Double zinc ribbon and ankyrin repeat-containing protein 1

Overview
NameDouble zinc ribbon and ankyrin repeat-containing protein 1
Smed IDSMED30007189
Length (bp)2545
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Double zinc ribbon and ankyrin repeat-containing protein 1 (SMED30007189) t-SNE clustered cells

Violin plots show distribution of expression levels for Double zinc ribbon and ankyrin repeat-containing protein 1 (SMED30007189) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Double zinc ribbon and ankyrin repeat-containing protein 1 (SMED30007189) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Double zinc ribbon and ankyrin repeat-containing protein 1 (SMED30007189) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007189

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007189SMESG000018145.1 SMESG000018144.1 SmedASXL_014854SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30007189SMESG000018145.1 SMESG000018144.1 dd_Smed_v4_9848_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007189SMESG000018145.1 SMESG000018144.1 dd_Smed_v4_9848_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007189SMESG000018145.1 SMESG000018144.1 dd_Smed_v4_9848_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30007189SMESG000018145.1 SMESG000018144.1 dd_Smed_v6_9848_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007189SMESG000018145.1 SMESG000018144.1 dd_Smed_v4_9848_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30007189SMESG000018145.1 SMESG000018144.1 dd_Smed_v4_9848_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Human
Match: DZANK1 (double zinc ribbon and ankyrin repeat domains 1 [Source:HGNC Symbol;Acc:HGNC:15858])

HSP 1 Score: 402.134 bits (1032), Expect = 1.121e-127
Identity = 277/799 (34.67%), Postives = 417/799 (52.19%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIG--DKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKILNQDVYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYISGLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAK----QMMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKKNIDKDKPLTTN-----NIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKR----TGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQANDSD 2475
            ++++T +E+ S++ D +IY+T++G KPE  K IG  + +TFK+  P  LP GK  VKAIAVSKD  R+S IVTK+F +++      SP+    +V   L+D   +   N            + +K +  + +   +N NLR      L   +     YG      SG    T       +   S  +   ST+I+        R+QRETDFLKC +CLAPRPSDPF++FC  CG  +PP+   RLPPPE  Q+G+C  CRS VPMN   C+VCEA L +Q QPQA+  L+E+V+C  CGT NP ++  C+TCE  LP S + +   +   PP       +       +C +C R N  +A FC WCG  +   A    GC  C +CGA+NH +A FC  CG  + +  K    + +A   E       S++IPL   +   K                   D+ TQTVGLFYPS   L K   K++ L +       + D       +SPG+GYWR+Q++HI  HL+ +A N+ EF+A+I EPR+GKLI+A V E+  E+++ L ++    K+ Y+ K  + F    LSS  +      GS  S+ SD +  ++D      T     R +  K K   +K+ + +P       ++ LLKE+  +GEG+ + IE+L +EGA+PN  +    P I VA  N H +AI +L + GA++++      NTALHEA  L     +    LL C +S++ +N  G+T  DLAL   +++   L ++K G+   ++L + +  +  D
Sbjct:   26 IDNNTLLEMKSDTPDVNIYYTLDGSKPEFLKRIGYGENNTFKYIKPITLPDGKIQVKAIAVSKD-CRQSGIVTKVFHVDYEPPNIVSPE---DNVENVLKDSSRQEFKNGFV-------GSKLKKKYKNSENQRSWNVNLRKFPESPLEIPA-----YGGG----SGSRPPTRQSQSPGFAHVSGQKCLTSTEIM--------RIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICVVCEAPLALQLQPQASLHLKEKVICRACGTGNPAHLRYCVTCEGALPSSQESMCSGDKAPPPPTQKGGTI-------SCYRCGRWNLWEASFCGWCGAMLGIPA----GCSVCPKCGASNHLSARFCGSCGICVKSLVKLSLDRSLALAAEEPRPFSESLNIPLPRSDVGTKR------------------DIGTQTVGLFYPSGKLLAK---KEQELASQKQRQEKMSDHKPLLTAISPGRGYWRRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVN-FSDHLLSSAAEGDGGLCGSRSSWVSDYSQSTSD------TIEKIKRIKNFKTKTFQEKKEQLIPE------NRLLLKEVGPTGEGRVSVIEQLLDEGADPNCCDEDNRPVITVAVMNKHHEAIPVLVQRGADIDQQWGPLRNTALHEATLLGLAGRESTATLLGCNASIQKKNAGGQTAYDLALNTGDDLVTSLFAAKFGQGLEDQLAQTRSLSLDD 751          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Human
Match: DZANK1 (double zinc ribbon and ankyrin repeat domains 1 [Source:HGNC Symbol;Acc:HGNC:15858])

