +  KN   K    L+          + +L   +G++NA+ +LC +P+ VR+I+L+A  LNFINGEY+F+NID+ +S+   ++PWY K+  +E N  AK+A+R+L+T+T ++PE E+Y+ F  EVK R   +Y   +E+   N F+  FHD+++LYAL LNDT++     E+G  + + MWNR+ + +   ++I  +GDR AD+S++D+++ TG+F++V+NYIG+K+ Y PV  +IIDW    N  P   P CGY+   CP      G IS   M A +  A+I G +I++R KFQAELNAMNW+IPWD++ET EKR R   K SD         KRF       +     L K DE     I N  L  D+  S+               + +  NIS  S ++  G+  D++H ++ F  TAL+KGN+VALK ++ + K+EI   LLIE+KK+K+++N+HICRFIGVCLD P  +++ EYCPKGSL+D+L  EQI LDWMFK+SL+QDICRGMIYLH+N GPHGNLKSSNCLVDSRFVLKI DFGL  L+G K  ++  +   YY++ LWTAPE+L  +    +  + K DVYSF +ICQE+VYRNGVF L+ D NL  K+I E V      P+RP L   + C++ + ++I+Q+W ED + RPDF TIK +MR LNKGGD+GNILDNLLSRMEQYANNLE LV +RTEQYLEEK+K EDLLYSMLPK VA QLI+N+ V AESY+MV+I+FSDIVGFTALSAESTPMQ+IELLNRLYTTFDSIIE++DVYKVETIGDAYMVCSGLPQ NG++H REIARMS+AFL AI  F IPH+P+K++ELRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNGLPLKIH+S+ + ++L TF  FIIS+RG +++KGKG Q TYWLHGEDS IVDP+P
Sbjct:   96 DSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRR---KFSDGDNFHPYTKKRFSNIMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSKKKKHKLNKLRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGKIEITTELLIEIKKIKDMSNDHICRFIGVCLDHP--YIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNP-PVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDPLP 1153          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000010241.1 (SMESG000010241.1)

HSP 1 Score: 1073.92 bits (2776), Expect = 0.000e+0
Identity = 556/1062 (52.35%), Postives = 727/1062 (68.46%), Query Frame = 2
Query:  275 LKYYADADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLN-----FCRSVGTLFDSE-----------NYKNKTFKSVVLLNAETLLEID-MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSVEES---NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCP--NRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREK-RHRLTHKV----SDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVKS--RPSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYL-SDINLEPKQIVEFV-TKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIPE 3367
            LK     DS C+ +   LY  V+  +   P V FGPIC Y LAPIARLL FW+IPI++       FR+ +  E+ TLTR+ S  +   L  + +K F+ Y W+    IY +T        +C ++G     E            YK  T  ++    A     ID +G++ AV VLCV+P SV RILLKA +LNF NGEYVFINI L +S    + PWY        N +AK AYRSLL+VT + PE+E++RNF  +VK   + +Y    E    N F+  F+D +LLYA ALN T+A      NG+ I + MWN T +GI G ++ID +GDR AD+S+LDMD  TG FK VA++IG K  ++ V    +DW +  N+ P + P CGY+   CP  ++ +  G IS   M  + L +   G+++Y+ +K QAELNAMNW+IPW+++ET EK R+ + H      S  + NS++  K  Q   + +       +V   +  ++ +  K+   P   +   IS  S E+  G+  D +   + F  TALYKGNVVALK +   ++++INR LLI+VKKVK+LNN+HICRFIG CL+    +++ +YCPKGSL+D+L  EQI LDW+FK+SL+QDICRGM+YLH+N+GP G LKSSNCLVDSRFVLKI DFGL  LRG+K+YLLE D   Y++NLLWTAPE+LR +    L  + K DVYSF I+CQE+VYR GVF L S+ +   ++IVE V  +    P+RP L+    C+E    +I+QSW ED  LRPDF TIK  MR  NK GDSGNILDNLLSRMEQYANNLE++V +RTEQYLEEK+K EDLLYSMLPKSVA QLI+N+ V AESY++V+I+FSDIVGFTALSAESTPMQ+I+LLNRLYTTFDSIIE++DVYKVETIGDAYMVCSGLPQ NG++H REIARM++AFLSAIF F IPH+P+K ++LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNGLP KIH+S+ ++ +L+TF  F++++RG + +KGKG   TYWLHGE+ +IVDP+P+
Sbjct:   77 LKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKELTTATLTNDTALEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKV--KVHQSRSQNMENLHLLHEVEKPSSKISRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNVYFKNLLWTAPELLRMSNP-PLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPVPK 1135          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000010241.1 (SMESG000010241.1)

