IlvB (bacterial acetolactate synthase)-like

Overview
NameIlvB (bacterial acetolactate synthase)-like
Smed IDSMED30007199
Length (bp)1364
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of IlvB (bacterial acetolactate synthase)-like (SMED30007199) t-SNE clustered cells

Violin plots show distribution of expression levels for IlvB (bacterial acetolactate synthase)-like (SMED30007199) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of IlvB (bacterial acetolactate synthase)-like (SMED30007199) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for IlvB (bacterial acetolactate synthase)-like (SMED30007199) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007199

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30007199SMESG000026596.1 Contig4902uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007199SMESG000026596.1 Contig4902newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30007199SMESG000026596.1 dd_Smed_v4_1784_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007199SMESG000026596.1 dd_Smed_v4_1784_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30007199SMESG000026596.1 dd_Smed_v4_1784_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007199SMESG000026596.1 dd_Smed_v4_1784_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Human
Match: ILVBL (ilvB acetolactate synthase like [Source:HGNC Symbol;Acc:HGNC:6041])

HSP 1 Score: 203.371 bits (516), Expect = 6.236e-59
Identity = 107/203 (52.71%), Postives = 153/203 (75.37%), Query Frame = 3
Query:  333 NFRSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
             FR + +     +LNP+ VLQ +++  L   SILV DGGDFVG+AA+++ PRGPL W DPGAFGTLGVG GFALG KLC+P+++VW ++GDG+ GY+++E+DTF RH + V+++VGNDA W+QI+REQVP  GS++ C L +T Y K A GLG +G L++REN  + ++ + ++A +  R G PV++N LIGR+DFR GS++V
Sbjct:  325 TFREKAAMPVAQHLNPVQVLQLVEET-LPDNSILVVDGGDFVGTAAHLVQPRGPLRWLDPGAFGTLGVGAGFALGAKLCRPDAEVWCLFGDGAFGYSLIEFDTFVRHKIPVMALVGNDAGWTQISREQVPSLGSNVACGLAYTDYHKAAMGLGARGLLLSRENEDQVVK-VLHDAQQQCRDGHPVVVNILIGRTDFRDGSIAV 525          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Human
Match: ILVBL (ilvB acetolactate synthase like [Source:HGNC Symbol;Acc:HGNC:6041])

HSP 1 Score: 203.756 bits (517), Expect = 2.804e-58
Identity = 107/203 (52.71%), Postives = 153/203 (75.37%), Query Frame = 3
Query:  333 NFRSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
             FR + +     +LNP+ VLQ +++  L   SILV DGGDFVG+AA+++ PRGPL W DPGAFGTLGVG GFALG KLC+P+++VW ++GDG+ GY+++E+DTF RH + V+++VGNDA W+QI+REQVP  GS++ C L +T Y K A GLG +G L++REN  + ++ + ++A +  R G PV++N LIGR+DFR GS++V
Sbjct:  432 TFREKAAMPVAQHLNPVQVLQLVEET-LPDNSILVVDGGDFVGTAAHLVQPRGPLRWLDPGAFGTLGVGAGFALGAKLCRPDAEVWCLFGDGAFGYSLIEFDTFVRHKIPVMALVGNDAGWTQISREQVPSLGSNVACGLAYTDYHKAAMGLGARGLLLSRENEDQVVK-VLHDAQQQCRDGHPVVVNILIGRTDFRDGSIAV 632          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Celegans
Match: T26C12.1 (Acetolactate synthase-like protein [Source:UniProtKB/Swiss-Prot;Acc:O61856])

HSP 1 Score: 190.66 bits (483), Expect = 7.173e-54
Identity = 116/191 (60.73%), Postives = 138/191 (72.25%), Query Frame = 3
Query:  372 LNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKG-IPVLLNFLIGRSDFRQGSLSV 941
            LNPL  L+TLD   L  ++ILVADGGDFVGSAAYI+ PRGPL W DPGAFGTLGVGGGFALG K   P+  V+II+GDGS GY++MEYDTF RH + VI +VGNDACW+QIAREQVPMF S +   L  T Y+ VA+ LG  G  I+  N     R I +EAL   R G    L+N LIG++DFR+GS+SV
Sbjct:  452 LNPLNFLRTLDQ-SLPDDAILVADGGDFVGSAAYIVRPRGPLQWLDPGAFGTLGVGGGFALGAKTVYPKRPVYIIWGDGSCGYSLMEYDTFARHKLPVIGIVGNDACWTQIAREQVPMFQSSVAVDLARTRYDNVAKSLGSWGETIDESN-ADSARKILDEALAVCRSGEQSALVNVLIGKTDFREGSISV 640          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Zebrafish
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:393639])

HSP 1 Score: 232.646 bits (592), Expect = 2.001e-69
Identity = 127/201 (63.18%), Postives = 161/201 (80.10%), Query Frame = 3
Query:  339 RSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            R++     E +LNPL+VL  +D++ L ++SI+VADGGDFVGSAAYI+ PRGPL W DPGAFGTLGVGGGFALG KLC+PES+VWI+YGDGSLGYT+ E+DTFTRH   VI++VGNDACWSQI+REQVPM GS++ C L FT Y  VA+G GGKGYLI RE+    + +I  +A +  ++G  VLLN LIG+++FR+GS+SV
Sbjct:  423 RAKADEKTERHLNPLSVLHRVDEL-LAEDSIIVADGGDFVGSAAYIMRPRGPLCWLDPGAFGTLGVGGGFALGAKLCRPESEVWIVYGDGSLGYTVAEFDTFTRHKTPVIALVGNDACWSQISREQVPMLGSNVACGLAFTDYHVVADGYGGKGYLIGRED-ESQLEDIIKKAQKECKEGKAVLLNVLIGKTNFREGSISV 621          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Zebrafish
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:393639])