HSP 1 Score: 402.134 bits (1032), Expect = 1.121e-127
Identity = 277/799 (34.67%), Postives = 417/799 (52.19%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIG--DKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKILNQDVYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYISGLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAK----QMMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKKNIDKDKPLTTN-----NIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKR----TGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQANDSD 2475
            ++++T +E+ S++ D +IY+T++G KPE  K IG  + +TFK+  P  LP GK  VKAIAVSKD  R+S IVTK+F +++      SP+    +V   L+D   +   N            + +K +  + +   +N NLR      L   +     YG      SG    T       +   S  +   ST+I+        R+QRETDFLKC +CLAPRPSDPF++FC  CG  +PP+   RLPPPE  Q+G+C  CRS VPMN   C+VCEA L +Q QPQA+  L+E+V+C  CGT NP ++  C+TCE  LP S + +   +   PP       +       +C +C R N  +A FC WCG  +   A    GC  C +CGA+NH +A FC  CG  + +  K    + +A   E       S++IPL   +   K                   D+ TQTVGLFYPS   L K   K++ L +       + D       +SPG+GYWR+Q++HI  HL+ +A N+ EF+A+I EPR+GKLI+A V E+  E+++ L ++    K+ Y+ K  + F    LSS  +      GS  S+ SD +  ++D      T     R +  K K   +K+ + +P       ++ LLKE+  +GEG+ + IE+L +EGA+PN  +    P I VA  N H +AI +L + GA++++      NTALHEA  L     +    LL C +S++ +N  G+T  DLAL   +++   L ++K G+   ++L + +  +  D
Sbjct:   26 IDNNTLLEMKSDTPDVNIYYTLDGSKPEFLKRIGYGENNTFKYIKPITLPDGKIQVKAIAVSKD-CRQSGIVTKVFHVDYEPPNIVSPE---DNVENVLKDSSRQEFKNGFV-------GSKLKKKYKNSENQRSWNVNLRKFPESPLEIPA-----YGGG----SGSRPPTRQSQSPGFAHVSGQKCLTSTEIM--------RIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICVVCEAPLALQLQPQASLHLKEKVICRACGTGNPAHLRYCVTCEGALPSSQESMCSGDKAPPPPTQKGGTI-------SCYRCGRWNLWEASFCGWCGAMLGIPA----GCSVCPKCGASNHLSARFCGSCGICVKSLVKLSLDRSLALAAEEPRPFSESLNIPLPRSDVGTKR------------------DIGTQTVGLFYPSGKLLAK---KEQELASQKQRQEKMSDHKPLLTAISPGRGYWRRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVN-FSDHLLSSAAEGDGGLCGSRSSWVSDYSQSTSD------TIEKIKRIKNFKTKTFQEKKEQLIPE------NRLLLKEVGPTGEGRVSVIEQLLDEGADPNCCDEDNRPVITVAVMNKHHEAIPVLVQRGADIDQQWGPLRNTALHEATLLGLAGRESTATLLGCNASIQKKNAGGQTAYDLALNTGDDLVTSLFAAKFGQGLEDQLAQTRSLSLDD 751          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Human
Match: DZANK1 (double zinc ribbon and ankyrin repeat domains 1 [Source:HGNC Symbol;Acc:HGNC:15858])

HSP 1 Score: 347.436 bits (890), Expect = 3.962e-109
Identity = 217/603 (35.99%), Postives = 326/603 (54.06%), Query Frame = 1
Query:  724 LRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTI-----IAPAKQMMAFTNEMKEYQ-----WNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKKNIDKDKPLTTN-----NIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKR----TGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQANDSD 2475
            +R+QRETDFLKC +CLAPRPSDPF++FC  CG  +PP+   RLPPPE  Q+G+C  CRS VPMN   C+VCEA L +Q QPQA+  L+E+V+C  CGT NP ++  C+TCE  LP S + +   +   PP       +       +C +C R N  +A FC WCG  +   A    GC  C +CGA+NH +A FC  CG  +     ++  + +     E + +      W S++IPL   +   K                   D+ TQTVGLFYPS   L K   K++ L +       + D       +SPG+GYWR+Q++HI  HL+ +A N+ EF+A+I EPR+GKLI+A V E+  E+++ L ++    K+ Y+ K  + F    LSS  +      GS  S+ SD +  ++D      T     R +  K K   +K+ + +P       ++ LLKE+  +GEG+ + IE+L +EGA+PN  +    P I VA  N H +AI +L + GA++++      NTALHEA  L     +    LL C +S++ +N  G+T  DLAL   +++   L ++K G+   ++L + +  +  D
Sbjct:    1 MRIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICVVCEAPLALQLQPQASLHLKEKVICRACGTGNPAHLRYCVTCEGALPSSQESMCSGDKAPPPPTQKGGTI-------SCYRCGRWNLWEASFCGWCGAMLGIPA----GCSVCPKCGASNHLSARFCGSCGICVKSLVKLSLDRSLALAAEEPRPFSEPRCAWQSLNIPLPRSDVGTKR------------------DIGTQTVGLFYPSGKLLAK---KEQELASQKQRQEKMSDHKPLLTAISPGRGYWRRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVN-FSDHLLSSAAEGDGGLCGSRSSWVSDYSQSTSD------TIEKIKRIKNFKTKTFQEKKEQLIPE------NRLLLKEVGPTGEGRVSVIEQLLDEGADPNCCDEDNRPVITVAVMNKHHEAIPVLVQRGADIDQQWGPLRNTALHEATLLGLAGRESTATLLGCNASIQKKNAGGQTAYDLALNTGDDLVTSLFAAKFGQGLEDQLAQTRSLSLDD 558          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Human
Match: DZANK1 (double zinc ribbon and ankyrin repeat domains 1 [Source:HGNC Symbol;Acc:HGNC:15858])