HSP 1 Score: 1072.77 bits (2773), Expect = 0.000e+0
Identity = 559/1069 (52.29%), Postives = 727/1069 (68.01%), Query Frame = 2
Query:  275 LKYYADADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLN-----FCRSVGTLFDSE-----------NYKNKTFKSVVLLNAETLLEID-MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSVEES---NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCP--NRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREK-RHRLTHKV----SDTLPNSELFTKRFQYSKRGLAKFDEESDVL-----IGNPSLAGDVVKSR----PSRVXXXXXXXXXWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYL-SDINLEPKQIVEFV-TKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIPE 3367
            LK     DS C+ +   LY  V+  +   P V FGPIC Y LAPIARLL FW+IPI++       FR+ +  E+ TLTR+ S  +   L  + +K F+ Y W+    IY +T        +C ++G     E            YK  T  ++    A     ID +G++ AV VLCV+P SV RILLKA +LNF NGEYVFINI L +S    + PWY        N +AK AYRSLL+VT + PE+E++RNF  +VK   + +Y    E    N F+  F+D +LLYA ALN T+A      NG+ I + MWN T +GI G ++ID +GDR AD+S+LDMD  TG FK VA++IG K  ++ V    +DW +  N+ P + P CGY+   CP  ++ +  G IS   M  + L +   G+++Y+ +K QAELNAMNW+IPW+++ET EK R+ + H      S  + NS++  K  Q   + +     E + L     +  PS       S+    P   +   IS  S E+  G+  D +   + F  TALYKGNVVALK +   ++++INR LLI+VKKVK+LNN+HICRFIG CL+    +++ +YCPKGSL+D+L  EQI LDW+FK+SL+QDICRGM+YLH+N+GP G LKSSNCLVDSRFVLKI DFGL  LRG+K+YLLE D   Y++NLLWTAPE+LR +    L  + K DVYSF I+CQE+VYR GVF L S+ +   ++IVE V  +    P+RP L+    C+E    +I+QSW ED  LRPDF TIK  MR  NK GDSGNILDNLLSRMEQYANNLE++V +RTEQYLEEK+K EDLLYSMLPKSVA QLI+N+ V AESY++V+I+FSDIVGFTALSAESTPMQ+I+LLNRLYTTFDSIIE++DVYKVETIGDAYMVCSGLPQ NG++H REIARM++AFLSAIF F IPH+P+K ++LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNGLP KIH+S+ ++ +L+TF  F++++RG + +KGKG   TYWLHGE+ +IVDP+P+
Sbjct:   77 LKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKELTTATLTNDTALEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKV--KVHQSRSQNVKGTRNEMENLHLLHEVEKPSSKISRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNVYFKNLLWTAPELLRMSNP-PLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPVPK 1142          
The following BLAST results are available for this feature:
BLAST of Guanylate cyclase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPR10.000e+042.07natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
NPR28.226e-3958.01natriuretic peptide receptor 2 [Source:HGNC Symbol... [more]
GUCY2F3.499e-14234.55guanylate cyclase 2F, retinal [Source:HGNC Symbol;... [more]
GUCY2D4.011e-12744.72guanylate cyclase 2D, retinal [Source:HGNC Symbol;... [more]
GUCY2C1.315e-11543.08guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcy-284.014e-17752.57Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-286.881e-17752.57Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-289.318e-17752.57Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-282.711e-16549.05Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-79.759e-14530.65Receptor-type guanylate cyclase gcy-7 [Source:Uni... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG311830.000e+044.09gene:FBgn0051183 transcript:FBtr0346151[more]
CG311830.000e+044.09gene:FBgn0051183 transcript:FBtr0083187[more]
CG32160.000e+039.47gene:FBgn0034568 transcript:FBtr0273396[more]
CG107383.151e-17337.00gene:FBgn0036368 transcript:FBtr0302487[more]