HSP 1 Score: 232.646 bits (592), Expect = 2.001e-69
Identity = 127/201 (63.18%), Postives = 161/201 (80.10%), Query Frame = 3
Query:  339 RSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            R++     E +LNPL+VL  +D++ L ++SI+VADGGDFVGSAAYI+ PRGPL W DPGAFGTLGVGGGFALG KLC+PES+VWI+YGDGSLGYT+ E+DTFTRH   VI++VGNDACWSQI+REQVPM GS++ C L FT Y  VA+G GGKGYLI RE+    + +I  +A +  ++G  VLLN LIG+++FR+GS+SV
Sbjct:  423 RAKADEKTERHLNPLSVLHRVDEL-LAEDSIIVADGGDFVGSAAYIMRPRGPLCWLDPGAFGTLGVGGGFALGAKLCRPESEVWIVYGDGSLGYTVAEFDTFTRHKTPVIALVGNDACWSQISREQVPMLGSNVACGLAFTDYHVVADGYGGKGYLIGRED-ESQLEDIIKKAQKECKEGKAVLLNVLIGKTNFREGSISV 621          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Xenopus
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:100145261])

HSP 1 Score: 224.942 bits (572), Expect = 1.207e-66
Identity = 124/209 (59.33%), Postives = 159/209 (76.08%), Query Frame = 3
Query:  315 IVKVLTNFRSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            + K  TN R +     E +LNPL VL  +DD  + ++SI+VADGGDFVGSAAYIL PRGPL W DPGAFGTLGVGGGFALG KLC+P+S+VWI++GDGSLGY+I+E+DT+TRH   VI++VGNDACW+QI+REQVPM GS++GC L ++ Y   AEG GG+G+L+  +   R I +I  EA E   KG   L+N LIG+++FR GS+SV
Sbjct:  383 VTKEKTN-RQKAEEKTERHLNPLKVLHLVDD-AMAEDSIIVADGGDFVGSAAYILRPRGPLCWLDPGAFGTLGVGGGFALGAKLCRPDSEVWIVFGDGSLGYSIVEFDTYTRHKTPVIALVGNDACWNQISREQVPMLGSNVGCSLAYSDYHVAAEGFGGRGFLVTTQEEER-ISDIIKEAQEACHKGKAALINVLIGKTNFRDGSISV 588          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Xenopus
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:100145261])

HSP 1 Score: 224.942 bits (572), Expect = 1.353e-66
Identity = 124/209 (59.33%), Postives = 159/209 (76.08%), Query Frame = 3
Query:  315 IVKVLTNFRSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            + K  TN R +     E +LNPL VL  +DD  + ++SI+VADGGDFVGSAAYIL PRGPL W DPGAFGTLGVGGGFALG KLC+P+S+VWI++GDGSLGY+I+E+DT+TRH   VI++VGNDACW+QI+REQVPM GS++GC L ++ Y   AEG GG+G+L+  +   R I +I  EA E   KG   L+N LIG+++FR GS+SV
Sbjct:  384 VTKEKTN-RQKAEEKTERHLNPLKVLHLVDD-AMAEDSIIVADGGDFVGSAAYILRPRGPLCWLDPGAFGTLGVGGGFALGAKLCRPDSEVWIVFGDGSLGYSIVEFDTYTRHKTPVIALVGNDACWNQISREQVPMLGSNVGCSLAYSDYHVAAEGFGGRGFLVTTQEEER-ISDIIKEAQEACHKGKAALINVLIGKTNFRDGSISV 589          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Xenopus
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:100145261])

HSP 1 Score: 224.942 bits (572), Expect = 1.925e-66
Identity = 124/209 (59.33%), Postives = 159/209 (76.08%), Query Frame = 3
Query:  315 IVKVLTNFRSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            + K  TN R +     E +LNPL VL  +DD  + ++SI+VADGGDFVGSAAYIL PRGPL W DPGAFGTLGVGGGFALG KLC+P+S+VWI++GDGSLGY+I+E+DT+TRH   VI++VGNDACW+QI+REQVPM GS++GC L ++ Y   AEG GG+G+L+  +   R I +I  EA E   KG   L+N LIG+++FR GS+SV
Sbjct:  399 VTKEKTN-RQKAEEKTERHLNPLKVLHLVDD-AMAEDSIIVADGGDFVGSAAYILRPRGPLCWLDPGAFGTLGVGGGFALGAKLCRPDSEVWIVFGDGSLGYSIVEFDTYTRHKTPVIALVGNDACWNQISREQVPMLGSNVGCSLAYSDYHVAAEGFGGRGFLVTTQEEER-ISDIIKEAQEACHKGKAALINVLIGKTNFRDGSISV 604          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Xenopus
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:100145261])

HSP 1 Score: 224.557 bits (571), Expect = 2.277e-66
Identity = 124/209 (59.33%), Postives = 159/209 (76.08%), Query Frame = 3
Query:  315 IVKVLTNFRSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            + K  TN R +     E +LNPL VL  +DD  + ++SI+VADGGDFVGSAAYIL PRGPL W DPGAFGTLGVGGGFALG KLC+P+S+VWI++GDGSLGY+I+E+DT+TRH   VI++VGNDACW+QI+REQVPM GS++GC L ++ Y   AEG GG+G+L+  +   R I +I  EA E   KG   L+N LIG+++FR GS+SV
Sbjct:  398 VTKEKTN-RQKAEEKTERHLNPLKVLHLVDD-AMAEDSIIVADGGDFVGSAAYILRPRGPLCWLDPGAFGTLGVGGGFALGAKLCRPDSEVWIVFGDGSLGYSIVEFDTYTRHKTPVIALVGNDACWNQISREQVPMLGSNVGCSLAYSDYHVAAEGFGGRGFLVTTQEEER-ISDIIKEAQEACHKGKAALINVLIGKTNFRDGSISV 603          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Xenopus
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:100145261])