HSP 1 Score: 320.857 bits (821), Expect = 7.028e-99
Identity = 209/575 (36.35%), Postives = 299/575 (52.00%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIG--DKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKILNQDVYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYISGLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAK----QMMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKK-------------NIDKDKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFA 1791
            ++++T +E+ S++ D +IY+T++G KPE  K IG  + +TFK+  P  LP GK  VKAIAVSKD  R+S IVTK+F +++      SP+    +V   L+D   +   N            + +K +  + +   +N NLR      L   +     YG      SG    T       +   S  +   ST+I+        R+QRETDFLKC +CLAPRPSDPF++FC  CG  +PP+   RLPPPE  Q+G+C  CRS VPMN   C+VCEA L +Q QPQA+  L+E+V+C  CGT NP ++  C+TCE  LP S + +   +   PP       +       +C +C R N  +A FC WCG  +   A    GC  C +CGA+NH +A FC  CG  + +  K    + +A   E       S++IPL   +   K                   D+ TQTVGLFYPS   L K              +   KPL T            +SPG+GYWR+Q++HI  HL+ +A N+ EF+A+I EPR+GKLI+A V E+  E+++ L ++
Sbjct:   26 IDNNTLLEMKSDTPDVNIYYTLDGSKPEFLKRIGYGENNTFKYIKPITLPDGKIQVKAIAVSKD-CRQSGIVTKVFHVDYEPPNIVSPE---DNVENVLKDSSRQEFKNGFV-------GSKLKKKYKNSENQRSWNVNLRKFPESPLEIPA-----YGGG----SGSRPPTRQSQSPGFAHVSGQKCLTSTEIM--------RIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICVVCEAPLALQLQPQASLHLKEKVICRACGTGNPAHLRYCVTCEGALPSSQESMCSGDKAPPPPTQKGGTI-------SCYRCGRWNLWEASFCGWCGAMLGIPA----GCSVCPKCGASNHLSARFCGSCGICVKSLVKLSLDRSLALAAEEPRPFSESLNIPLPRSDVGTKR------------------DIGTQTVGLFYPSGKLLAKKEQELASQKQRQEKMSDHKPLLTA-----------ISPGRGYWRRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYS 532          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Human
Match: DZANK1 (double zinc ribbon and ankyrin repeat domains 1 [Source:HGNC Symbol;Acc:HGNC:15858])

HSP 1 Score: 243.432 bits (620), Expect = 3.525e-71
Identity = 172/543 (31.68%), Postives = 263/543 (48.43%), Query Frame = 1
Query:  874 LGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAKQMMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKKNIDKDKPLTTN-----NIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLK----RTGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQANDSD 2475
            +G+C  CRS VPMN   C+VCEA L +Q QPQA+  L+E+V+C  CGT NP ++  C+TCE  LP S       EL  P   ++            C KC   N+  ARFC  CG  V                               + +     + +A   E       S++IPL   +   K                   D+ TQTVGLFYPS   L K   K++ L +       + D       +SPG+GYWR+Q++HI  HL+ +A N+ EF+A+I EPR+GKLI+A V E+  E+++ L ++    K+ Y+ K  + F    LSS  +      GS  S+ SD +  ++D      T     R +  K K   +K+ + +P       ++ LLKE+  +GEG+ + IE+L +EGA+PN  +    P I VA  N H +AI +L + GA++++      NTALHEA  L     +    LL C +S++ +N  G+T  DLAL   +++   L ++K G+   ++L + +  +  D
Sbjct:    1 MGLCAECRSLVPMNTPICVVCEAPLALQLQPQASLHLKEKVICRACGTGNPAHLRYCVTCEGALPSSQ------ELGIPAGCSV------------CPKCGASNHLSARFCGSCGICVK------------------------------SLVKLSLDRSLALAAEEPRPFSESLNIPLPRSDVGTKR------------------DIGTQTVGLFYPSGKLLAK---KEQELASQKQRQEKMSDHKPLLTAISPGRGYWRRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVN-FSDHLLSSAAEGDGGLCGSRSSWVSDYSQSTSD------TIEKIKRIKNFKTKTFQEKKEQLIPE------NRLLLKEVGPTGEGRVSVIEQLLDEGADPNCCDEDNRPVITVAVMNKHHEAIPVLVQRGADIDQQWGPLRNTALHEATLLGLAGRESTATLLGCNASIQKKNAGGQTAYDLALNTGDDLVTSLFAAKFGQGLEDQLAQTRSLSLDD 461          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Fly
Match: CG3104 (gene:FBgn0031473 transcript:FBtr0335132)