CG107381.006e-17236.93gene:FBgn0036368 transcript:FBtr0304792[more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr1a0.000e+042.44natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1a0.000e+042.44natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr20.000e+041.30natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZD... [more]
si:dkey-37g12.10.000e+039.39si:dkey-37g12.1 [Source:ZFIN;Acc:ZDB-GENE-090312-1... [more]
si:dkey-37g12.10.000e+038.89si:dkey-37g12.1 [Source:ZFIN;Acc:ZDB-GENE-090312-1... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPR20.000e+059.08natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+059.08natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+059.08natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+059.08natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+059.08natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npr10.000e+041.40natriuretic peptide receptor 1 [Source:MGI Symbol;... [more]
Npr27.557e-4057.81natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Npr20.000e+057.81natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Gucy2g6.317e-15432.73guanylate cyclase 2g [Source:MGI Symbol;Acc:MGI:10... [more]
Npr29.946e-15355.73natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
back to top
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P18293|ANPRA_MOUSE0.000e+041.40Atrial natriuretic peptide receptor 1 OS=Mus muscu... [more]
sp|P18910|ANPRA_RAT0.000e+041.69Atrial natriuretic peptide receptor 1 OS=Rattus no... [more]
sp|P16066|ANPRA_HUMAN0.000e+042.07Atrial natriuretic peptide receptor 1 OS=Homo sapi... [more]
sp|P55202|ANPRB_ANGJA0.000e+041.09Atrial natriuretic peptide receptor 2 OS=Anguilla ... [more]
sp|P46197|ANPRB_BOVIN9.361e-3858.01Atrial natriuretic peptide receptor 2 OS=Bos tauru... [more]
back to top
BLAST of Guanylate cyclase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4V6510.000e+052.04Guanylate cyclase OS=Schistosoma mansoni OX=6183 G... [more]
V4BNJ30.000e+048.85Guanylate cyclase (Fragment) OS=Lottia gigantea OX... [more]
A0A210PTL80.000e+048.24Guanylate cyclase OS=Mizuhopecten yessoensis OX=65... [more]
A0A1I8HCY10.000e+047.88Guanylate cyclase OS=Macrostomum lignano OX=282301... [more]
A0A1I8JDN40.000e+048.06Guanylate cyclase OS=Macrostomum lignano OX=282301... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr1a0.000e+040.82natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1a5.495e-3759.61natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1b1.650e-4658.79atrial natriuretic peptide receptor 1-like [Source... [more]
npr1b1.650e-4658.79atrial natriuretic peptide receptor 1-like [Source... [more]
npr20.000e+036.75natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006352.10.000e+045.80pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 ... [more]
NPR10.000e+055.38natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
ENSPMAT00000008976.14.076e-15049.22pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-... [more]
ENSPMAT00000008986.11.014e-14048.10pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-... [more]
ENSPMAT00000008942.19.789e-13746.11pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 ... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC151.821e-1326.29Protein kinase of the Mitotic Exit Network; locali... [more]
CDC52.050e-1327.60Polo-like kinase; controls targeting and activatio... [more]
KIN12.684e-1127.78Serine/threonine protein kinase involved in regula... [more]
CLA43.936e-1128.04Cdc42p-activated signal transducing kinase; member... [more]