HSP 1 Score: 224.557 bits (571), Expect = 2.297e-66
Identity = 124/209 (59.33%), Postives = 159/209 (76.08%), Query Frame = 3
Query:  315 IVKVLTNFRSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            + K  TN R +     E +LNPL VL  +DD  + ++SI+VADGGDFVGSAAYIL PRGPL W DPGAFGTLGVGGGFALG KLC+P+S+VWI++GDGSLGY+I+E+DT+TRH   VI++VGNDACW+QI+REQVPM GS++GC L ++ Y   AEG GG+G+L+  +   R I +I  EA E   KG   L+N LIG+++FR GS+SV
Sbjct:  389 VTKEKTN-RQKAEEKTERHLNPLKVLHLVDD-AMAEDSIIVADGGDFVGSAAYILRPRGPLCWLDPGAFGTLGVGGGFALGAKLCRPDSEVWIVFGDGSLGYSIVEFDTYTRHKTPVIALVGNDACWNQISREQVPMLGSNVGCSLAYSDYHVAAEGFGGRGFLVTTQEEER-ISDIIKEAQEACHKGKAALINVLIGKTNFRDGSISV 594          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Mouse
Match: Ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:MGI Symbol;Acc:MGI:1351911])

HSP 1 Score: 195.282 bits (495), Expect = 2.485e-55
Identity = 106/198 (53.54%), Postives = 149/198 (75.25%), Query Frame = 3
Query:  351 SFIPEL-NLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            + +P L +LNP+ VLQ +++  L   ++LV DGGDFV +AAY++ PRGPL W DPGAFGTLGVG GFALG KLC+PE++VW ++GDG+ GY+++E+DTF RH V VI++VGNDA W+QI+REQVP  GSD+ C L +T Y K A GLG +G +++R+N  + ++ +  E  +  + G  V++N LIGR+DFR GS+SV
Sbjct:  437 ALMPVLQHLNPVWVLQQVEET-LPDNALLVVDGGDFVATAAYLVQPRGPLRWLDPGAFGTLGVGAGFALGAKLCQPEAEVWCLFGDGAFGYSLIEFDTFVRHKVPVIALVGNDAGWTQISREQVPRLGSDVACSLAYTDYHKAAMGLGAQGLILSRDNKDQVVK-VLREGQQLCQDGHAVVVNILIGRTDFRDGSISV 632          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Mouse
Match: Ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:MGI Symbol;Acc:MGI:1351911])

HSP 1 Score: 195.282 bits (495), Expect = 2.485e-55
Identity = 106/198 (53.54%), Postives = 149/198 (75.25%), Query Frame = 3
Query:  351 SFIPEL-NLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            + +P L +LNP+ VLQ +++  L   ++LV DGGDFV +AAY++ PRGPL W DPGAFGTLGVG GFALG KLC+PE++VW ++GDG+ GY+++E+DTF RH V VI++VGNDA W+QI+REQVP  GSD+ C L +T Y K A GLG +G +++R+N  + ++ +  E  +  + G  V++N LIGR+DFR GS+SV
Sbjct:  437 ALMPVLQHLNPVWVLQQVEET-LPDNALLVVDGGDFVATAAYLVQPRGPLRWLDPGAFGTLGVGAGFALGAKLCQPEAEVWCLFGDGAFGYSLIEFDTFVRHKVPVIALVGNDAGWTQISREQVPRLGSDVACSLAYTDYHKAAMGLGAQGLILSRDNKDQVVK-VLREGQQLCQDGHAVVVNILIGRTDFRDGSISV 632          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Mouse
Match: Ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:MGI Symbol;Acc:MGI:1351911])

HSP 1 Score: 149.443 bits (376), Expect = 6.890e-39
Identity = 82/138 (59.42%), Postives = 110/138 (79.71%), Query Frame = 3
Query:  351 SFIPEL-NLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFT 761
            + +P L +LNP+ VLQ +++  L   ++LV DGGDFV +AAY++ PRGPL W DPGAFGTLGVG GFALG KLC+PE++VW ++GDG+ GY+++E+DTF RH V VI++VGNDA W+QI+REQVP  GSD+ C L +T
Sbjct:  437 ALMPVLQHLNPVWVLQQVEET-LPDNALLVVDGGDFVATAAYLVQPRGPLRWLDPGAFGTLGVGAGFALGAKLCQPEAEVWCLFGDGAFGYSLIEFDTFVRHKVPVIALVGNDAGWTQISREQVPRLGSDVACSLAYT 573          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Mouse
Match: Ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:MGI Symbol;Acc:MGI:1351911])

HSP 1 Score: 67.0106 bits (162), Expect = 2.252e-11
Identity = 48/80 (60.00%), Postives = 63/80 (78.75%), Query Frame = 3
Query:  351 SFIPEL-NLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDV 587
            + +P L +LNP+ VLQ +++  L   ++LV DGGDFV +AAY++ PRGPL W DPGAFGTLGVG GFALG KLC+PE++V
Sbjct:  437 ALMPVLQHLNPVWVLQQVEET-LPDNALLVVDGGDFVATAAYLVQPRGPLRWLDPGAFGTLGVGAGFALGAKLCQPEAEV 515          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Mouse
Match: Hacl1 (2-hydroxyacyl-CoA lyase 1 [Source:MGI Symbol;Acc:MGI:1929657])