HSP 1 Score: 52.373 bits (124), Expect = 9.181e-7
Identity = 31/101 (30.69%), Postives = 53/101 (52.48%), Query Frame = 1
Query: 2059 ISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETP 2361
            I ++  G T  +  L ++GA+PN +   G   +  A +  H D +++L + GA+V+    + G T L   V+ +  +  I+ ELLDCG++V    K   TP
Sbjct:   48 ILAAAGGHTYCVMELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSAD-GGTPLF--VACQGGHVKIVRELLDCGANVNAHMKDRATP 145          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Fly
Match: CG3104 (gene:FBgn0031473 transcript:FBtr0077686)

HSP 1 Score: 52.373 bits (124), Expect = 9.181e-7
Identity = 31/101 (30.69%), Postives = 53/101 (52.48%), Query Frame = 1
Query: 2059 ISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETP 2361
            I ++  G T  +  L ++GA+PN +   G   +  A +  H D +++L + GA+V+    + G T L   V+ +  +  I+ ELLDCG++V    K   TP
Sbjct:   48 ILAAAGGHTYCVMELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSAD-GGTPLF--VACQGGHVKIVRELLDCGANVNAHMKDRATP 145          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Fly
Match: CG3104 (gene:FBgn0031473 transcript:FBtr0077687)

HSP 1 Score: 52.373 bits (124), Expect = 9.181e-7
Identity = 31/101 (30.69%), Postives = 53/101 (52.48%), Query Frame = 1
Query: 2059 ISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETP 2361
            I ++  G T  +  L ++GA+PN +   G   +  A +  H D +++L + GA+V+    + G T L   V+ +  +  I+ ELLDCG++V    K   TP
Sbjct:   48 ILAAAGGHTYCVMELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSAD-GGTPLF--VACQGGHVKIVRELLDCGANVNAHMKDRATP 145          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Zebrafish
Match: dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:ZFIN;Acc:ZDB-GENE-051113-296])