STE111.175e-1027.22Signal transducing MEK kinase; involved in pheromo... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO342752.720e-17552.78Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309859.116e-16753.27Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279231.284e-13548.84Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361824.618e-13545.12Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362033.072e-13447.75Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr20.000e+041.10natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
npr20.000e+040.44natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
olgc78.094e-3658.25membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc78.127e-1458.25membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc26.051e-4558.09membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Guanylate cyclase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068881.12.015e-4199.71SMESG000068881.1[more]
SMESG000068881.10.000e+099.90SMESG000068881.1[more]
SMESG000056411.10.000e+052.82SMESG000056411.1[more]
SMESG000010241.10.000e+052.35SMESG000010241.1[more]
SMESG000010241.10.000e+052.29SMESG000010241.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007202 ID=SMED30007202|Name=Guanylate cyclase|organism=Schmidtea mediterranea sexual|type=transcript|length=3482bp
AAGTGGGATTTTATTCATTTTTATATTCTCATAGCATGAAGTCAAAAGAT
TTATCTCATCTATTCATCCTTTTTTATTCTTTTGCTGTCTTCATTATTAT
TTGTAAATCCGACATCACCGACAACTTTCCAAACGCCAATCCAGACTATC
CTTTAGCTATCATCATGATTCCCGATGACATTAGACATAATTTTAATAAA
AATCTCATGCTTTCCGCCTTCGACATTGCTTTGGAAAAGATCAGAACGTG
GAATATTCATCCTTTTATTCGAAATTGAAATACTATGCGGACGCCGACAG
TGACTGTTTAGCCTCAAGAATGCCGCTTTATTATACTGTGAAACTACTAA
TGAAAAGCAAACCTGGTGTTTGGTTTGGTCCAATTTGTGATTACAGTTTG
GCACCGATAGCCCGTTTACTTCCGTTTTGGGACATTCCAATTATCACCCC
GTGCGGAGCCTCGGGAATATTTCGTCAGATGAAACACGAAGAGTACTCCA
CATTAACTCGGGTCAATTCCATTATCGTAACTGATCATCTGAAAGTGCTT
TTTCGGAAAATATTCCAAATGTACAATTGGTCCCGGGTGAAACTTATTTA
CGAGCAAACATTTCTCAACTTTTGCCGATCAGTTGGCACACTTTTCGACA
GTGAAAATTACAAAAATAAAACATTCAAATCTGTAGTGCTTCTTAACGCT
GAAACACTTTTAGAAATAGATATGGGATCAGAAAATGCAGTTGTTGTTCT
ATGTGTGGAACCGGAATCTGTACGACGAATTCTATTAAAAGCTCATAAAT
TGAACTTTATCAATGGTGAATATGTTTTTATTAACATTGATCTATTAACC
AGTAAAACTAACAACCAAAAGCCATGGTATTCCAAGAATGATACAGACGA
AGTGAATTTCAAAGCCAAAGAAGCATACCGGTCATTGCTTACGGTCACAG
CTCAAAGACCGGAAAGTGAAGAATATCGAAATTTCATAAAAGAAGTTAAA
AACCGAACGAATGAAAAATATGGTTCAGTTGAAGAATCGAATAAATTTCT
GGGGGTATTCCACGATTCTTTACTGCTTTACGCACTTGCTTTGAACGACA
CAATGGCCATGAATTTGACATACGAAAATGGAACTTTTATCACTAGAAAA
ATGTGGAATCGGACAATTCAAGGCATTACTGGTGAAATGAGTATAGACGA
AAATGGAGACCGAAACGCTGATTATTCTGTGTTAGACATGGACAAAGATA
CAGGAATTTTTAAGATTGTCGCAAATTATATTGGTAAAAAGCAGCTGTAT
ATCCCAGTGGAAGGTCAAATCATAGATTGGGTAAACAAGAAGAATTTACC
TCCACCCAGTTTCCCGGTTTGTGGATACAATCGTAAAAACTGTCCCAATA
GAAAAATCGGAGCTGGAACTATTTCTTTGATCACAATGGCAGCGATTCTT
CTCTTTGCGTTAATAAACGGCTTTTATATATATAAGAGAGTAAAGTTTCA
AGCGGAACTTAATGCAATGAACTGGCTGATTCCATGGGATAATGTTGAAA
CAAGAGAAAAAAGACACAGATTAACCCATAAAGTTTCTGATACCCTACCT
AATTCTGAACTATTTACAAAACGTTTCCAATATTCTAAAAGAGGATTGGC
CAAATTTGATGAGGAAAGTGATGTCTTAATTGGAAATCCTTCATTAGCTG
GAGACGTTGTAAAGTCGAGACCGTCACGAGTCAATTCAATAAATATAAGT
ATTAATAGCTGGGAAAGTTTTACTGGACTGCAGAATGACAATTTACACTG
CATTAAAACGTTTATCACAACTGCACTGTACAAAGGCAATGTTGTAGCAT
TAAAACAACTTCATGGTTCCAAAAAAGTAGAAATCAACAGAAACTTGTTA
ATTGAAGTGAAAAAGGTAAAAAATCTCAATAATGAGCATATCTGTCGATT
CATTGGGGTATGTCTTGACGCCCCTCAGCATTGGTTATTAACCGAATATT
GCCCAAAAGGAAGCCTGCAAGATATATTAGAAAACGAACAGATTAATTTA
GATTGGATGTTCAAGTTTTCTCTGCTTCAAGATATTTGCCGAGGTATGAT
CTATCTCCATTCAAATATCGGACCTCATGGCAACTTAAAAAGTTCCAATT
GTTTAGTTGATTCAAGATTCGTGTTGAAAATTTGTGATTTTGGTTTGGAA