HSP 1 Score: 51.6026 bits (122), Expect = 1.503e-6
Identity = 34/129 (26.36%), Postives = 58/129 (44.96%), Query Frame = 3
Query:  573 PESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDA---------CWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGS 932
            P   V  + GD + G++ ME +T  R+ + +I +V N+           W ++   Q         C L  + YE+V    GGKGY +     P ++++   +AL+ + K  P LLN +I     R+  
Sbjct:  448 PGQRVICVEGDSAFGFSGMEVETICRYNLPIILLVVNNNGIYQGFDADTWEKMLHFQEAATTVPPMCLLPNSHYEQVMTAFGGKGYFVRT---PEELQHSLRQALQDTSK--PCLLNIMIEPQSTRKAQ 571          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. UniProt/SwissProt
Match: sp|Q6NV04|HACL2_DANRE (2-hydroxyacyl-CoA lyase 2 OS=Danio rerio OX=7955 GN=ilvbl PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.510e-68
Identity = 127/201 (63.18%), Postives = 161/201 (80.10%), Query Frame = 3
Query:  339 RSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            R++     E +LNPL+VL  +D++ L ++SI+VADGGDFVGSAAYI+ PRGPL W DPGAFGTLGVGGGFALG KLC+PES+VWI+YGDGSLGYT+ E+DTFTRH   VI++VGNDACWSQI+REQVPM GS++ C L FT Y  VA+G GGKGYLI RE+    + +I  +A +  ++G  VLLN LIG+++FR+GS+SV
Sbjct:  423 RAKADEKTERHLNPLSVLHRVDEL-LAEDSIIVADGGDFVGSAAYIMRPRGPLCWLDPGAFGTLGVGGGFALGAKLCRPESEVWIVYGDGSLGYTVAEFDTFTRHKTPVIALVGNDACWSQISREQVPMLGSNVACGLAFTDYHVVADGYGGKGYLIGRED-ESQLEDIIKKAQKECKEGKAVLLNVLIGKTNFREGSISV 621          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. UniProt/SwissProt
Match: sp|A1L0T0|HACL2_HUMAN (2-hydroxyacyl-CoA lyase 2 OS=Homo sapiens OX=9606 GN=ILVBL PE=1 SV=2)

HSP 1 Score: 203.756 bits (517), Expect = 1.347e-57
Identity = 107/203 (52.71%), Postives = 153/203 (75.37%), Query Frame = 3
Query:  333 NFRSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
             FR + +     +LNP+ VLQ +++  L   SILV DGGDFVG+AA+++ PRGPL W DPGAFGTLGVG GFALG KLC+P+++VW ++GDG+ GY+++E+DTF RH + V+++VGNDA W+QI+REQVP  GS++ C L +T Y K A GLG +G L++REN  + ++ + ++A +  R G PV++N LIGR+DFR GS++V
Sbjct:  432 TFREKAAMPVAQHLNPVQVLQLVEET-LPDNSILVVDGGDFVGTAAHLVQPRGPLRWLDPGAFGTLGVGAGFALGAKLCRPDAEVWCLFGDGAFGYSLIEFDTFVRHKIPVMALVGNDAGWTQISREQVPSLGSNVACGLAYTDYHKAAMGLGARGLLLSRENEDQVVK-VLHDAQQQCRDGHPVVVNILIGRTDFRDGSIAV 632          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. UniProt/SwissProt
Match: sp|A6QQT9|HACL2_BOVIN (2-hydroxyacyl-CoA lyase 2 OS=Bos taurus OX=9913 GN=ILVBL PE=2 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 1.072e-56
Identity = 106/202 (52.48%), Postives = 152/202 (75.25%), Query Frame = 3
Query:  336 FRSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            FR +       +LNP+ VLQ ++D  L   SILV DGGDFVG+AAY++ PRGPL W DPGAFGTLGVG GFALG KLC+P+++VW ++GDG+ GY+++E+DTF RH + V++++GNDA W+QI+REQVP  GS++ C L +T Y K A+GLG +G L++REN  + ++ +  +A +  + G PV++N LIGR+DFR GS+++
Sbjct:  433 FREKALMPVAQHLNPVRVLQLVEDT-LPDNSILVVDGGDFVGTAAYLVQPRGPLRWLDPGAFGTLGVGAGFALGAKLCRPDAEVWCLFGDGAFGYSLIEFDTFVRHKIPVMALIGNDAGWTQISREQVPSLGSNVACGLAYTDYHKAAQGLGAQGLLLSRENEDQVVK-VLRDAQQWCQDGHPVVVNILIGRTDFRDGSIAM 632          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. UniProt/SwissProt
Match: sp|Q8BU33|HACL2_MOUSE (2-hydroxyacyl-CoA lyase 2 OS=Mus musculus OX=10090 GN=Ilvbl PE=1 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.738e-54
Identity = 106/198 (53.54%), Postives = 149/198 (75.25%), Query Frame = 3
Query:  351 SFIPEL-NLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            + +P L +LNP+ VLQ +++  L   ++LV DGGDFV +AAY++ PRGPL W DPGAFGTLGVG GFALG KLC+PE++VW ++GDG+ GY+++E+DTF RH V VI++VGNDA W+QI+REQVP  GSD+ C L +T Y K A GLG +G +++R+N  + ++ +  E  +  + G  V++N LIGR+DFR GS+SV
Sbjct:  437 ALMPVLQHLNPVWVLQQVEET-LPDNALLVVDGGDFVATAAYLVQPRGPLRWLDPGAFGTLGVGAGFALGAKLCQPEAEVWCLFGDGAFGYSLIEFDTFVRHKVPVIALVGNDAGWTQISREQVPRLGSDVACSLAYTDYHKAAMGLGAQGLILSRDNKDQVVK-VLREGQQLCQDGHAVVVNILIGRTDFRDGSISV 632          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. UniProt/SwissProt
Match: sp|O61856|HACL2_CAEEL (2-hydroxyacyl-CoA lyase 2 OS=Caenorhabditis elegans OX=6239 GN=T26C12.1 PE=3 SV=2)