HSP 1 Score: 379.407 bits (973), Expect = 3.553e-119
Identity = 254/793 (32.03%), Postives = 418/793 (52.71%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIG-DKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKILNQDVYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYIS---GLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDL-IFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAKQMMAFT--NEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKKNIDKDKPLTTN--NIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKRTGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQANDSD 2475
            ++  T +EI SES D  + +T++G KPE  K  G    T K++ P  LP GK  VKA+A+S DG R+S +VTK+F +E   S        ++D     + +KN    +     E               N TG+        + ++L   S+   +  K   ++S   G      + T +N + +S    +   K LT++  S  R+QRETDFL+C  CL+ RPSDPF++FC +CG  +PP+P  RLPP E GQ+G+C+HC++ VP+N + C+VCE+ L+ Q QPQAT +L+++ +C  CGT NP ++  C+TCE++L    +P+   +   P        +PS      +C KCNR N++DARFCDWCG K    A+S    + CS+CGA++H  A  C  CG  +  P +  +      + +E Q  + +  L+       P ++ ++         +  D  TQTVGLF+PS  +LKK   + +   +    + D+      +SPG+G+WRKQ++HI  HL+++  N++EF+A+IGEPR+G++I+A +QE+  E++L + F     ++   R +S     R ++S  +   S    R+  + ++N  +   +      +   T     N+ +SK          D  LLKE+   G G+   +++L +EGA+P      G P ++ A  N H D I +L +  A+VN+      NTALHEA +L       +  LL C +S++ +N +G+TP D+A+   +   + L+++ LG+  + + TK +  +  D
Sbjct:   26 IDSSTPVEIKSESPDVRVLYTLDGSKPELTKRPGFADSTLKYTEPVRLPVGKVYVKAMAISIDG-RQSAVVTKVFVVEPSASDERELNAHDED-----DSVKNDTAIDGKDVVE---------------NGTGVS-------SVKYLDISSNEAHRALKGPRFLSQRLGPGSSARL-TAQNSQNQSADVVESPLKNLTNTQIS--RIQRETDFLRCPKCLSHRPSDPFARFCLHCGAPVPPIPGQRLPPTEGGQMGLCMHCKTMVPLNTAICVVCESPLDQQLQPQATLRLQDKFICHSCGTGNPAHITHCVTCESQLLRQARPVLSGQRAAP--------VPSSQGKMVSCSKCNRVNHSDARFCDWCGAKPGHKASS----VKCSQCGASSHPYANHCGGCGVFLDGPPRMPLQVNQRQDAEEMQQTASAAELAT-----APPSVGLR---------MCADAQTQTVGLFFPSNTELKKRSQQREAELSRQEQMRDRKPLLTAISPGRGFWRKQLDHICAHLRSYTQNNTEFRALIGEPRLGRMISAVIQEDSYEVSLRINFISAPPEE--SRSSSAGQRSRSVTSESQNLSSVTEGRNSASPENNINTTGSEVKKKKKKKIGTSDVTENQPESK----------DSLLLKEVGPEGRGRIPAVQQLLDEGADPACLGKDGRPALVAAVLNGHHDVIPVLVQREADVNQASGPLKNTALHEAAALGDEGLKSVEILLGCNASIRKQNDRGQTPYDIAVAAGSSSVLSLMAAHLGQGLLLRHTKARSLSGLD 749          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Zebrafish
Match: dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:ZFIN;Acc:ZDB-GENE-051113-296])

HSP 1 Score: 305.834 bits (782), Expect = 2.597e-93
Identity = 196/564 (34.75%), Postives = 312/564 (55.32%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIG-DKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKILNQDVYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYIS---GLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDL-IFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAKQMMAF--TNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKKNIDKDKPLTTN--NIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVF 1788
            ++  T +EI SES D  + +T++G KPE  K  G    T K++ P  LP GK  VKA+AVS DG R+S +VTK+F +E   S        ++D     + +KN    +     E               N TG+        + ++L   S+   +  K   ++S   G      + T +N + +S    +   K LT++  S  R+QRETDFL+C  CL+ RPSDPF++FC +CG  +PP+P  RLPP E GQ+G+C+HC++ VP+N + C+VCE+ L+   QPQAT +L+++ +C  CGT NP ++  C+TCE++L +  +P+   +   P        +PS      +C KCNR N++DARFCDWCG K    A+S    + CS+CGA++H  A  C  CG  +  P +  +      + +E Q  + +  L+       P ++ ++  +         D  TQTVGLF+PS  +LKK   + +   +    + D+      +SPG+G+WRKQ++HI  HL+++  N++EF+A+IGEPR+G++I+A +QE+  E++L + F
Sbjct:   26 IDSSTPVEIKSESPDVRVLYTLDGSKPELTKRPGFADSTLKYTEPVRLPVGKVYVKAMAVSIDG-RQSAVVTKVFVVEPSASDERELNAHDED-----DSVKNDTAIDGKDVME---------------NGTGVS-------SVKYLDISSNEAHRALKGPRFLSQRLGPGSSARL-TAQNSQNQSADVVESPLKNLTNTQMS--RIQRETDFLRCPKCLSHRPSDPFARFCLHCGAPVPPIPGQRLPPTEGGQMGLCMHCKTMVPLNTAICVVCESPLDQLLQPQATLRLQDKFICHSCGTGNPAHITHCVTCESQLLQQARPVLSGQRAAP--------VPSSQGKMVSCSKCNRVNHSDARFCDWCGAKPGHKASS----VKCSQCGASSHPYANHCGGCGVFLDGPPRMPLQVNQRQDAEEMQQTASAAELAT-----APPSVGLRMCA---------DAQTQTVGLFFPSNTELKKRSQQREAELSRQEQMRDRKPLLTAISPGRGFWRKQLDHICAHLRSYTQNNTEFRALIGEPRLGRMISAVIQEDSYEVSLRINF 532          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Zebrafish
Match: ppp1r12a (protein phosphatase 1, regulatory subunit 12A [Source:NCBI gene;Acc:445393])