AAATTGCGAGGCACGAAAGAATATCTTTTGGAAAATGATGAATATGCATA
TTATAGAAACTTACTATGGACGGCTCCGGAGATTTTAAGGAAAACAACCG
AAATTCATTTGCAAAAATCAACGAAAGCAGATGTATATAGTTTCGGAATT
ATTTGTCAAGAAGTTGTTTATCGAAATGGAGTTTTCTATCTATCCGATAT
CAATTTGGAACCAAAACAAATTGTGGAATTCGTAACAAAAGTACAGCTCA
TTCCGTATCGGCCATTTCTGAGTGAAAATGAGATATGTTCAGAAGGTCTC
TGTAGGATTATTCGCCAGTCTTGGCAGGAAGATTTTAGTTTGAGGCCAGA
TTTTAGAACAATAAAAGGAATGATGAGATACCTCAACAAAGGAGGAGACA
GTGGCAATATTTTGGATAATTTGTTGTCGCGTATGGAGCAGTACGCAAAT
AATTTGGAGGAACTAGTCAATCAAAGAACTGAACAATATCTAGAAGAGAA
GAGAAAGACTGAAGACCTACTATATTCAATGTTACCAAAGTCTGTGGCGG
GCCAGTTGATACGAAACGAAACTGTAACGGCGGAAAGCTATGAAATGGTA
TCAATATATTTTAGTGACATTGTTGGATTTACCGCTCTCTCCGCCGAATC
TACTCCGATGCAAGTTATTGAGCTGCTCAATAGACTTTATACAACTTTTG
ATTCAATTATAGAAAGTTTTGACGTTTATAAAGTTGAAACTATCGGGGAT
GCTTATATGGTATGTTCAGGACTTCCACAGAGAAATGGTGATATTCATAT
TAGAGAAATAGCCAGAATGAGTTTAGCTTTTTTGTCTGCAATTTTCGAGT
TTCAGATACCTCACAAACCCAATAAAAGAGTTGAATTAAGAATCGGAATA
CATTCGGGTCCAGTTTGTGCTGGAGTCGTCGGATTGAAAATGCCAAGGTA
CTGTTTATTTGGAGATACTGTCAACACTGCAAGTCGGATGGAGAGTAACG
GATTACCGTTAAAAATTCACATGAGTGAACAGTCCGTAGATGTACTCCGA
ACGTTTCAAAGATTTATTATTAGCAAAAGAGGGCAGGTCAATATGAAAGG
TAAGGGCTACCAAACGACCTACTGGCTTCATGGAGAAGATTCAGTGATCG
TTGATCCTATTCCAGAAAGTTGTGAATTTTCGAAATAGATTATTTTTACC
AAACAATTCGTCATTGTCAATTTTTTTATTTGATTTGCGTTTTTTGTAAA
TATGTTTCATGGTCAAGATTGTACTATTAATA
back to top

protein sequence of SMED30007202-orf-1

>SMED30007202-orf-1 ID=SMED30007202-orf-1|Name=SMED30007202-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1023bp
MPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGI
FRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLN
FCRSVGTLFDSENYKNKTFKSVVLLNAETLLEIDMGSENAVVVLCVEPES
VRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAK
EAYRSLLTVTAQRPESEEYRNFIKEVKNRTNEKYGSVEESNKFLGVFHDS
LLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNA
DYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPV
CGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAM
NWLIPWDNVETREKRHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEES
DVLIGNPSLAGDVVKSRPSRVNSINISINSWESFTGLQNDNLHCIKTFIT
TALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLD
APQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNI
GPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLW
TAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINLEPKQ
IVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKG
MMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDL
LYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVI
ELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARM
SLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDT
VNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTT
YWLHGEDSVIVDPIPESCEFSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001170ANPR/GUC
IPR001054A/G_cyclase
IPR001828ANF_lig-bd_rcpt
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR018297A/G_cyclase_CS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
IPR029787Nucleotide_cyclase
IPR028082Peripla_BP_I
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0008074guanylate cyclase complex, soluble
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0009190cyclic nucleotide biosynthetic process
GO:0006468protein phosphorylation
GO:0006182cGMP biosynthetic process
GO:0007165signal transduction
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0016849phosphorus-oxygen lyase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004383guanylate cyclase activity
GO:0016301kinase activity
GO:0016829lyase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 17..34