HSP 1 Score: 190.66 bits (483), Expect = 9.124e-53
Identity = 116/191 (60.73%), Postives = 138/191 (72.25%), Query Frame = 3
Query:  372 LNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKG-IPVLLNFLIGRSDFRQGSLSV 941
            LNPL  L+TLD   L  ++ILVADGGDFVGSAAYI+ PRGPL W DPGAFGTLGVGGGFALG K   P+  V+II+GDGS GY++MEYDTF RH + VI +VGNDACW+QIAREQVPMF S +   L  T Y+ VA+ LG  G  I+  N     R I +EAL   R G    L+N LIG++DFR+GS+SV
Sbjct:  452 LNPLNFLRTLDQ-SLPDDAILVADGGDFVGSAAYIVRPRGPLQWLDPGAFGTLGVGGGFALGAKTVYPKRPVYIIWGDGSCGYSLMEYDTFARHKLPVIGIVGNDACWTQIAREQVPMFQSSVAVDLARTRYDNVAKSLGSWGETIDESN-ADSARKILDEALAVCRSGEQSALVNVLIGKTDFREGSISV 640          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. TrEMBL
Match: A0A0S7JTQ2 (ILVBL (Fragment) OS=Poeciliopsis prolifica OX=188132 GN=ILVBL PE=4 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 2.911e-70
Identity = 124/201 (61.69%), Postives = 160/201 (79.60%), Query Frame = 3
Query:  339 RSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            R++ +   E +LNPL VL  +D++ + ++SI+VADGGDFVGSAAYI+ PRGPL W DPGAFGTLGVGGGFALG KLC+PE++VWI+YGDGSLGY++ EYDTFTRH   VISVVGNDACWSQI+REQVP+ GS++ C L FT Y  VA+G GGKGYL+ RE+    + +I  +A   +++G   LLN LIG+++FR+GS+SV
Sbjct:   21 RAKANEKTEHHLNPLKVLHCVDEL-MAEDSIIVADGGDFVGSAAYIMRPRGPLRWLDPGAFGTLGVGGGFALGAKLCRPEAEVWIVYGDGSLGYSVAEYDTFTRHKTPVISVVGNDACWSQISREQVPILGSNVACGLAFTDYHTVADGYGGKGYLVRRED-ENQLSDIIKQAQRDAKEGKATLLNVLIGKTNFREGSISV 219          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. TrEMBL
Match: A0A0S7JSP5 (ILVBL OS=Poeciliopsis prolifica OX=188132 GN=ILVBL PE=4 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 2.403e-69
Identity = 124/201 (61.69%), Postives = 160/201 (79.60%), Query Frame = 3
Query:  339 RSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            R++ +   E +LNPL VL  +D++ + ++SI+VADGGDFVGSAAYI+ PRGPL W DPGAFGTLGVGGGFALG KLC+PE++VWI+YGDGSLGY++ EYDTFTRH   VISVVGNDACWSQI+REQVP+ GS++ C L FT Y  VA+G GGKGYL+ RE+    + +I  +A   +++G   LLN LIG+++FR+GS+SV
Sbjct:   50 RAKANEKTEHHLNPLKVLHCVDEL-MAEDSIIVADGGDFVGSAAYIMRPRGPLRWLDPGAFGTLGVGGGFALGAKLCRPEAEVWIVYGDGSLGYSVAEYDTFTRHKTPVISVVGNDACWSQISREQVPILGSNVACGLAFTDYHTVADGYGGKGYLVRRED-ENQLSDIIKQAQRDAKEGKATLLNVLIGKTNFREGSISV 248          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. TrEMBL
Match: A0A0S7JS90 (ILVBL OS=Poeciliopsis prolifica OX=188132 GN=ILVBL PE=4 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 3.013e-69
Identity = 124/201 (61.69%), Postives = 160/201 (79.60%), Query Frame = 3
Query:  339 RSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            R++ +   E +LNPL VL  +D++ + ++SI+VADGGDFVGSAAYI+ PRGPL W DPGAFGTLGVGGGFALG KLC+PE++VWI+YGDGSLGY++ EYDTFTRH   VISVVGNDACWSQI+REQVP+ GS++ C L FT Y  VA+G GGKGYL+ RE+    + +I  +A   +++G   LLN LIG+++FR+GS+SV
Sbjct:   49 RAKANEKTEHHLNPLKVLHCVDEL-MAEDSIIVADGGDFVGSAAYIMRPRGPLRWLDPGAFGTLGVGGGFALGAKLCRPEAEVWIVYGDGSLGYSVAEYDTFTRHKTPVISVVGNDACWSQISREQVPILGSNVACGLAFTDYHTVADGYGGKGYLVRRED-ENQLSDIIKQAQRDAKEGKATLLNVLIGKTNFREGSISV 247          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. TrEMBL
Match: A0A2B4RGW4 (Acetolactate synthase-like protein OS=Stylophora pistillata OX=50429 GN=ilvbl PE=3 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.473e-67
Identity = 130/191 (68.06%), Postives = 159/191 (83.25%), Query Frame = 3
Query:  369 NLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            +LNPL +L  L++I ++ +SI+VADGGDFVG+AAYIL PRGPLTW DPGAFGTLGVGGGFALG KLC+PES+VWIIYGDGSLGY++ E+DTFTRH   VI++VGNDACWSQIAREQVPMFGS IGC L+FT Y  VAEG GGKG+L+ R++   +I    ++A E +R G  VL+N LIG++DFRQGS+SV
Sbjct:  406 HLNPLKLLFNLENI-MSSDSIIVADGGDFVGTAAYILRPRGPLTWLDPGAFGTLGVGGGFALGAKLCRPESEVWIIYGDGSLGYSVAEFDTFTRHKTPVIALVGNDACWSQIAREQVPMFGSSIGCDLEFTDYHNVAEGYGGKGFLL-RDSSTGEIDKTLSKAQEVARDGTAVLINALIGKTDFRQGSISV 594          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. TrEMBL
Match: H3BDZ6 (IlvB acetolactate synthase like OS=Latimeria chalumnae OX=7897 GN=ILVBL PE=3 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 7.423e-67
Identity = 127/193 (65.80%), Postives = 157/193 (81.35%), Query Frame = 3
Query:  363 ELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            E +LNPL VL  ++D+ + ++SI+V DGGDFVGSAAYIL PRGPL W DPGAFGTLGVGGGFALG KLC+PES+VWIIYGDGSLGY++ E+DTFTRH   VI+VVGNDACWSQI+REQVPM GS++ C L +T Y  VA+G GGKGYL+ RE+  + + N+  +A E  +KG  VL+N LIGR+DFR+GS+SV
Sbjct:  440 ERHLNPLKVLHRIEDL-MAEDSIIVTDGGDFVGSAAYILKPRGPLRWLDPGAFGTLGVGGGFALGAKLCRPESEVWIIYGDGSLGYSVAEFDTFTRHKTPVIAVVGNDACWSQISREQVPMLGSNVACSLAYTDYHIVADGYGGKGYLLKREDEAQ-MDNVIGKAQEECKKGTAVLVNVLIGRTDFREGSISV 630          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Cavefish
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:393639])