HSP 1 Score: 53.9138 bits (128), Expect = 8.486e-7
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 2059 ISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDL------ALTKNNEIAVKLISSKLGRKQVEKL 2445
            +++   G T E+ R+ + GA+ N  N  G+  +  A  +++ D +  L E GA +N+ + E G   LH A S   L  DI   L+  G+SV + N +GETP D+           NEI  + +  +  RK+ E++
Sbjct:  113 LAACSSGDTEEVLRMLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGACINQPDNE-GWIPLHAAASCGYL--DIAEYLISQGASVGVVNSEGETPLDIAEEEAMEELLQNEINRQGVDIEAARKEEERI 244          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Zebrafish
Match: pla2g6 (phospholipase A2, group VI (cytosolic, calcium-independent) [Source:ZFIN;Acc:ZDB-GENE-040426-2079])

HSP 1 Score: 53.9138 bits (128), Expect = 8.852e-7
Identity = 54/162 (33.33%), Postives = 75/162 (46.30%), Query Frame = 1
Query: 1993 KKQSKSVPNVVLSEVDKSLLKEISSSG-----EGKTTEIERLF-EEGANPN--GKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKP 2454
            K   KS    +LS     LL E    G       KT E+ RL  + G N N   K G+  P  I+  R   + A+ LL   GA+ N I  + GNTALH A+ L   N D+I  L+  G+ V++ N  GETP  +A   +     K++ + L    VE+   P
Sbjct:  266 KFSEKSCAEAILSSSPNQLLAEDPVYGGTPLHWAKTAEMSRLLLDRGCNVNYLSKTGES-PLHILTKRGRFEAAMTLLTH-GADAN-IRGQDGNTALHLAMKLD--NMDLIKALMVFGADVEVHNDVGETPGLIAARTSKGSNRKVLLNMLCSVGVERCHPP 422          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Zebrafish
Match: pla2g6 (phospholipase A2, group VI (cytosolic, calcium-independent) [Source:ZFIN;Acc:ZDB-GENE-040426-2079])

HSP 1 Score: 53.9138 bits (128), Expect = 8.961e-7
Identity = 54/162 (33.33%), Postives = 75/162 (46.30%), Query Frame = 1
Query: 1993 KKQSKSVPNVVLSEVDKSLLKEISSSG-----EGKTTEIERLF-EEGANPN--GKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKP 2454
            K   KS    +LS     LL E    G       KT E+ RL  + G N N   K G+  P  I+  R   + A+ LL   GA+ N I  + GNTALH A+ L   N D+I  L+  G+ V++ N  GETP  +A   +     K++ + L    VE+   P
Sbjct:  260 KFSEKSCAEAILSSSPNQLLAEDPVYGGTPLHWAKTAEMSRLLLDRGCNVNYLSKTGES-PLHILTKRGRFEAAMTLLTH-GADAN-IRGQDGNTALHLAMKLD--NMDLIKALMVFGADVEVHNDVGETPGLIAARTSKGSNRKVLLNMLCSVGVERCHPP 416          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Xenopus
Match: dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:NCBI gene;Acc:100158524])

HSP 1 Score: 433.721 bits (1114), Expect = 2.099e-139
Identity = 296/808 (36.63%), Postives = 434/808 (53.71%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIG--DKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKILNQDVYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDY-ISGLNLETNMDTDKNYKRKSEFEEKMSTK-------------ILTDSSYSS--LRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQP-PNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAK-----QMMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKK-----NIDKDKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKRTGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQ 2460
            ++ +T IEI S+S +  IY+T++G KPE +K +G  +K+T K+  PF LP GK TVKA+AVS+DG RES  VTK+F +E+V+    S    N +   FL+D+  ++  N   +  PK+  +               N  L  I+    T +S+   K G+T+     GL        +   ++ S+ EE +S               I+  S  S+  +R+QRETDFLKC +CLA RPSDPF++FC  CG  +PP+P  RLPPPE  Q+G+C+ CRS VPMN  +C+VCEA L  Q  PQA+  L ++  C  CGT NP N++ C+TCEA+LPE  KPI   +   P PNQ             +C KC R N++DARFCDWCG K S   +     LTCS+C A+NH  A FC  CG  +  PA+      MM  + E K +         ++     +P T+S+    L I +    D  TQTVGLFYPS   ++K      ++K+K      + D+      +SPG+GYWR+Q++HI  HL+ +  N+SEF+++IG PR+G++I+  + E+  E+++ L +     KD    K        +LSS+ +  G  D++ S  ++ S D    +     + R +  K     +++        LS  D+ LLKE+   GEG    +E L +EGA+PN  N +  P + VA  N H   I +L + GA++ +      NTALHEAV L          LL C +S+K +N KG T  DLAL   N+  V L +SKLG+  ++KL+KPK+
Sbjct:   26 IDSNTPIEIKSDSPEVTIYYTLDGSKPELYKKVGFGEKNTLKYKGPFMLPDGKITVKALAVSRDG-RESGTVTKVFIVEYVQPDLDSSDEDNDE--NFLKDLSKQDIENS--FSLPKSKKK---------------NEALERISAWDETAQSNGPVKEGRTNRRSFKGLQF-----MNDRLEKSSQVEEPISPSQTQRSQQNGGVEGIVRKSLTSAQIMRIQRETDFLKCSHCLANRPSDPFARFCLECGYPVPPVPGHRLPPPEGAQMGLCVECRSMVPMNTPSCIVCEAPLLPQMTPQAS--LNDKTFCRFCGTGNPINLNYCVTCEARLPEMQKPIWSGDSAPPLPNQVGK--------MQSCSKCGRVNHSDARFCDWCGAKPSSPISH----LTCSKCSASNHPLANFCASCGAYLEPPARYSPLHNMMLTSGEHKAFSE-------ADNRASWQPVTVSLPKPRLEIERE---DKGTQTVGLFYPSGKLIEKKEIELGLEKEK---KEKMSDRKPLVTAISPGRGYWRQQLDHICAHLRCYTQNNSEFKSLIGNPRMGRIISGTMHEDGYEVSIRLNYVQVTDKDALTAKPIRLSGSNFLSSVTE--GRNDNYESPSSVASEDGLSARSKNGKARRKKKNKLLLQKEER--------LSNEDRKLLKEVGPKGEGNIAVVEELLDEGADPNCCNNEDRPVLTVAVLNGHNQVIPVLVQKGADIEQQSGPHNNTALHEAVMLGLDGKKCTEVLLGCNASIKTKNDKGMTAYDLALKNGNDQVVSLFASKLGQGMLDKLSKPKK 771          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Xenopus
Match: dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:NCBI gene;Acc:100158524])