HSP 1 Score: 226.483 bits (576), Expect = 2.782e-67
Identity = 123/201 (61.19%), Postives = 159/201 (79.10%), Query Frame = 3
Query:  339 RSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            R++     E +LNPL+VLQ +D++ + ++SI+VADGGDFVGSAAYI+ PRGPL W DPGAFGTLGVGGGFALG KLC P+S+VW++YGDGSLGY++ E+DTFTRH   VI++VGNDACWSQI+REQVP+ GS++ C L FT Y  VA+G GGKG+LI RE+    + +I  EA    ++G  VLLN LIG+++FR GS+SV
Sbjct:  400 RAKAEEKTERHLNPLSVLQRVDEL-MAEDSIIVADGGDFVGSAAYIMRPRGPLCWLDPGAFGTLGVGGGFALGAKLCHPDSEVWVVYGDGSLGYSVAEFDTFTRHKTPVIALVGNDACWSQISREQVPILGSNVACGLAFTDYHVVAQGYGGKGHLIGRED-ESQLEDIVKEAQRECKEGQAVLLNVLIGKTNFRDGSISV 598          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Cavefish
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:393639])

HSP 1 Score: 226.098 bits (575), Expect = 5.063e-67
Identity = 123/201 (61.19%), Postives = 159/201 (79.10%), Query Frame = 3
Query:  339 RSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            R++     E +LNPL+VLQ +D++ + ++SI+VADGGDFVGSAAYI+ PRGPL W DPGAFGTLGVGGGFALG KLC P+S+VW++YGDGSLGY++ E+DTFTRH   VI++VGNDACWSQI+REQVP+ GS++ C L FT Y  VA+G GGKG+LI RE+    + +I  EA    ++G  VLLN LIG+++FR GS+SV
Sbjct:  423 RAKAEEKTERHLNPLSVLQRVDEL-MAEDSIIVADGGDFVGSAAYIMRPRGPLCWLDPGAFGTLGVGGGFALGAKLCHPDSEVWVVYGDGSLGYSVAEFDTFTRHKTPVIALVGNDACWSQISREQVPILGSNVACGLAFTDYHVVAQGYGGKGHLIGRED-ESQLEDIVKEAQRECKEGQAVLLNVLIGKTNFRDGSISV 621          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Cavefish
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:393639])

HSP 1 Score: 226.098 bits (575), Expect = 5.920e-67
Identity = 123/201 (61.19%), Postives = 159/201 (79.10%), Query Frame = 3
Query:  339 RSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            R++     E +LNPL+VLQ +D++ + ++SI+VADGGDFVGSAAYI+ PRGPL W DPGAFGTLGVGGGFALG KLC P+S+VW++YGDGSLGY++ E+DTFTRH   VI++VGNDACWSQI+REQVP+ GS++ C L FT Y  VA+G GGKG+LI RE+    + +I  EA    ++G  VLLN LIG+++FR GS+SV
Sbjct:  423 RAKAEEKTERHLNPLSVLQRVDEL-MAEDSIIVADGGDFVGSAAYIMRPRGPLCWLDPGAFGTLGVGGGFALGAKLCHPDSEVWVVYGDGSLGYSVAEFDTFTRHKTPVIALVGNDACWSQISREQVPILGSNVACGLAFTDYHVVAQGYGGKGHLIGRED-ESQLEDIVKEAQRECKEGQAVLLNVLIGKTNFRDGSISV 621          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Sea Lamprey
Match: ilvbl (ilvB (bacterial acetolactate synthase)-like [Source:NCBI gene;Acc:393639])

HSP 1 Score: 206.453 bits (524), Expect = 3.810e-60
Identity = 119/191 (62.30%), Postives = 148/191 (77.49%), Query Frame = 3
Query:  369 NLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            +LNPL VL  LDD+      I VADGGDFVGSAAYIL PRGPL W DPGAFGTLGVGGGFALG KLC+P+S+VWIIYGDGSLG+++ E+DTFTRH + +I++VGNDACWSQIAREQVPM GS++ C L FT Y  VA+GLG +G+L+ +E     I  +   A   S++G   L+N LIG+++FR+GS+SV
Sbjct:  446 HLNPLKVLHRLDDLLADDSLI-VADGGDFVGSAAYILRPRGPLCWLDPGAFGTLGVGGGFALGAKLCRPDSEVWIIYGDGSLGFSMAEFDTFTRHKLPIIALVGNDACWSQIAREQVPMLGSNVACGLAFTDYHVVADGLGARGFLLGKEK-ESQIDEVIKAAQAESKQGRSSLINTLIGKTNFREGSISV 634          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Nematostella
Match: EDO32896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STP8])

HSP 1 Score: 221.476 bits (563), Expect = 5.718e-66
Identity = 123/204 (60.29%), Postives = 165/204 (80.88%), Query Frame = 3
Query:  330 TNFRSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            ++ R +   +P  +LNP+ +L  ++ + ++K+S++VADGGDFVG+AAYIL PR PL+W DPGAFGTLGVGGGFALG KLC+P+SDVW++YGDGSLGY+I E+DTF RH   VI++VGNDACWSQIAREQVP+FGS I C L++T+YE+VAEG GG G  +   +  R+I++I ++A E SR+G PVL+N LIG+S FR+GS+SV
Sbjct:  386 SDNRLKAEEVPAQHLNPMKLLNIVEQV-MSKDSVIVADGGDFVGTAAYILRPRAPLSWLDPGAFGTLGVGGGFALGAKLCRPDSDVWVMYGDGSLGYSIAEFDTFVRHKTPVIALVGNDACWSQIAREQVPLFGSSIACDLEYTNYEQVAEGYGGYGLKLGASS-EREIKDILSKAQEVSRQGKPVLINALIGKSTFREGSISV 587          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Medaka
Match: ilvbl (ilvB acetolactate synthase like [Source:NCBI gene;Acc:101163679])

HSP 1 Score: 228.409 bits (581), Expect = 3.398e-68
Identity = 122/201 (60.70%), Postives = 161/201 (80.10%), Query Frame = 3
Query:  339 RSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            R++     E +LNP+ VL  +D++ + ++SI+VADGGDFVG+AAYI+ PRGPL W DPGAFGTLGVGGGFALG KLC+PES+VWIIYGDGSLGY++ E+DTFTRH   V+++VGNDACWSQI+REQVP+ GS++ C L FT Y  VA+G GGKGYL+ RE   R +R+I  +A + +++G   LLN LIG+++FR+GS+SV
Sbjct:  383 RAKADEKTERHLNPIKVLHCVDEL-MAEDSIIVADGGDFVGTAAYIMRPRGPLRWLDPGAFGTLGVGGGFALGAKLCRPESEVWIIYGDGSLGYSVAEFDTFTRHKTPVLALVGNDACWSQISREQVPILGSNVACGLAFTDYHVVADGYGGKGYLVGREEESR-LRDIIKQAQKETKEGKATLLNVLIGKTNFREGSISV 581          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Medaka
Match: ilvbl (ilvB acetolactate synthase like [Source:NCBI gene;Acc:101163679])

HSP 1 Score: 228.024 bits (580), Expect = 1.067e-67
Identity = 122/201 (60.70%), Postives = 161/201 (80.10%), Query Frame = 3
Query:  339 RSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            R++     E +LNP+ VL  +D++ + ++SI+VADGGDFVG+AAYI+ PRGPL W DPGAFGTLGVGGGFALG KLC+PES+VWIIYGDGSLGY++ E+DTFTRH   V+++VGNDACWSQI+REQVP+ GS++ C L FT Y  VA+G GGKGYL+ RE   R +R+I  +A + +++G   LLN LIG+++FR+GS+SV
Sbjct:  428 RAKADEKTERHLNPIKVLHCVDEL-MAEDSIIVADGGDFVGTAAYIMRPRGPLRWLDPGAFGTLGVGGGFALGAKLCRPESEVWIIYGDGSLGYSVAEFDTFTRHKTPVLALVGNDACWSQISREQVPILGSNVACGLAFTDYHVVADGYGGKGYLVGREEESR-LRDIIKQAQKETKEGKATLLNVLIGKTNFREGSISV 626          
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Planmine SMEST
Match: SMESG000026596.1 (SMESG000026596.1)