HSP 1 Score: 324.324 bits (830), Expect = 3.527e-99
Identity = 215/570 (37.72%), Postives = 308/570 (54.04%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIG--DKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKILNQD-VYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYISGLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQP-PNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAK-----QMMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKK-----NIDKDKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFA 1791
            ++ +T IEI S+S +  IY+T++G KPE +K +G  +K+T K+  PF LP GK TVKA+AVS+DG RES  VTK+F    VE V P     ++D    FL+D+  +        Q P AS                +   +  I P          K  G   +++ G +L                           +S   +R+QRETDFLKC +CLA RPSDPF++FC  CG  +PP+P  RLPPPE  Q+G+C+ CRS VPMN  +C+VCEA L  Q  PQA+  L ++  C  CGT NP N++ C+TCEA+LPE  KPI   +   P PNQ             +C KC R N++DARFCDWCG KV +   S+   LTCS+C A+NH  A FC  CG  +  PA+      MM  + E K +         ++     +P T+S+    L I +    D  TQTVGLFYPS   ++K      ++K+K      + D+      +SPG+GYWR+Q++HI  HL+ +  N+SEF+++IG PR+G++I+  + E+  E+++ L + 
Sbjct:   26 IDSNTPIEIKSDSPEVTIYYTLDGSKPELYKKVGFGEKNTLKYKGPFMLPDGKITVKALAVSRDG-RESGTVTKVF---IVEYVQPDLDSSDEDNDENFLKDLSKQ-------VQYPIAS----------------FFGGMSKIRP----------KWGGALIEFVVGKSL---------------------------TSAQIMRIQRETDFLKCSHCLANRPSDPFARFCLECGYPVPPVPGHRLPPPEGAQMGLCVECRSMVPMNTPSCIVCEAPLLPQMTPQAS--LNDKTFCRFCGTGNPINLNYCVTCEARLPEMQKPIWSGDSAPPLPNQVGK--------MQSCSKCGRVNHSDARFCDWCGAKV-YSPISH---LTCSKCSASNHPLANFCASCGAYLEPPARYSPLHNMMLTSGEHKAFSE-------ADNRASWQPVTVSLPKPRLEIERE---DKGTQTVGLFYPSGKLIEKKEIELGLEKEK---KEKMSDRKPLVTAISPGRGYWRQQLDHICAHLRCYTQNNSEFKSLIGNPRMGRIISGTMHEDGYEVSIRLNYV 504          

HSP 2 Score: 107.842 bits (268), Expect = 1.688e-23
Identity = 59/141 (41.84%), Postives = 81/141 (57.45%), Query Frame = 1
Query: 2038 DKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQ 2460
            D+ LLKE+   GEG    +E L +EGA+PN  N +  P + VA  N H   I +L + GA++ +      NTALHEAV L          LL C +S+K +N KG T  DLAL   N+  V L +SKLG+  ++KL+KPK+
Sbjct:  519 DRKLLKEVGPKGEGNIAVVEELLDEGADPNCCNNEDRPVLTVAVLNGHNQVIPVLVQKGADIEQQSGPHNNTALHEAVMLGLDGKKCTEVLLGCNASIKTKNDKGMTAYDLALKNGNDQVVSLFASKLGQGMLDKLSKPKK 659          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Xenopus
Match: dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:NCBI gene;Acc:100158524])