HSP 1 Score: 376.711 bits (966), Expect = 6.704e-125
Identity = 199/201 (99.00%), Postives = 201/201 (100.00%), Query Frame = 3
Query:  339 RSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPXXXXXXXXXXXXXXXIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 941
            +SRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPGAFGTLGVGGGFALGIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINR+NFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV
Sbjct:  426 KSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGGDFVGSAAYILHPRGPLTWFDPGAFGTLGVGGGFALGIKLCKPESDVWIIYGDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQLDFTSYEKVAEGLGGKGYLINRDNFPRDIRNIFNEALETSRKGIPVLLNFLIGRSDFRQGSLSV 626          
The following BLAST results are available for this feature:
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ILVBL6.236e-5952.71ilvB acetolactate synthase like [Source:HGNC Symbo... [more]
ILVBL2.804e-5852.71ilvB acetolactate synthase like [Source:HGNC Symbo... [more]
back to top
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T26C12.17.173e-5460.73Acetolactate synthase-like protein [Source:UniPro... [more]
back to top
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ilvbl2.001e-6963.18ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
ilvbl2.001e-6963.18ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
back to top
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ilvbl1.207e-6659.33ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
ilvbl1.353e-6659.33ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
ilvbl1.925e-6659.33ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
ilvbl2.277e-6659.33ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
ilvbl2.297e-6659.33ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
back to top
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ilvbl2.485e-5553.54ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
Ilvbl2.485e-5553.54ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
Ilvbl6.890e-3959.42ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
Ilvbl2.252e-1160.00ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
Hacl11.503e-626.362-hydroxyacyl-CoA lyase 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of IlvB (bacterial acetolactate synthase)-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NV04|HACL2_DANRE1.510e-6863.182-hydroxyacyl-CoA lyase 2 OS=Danio rerio OX=7955 G... [more]
sp|A1L0T0|HACL2_HUMAN1.347e-5752.712-hydroxyacyl-CoA lyase 2 OS=Homo sapiens OX=9606 ... [more]
sp|A6QQT9|HACL2_BOVIN1.072e-5652.482-hydroxyacyl-CoA lyase 2 OS=Bos taurus OX=9913 GN... [more]
sp|Q8BU33|HACL2_MOUSE1.738e-5453.542-hydroxyacyl-CoA lyase 2 OS=Mus musculus OX=10090... [more]
sp|O61856|HACL2_CAEEL9.124e-5360.732-hydroxyacyl-CoA lyase 2 OS=Caenorhabditis elegan... [more]
back to top
BLAST of IlvB (bacterial acetolactate synthase)-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0S7JTQ22.911e-7061.69ILVBL (Fragment) OS=Poeciliopsis prolifica OX=1881... [more]
A0A0S7JSP52.403e-6961.69ILVBL OS=Poeciliopsis prolifica OX=188132 GN=ILVBL... [more]
A0A0S7JS903.013e-6961.69ILVBL OS=Poeciliopsis prolifica OX=188132 GN=ILVBL... [more]
A0A2B4RGW41.473e-6768.06Acetolactate synthase-like protein OS=Stylophora p... [more]
H3BDZ67.423e-6765.80IlvB acetolactate synthase like OS=Latimeria chalu... [more]
back to top
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ilvbl2.782e-6761.19ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
ilvbl5.063e-6761.19ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
ilvbl5.920e-6761.19ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
back to top
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ilvbl3.810e-6062.30ilvB (bacterial acetolactate synthase)-like [Sourc... [more]
back to top
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO328965.718e-6660.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ilvbl3.398e-6860.70ilvB acetolactate synthase like [Source:NCBI gene;... [more]
ilvbl1.067e-6760.70ilvB acetolactate synthase like [Source:NCBI gene;... [more]
back to top
BLAST of IlvB (bacterial acetolactate synthase)-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000026596.16.704e-12599.00SMESG000026596.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007199 ID=SMED30007199|Name=IlvB (bacterial acetolactate synthase)-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1364bp
GAATTGCGCTGTTTCGAGATGCGTTGCGATTTATTGTAGCGCATTAACGA
CGCAACTCGAGGCTCTAGTGTATGTGTAATTATTTAGTATTCGGATAAAT
TAAAATTATTATATTGTGTTCAATTTATTGATTTTTAGAGTAGGGATAGG
AATCGTTAATAACCAAACACGTAATACTGCTAGGTATTAGCTTGGATTGG
CCATGTGTGAGGCAGGCATATAATGTGATTGGATATATATGGTCTGTATT
GGTCAGGGAAACACAAGATTGCGTGATATAATTATAAGTGTAGATCTTCA
TGGCTGATATGTTTATTGTAAAGGTTTTGACTAATTTCAGATCGAGATTG
TCCTTTATTCCTGAACTTAACCTCAATCCATTGACAGTATTACAGACGTT
AGATGATATCGGTTTAACAAAGGAGTCTATTCTTGTGGCAGACGGTGGGG
ATTTCGTTGGGTCAGCAGCATATATTTTGCATCCCAGGGGACCTTTAACT
TGGTTCGATCCAGGAGCGTTCGGCACTCTTGGAGTTGGTGGAGGTTTCGC
ACTTGGTATTAAGTTATGCAAACCAGAAAGTGACGTGTGGATAATCTATG
GGGATGGCTCACTGGGGTACACCATAATGGAATATGACACCTTCACTCGA
CATGGAGTAGGTGTGATATCTGTGGTAGGCAATGACGCCTGTTGGTCACA
AATAGCTCGAGAACAAGTTCCCATGTTTGGCAGTGATATTGGTTGTCAAC
TTGATTTCACAAGCTATGAGAAAGTTGCCGAAGGATTAGGTGGTAAGGGC
TATCTGATTAATCGTGAAAATTTCCCGCGTGATATTCGAAACATTTTCAA
TGAAGCTCTCGAAACGTCTCGAAAAGGTATTCCAGTCTTGCTCAATTTTC
TTATTGGTCGAAGTGATTTCCGACAAGGAAGTTTGTCGGTGTGAATTTTA
GTGGAAGAAAATTACTGATTCACATAGAATATTTTATTAGCTAAATAAAT
TCATTTTGTATTGAAGTTTTGATGGTGGTGGAGTCGCAATTCTGTAGGCT
GTTGGTAATATACTTAGACGGATAGAGGCTTTTCAGGTCATACTCACCTT
TATTTGAAAGAATTATCAAGTAGAAATTACATGAACAAGACTATCTAAAT
AGTATCTAATTAATAGTTGATTATTTGTTGTTATTATCGATTATCGATTC
TTAATAATTCTGAGTGATGGTTTTAATGATTTCGTTGGTTTATAATTGTT
AATAATATTGTTTGTTATTGTTGGTTAGTGATTGTCTACTATTTATTAAG
GCCACATCTAGTCTAGATTTCTCGATATCCAGTGTCTCAGCTTGATTTTT
GTTCACTGAAATTT
back to top

protein sequence of SMED30007199-orf-1

>SMED30007199-orf-1 ID=SMED30007199-orf-1|Name=SMED30007199-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=215bp
MADMFIVKVLTNFRSRLSFIPELNLNPLTVLQTLDDIGLTKESILVADGG
DFVGSAAYILHPRGPLTWFDPGAFGTLGVGGGFALGIKLCKPESDVWIIY
GDGSLGYTIMEYDTFTRHGVGVISVVGNDACWSQIAREQVPMFGSDIGCQ
LDFTSYEKVAEGLGGKGYLINRENFPRDIRNIFNEALETSRKGIPVLLNF
LIGRSDFRQGSLSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029061THDP-binding
IPR011766TPP_enzyme-bd_C
IPR000399TPP-bd_CS
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0030976thiamine pyrophosphate binding
GO:0000287magnesium ion binding
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0048701embryonic cranial skeleton morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011766Thiamine pyrophosphate enzyme, C-terminal TPP-bindingPFAMPF02775TPP_enzyme_Ccoord: 45..194
e-value: 6.8E-26
score: 90.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.970coord: 15..207
e-value: 3.3E-41
score: 142.7
NoneNo IPR availablePANTHERPTHR18968:SF155ACETOLACTATE SYNTHASE-LIKE PROTEINcoord: 19..203
NoneNo IPR availablePANTHERPTHR18968THIAMINE PYROPHOSPHATE ENZYMEScoord: 19..203
NoneNo IPR availableCDDcd02004TPP_BZL_OCoD_HPCLcoord: 24..199
e-value: 7.85865E-66
score: 198.525
IPR000399TPP-binding enzyme, conserved sitePROSITEPS00187TPP_ENZYMEScoord: 82..101
IPR029061Thiamin diphosphate-binding foldSUPERFAMILYSSF52518Thiamin diphosphate-binding fold (THDP-binding)coord: 22..204