HSP 1 Score: 273.092 bits (697), Expect = 4.254e-80
Identity = 156/372 (41.94%), Postives = 221/372 (59.41%), Query Frame = 1
Query:  709 SSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQP-PNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAK-----QMMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKK-----NIDKDKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFA 1791
            +S   +R+QRETDFLKC +CLA RPSDPF++FC  CG  +PP+P  RLPPPE  Q+G+C+ CRS VPMN  +C+VCEA L  Q  PQA+  L ++  C  CGT NP N++ C+TCEA+LPE  KPI   +   P PNQ             +C KC R N++DARFCDWCG K S   +     LTCS+C A+NH  A FC  CG  +  PA+      MM  + E K +         ++     +P T+S+    L I +    D  TQTVGLFYPS   ++K      ++K+K      + D+      +SPG+GYWR+Q++HI  HL+ +  N+SEF+++IG PR+G++I+  + E+  E+++ L + 
Sbjct:  166 TSAQIMRIQRETDFLKCSHCLANRPSDPFARFCLECGYPVPPVPGHRLPPPEGAQMGLCVECRSMVPMNTPSCIVCEAPLLPQMTPQAS--LNDKTFCRFCGTGNPINLNYCVTCEARLPEMQKPIWSGDSAPPLPNQVGK--------MQSCSKCGRVNHSDARFCDWCGAKPSSPISH----LTCSKCSASNHPLANFCASCGAYLEPPARYSPLHNMMLTSGEHKAFS-------EADNRASWQPVTVSLPKPRLEIERE---DKGTQTVGLFYPSGKLIEKKEIELGLEKEK---KEKMSDRKPLVTAISPGRGYWRQQLDHICAHLRCYTQNNSEFKSLIGNPRMGRIISGTMHEDGYEVSIRLNYV 510          

HSP 2 Score: 84.7297 bits (208), Expect = 2.948e-16
Identity = 48/117 (41.03%), Postives = 67/117 (57.26%), Query Frame = 1
Query: 2110 EGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQ 2460
            +GA+PN  N +  P + VA  N H   I +L + GA++ +      NTALHEAV L          LL C +S+K +N KG T  DLAL   N+  V L +SKLG+  ++KL+KPK+
Sbjct:  535 KGADPNCCNNEDRPVLTVAVLNGHNQVIPVLVQKGADIEQQSGPHNNTALHEAVMLGLDGKKCTEVLLGCNASIKTKNDKGMTAYDLALKNGNDQVVSLFASKLGQGMLDKLSKPKK 651          

HSP 3 Score: 82.0333 bits (201), Expect = 1.810e-15
Identity = 42/82 (51.22%), Postives = 61/82 (74.39%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIG--DKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVE 363
            ++ +T IEI S+S +  IY+T++G KPE +K +G  +K+T K+  PF LP GK TVKA+AVS+DG RES  VTK+F +E+V+
Sbjct:   26 IDSNTPIEIKSDSPEVTIYYTLDGSKPELYKKVGFGEKNTLKYKGPFMLPDGKITVKALAVSRDG-RESGTVTKVFIVEYVQ 106          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Xenopus
Match: dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:NCBI gene;Acc:100158524])

HSP 1 Score: 253.447 bits (646), Expect = 2.883e-74
Identity = 155/392 (39.54%), Postives = 229/392 (58.42%), Query Frame = 1
Query:  670 EFEEKMSTKILTDSSYSSLRLQRETDF-LK------CIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQP-PNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAK-----QMMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKK-----NIDKDKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFA 1791
            EF  +++ + ++ S+Y    L+R+ +F +K      C +CLA RPSDPF++FC  CG  +PP+P  RLPPPE  Q+G+C+ CRS VPMN  +C+VCEA L  Q  PQA+  L ++  C  CGT NP N++ C+TCEA+LPE  KPI   +   P PNQ             +C KC R N++DARFCDWCG KV +   S+   LTCS+C A+NH  A FC  CG  +  PA+      MM  + E K +         ++     +P T+S+    L I +    D  TQTVGLFYPS   ++K      ++K+K      + D+      +SPG+GYWR+Q++HI  HL+ +  N+SEF+++IG PR+G++I+  + E+  E+++ L + 
Sbjct:    3 EFPIQVNNRQISASAY---HLKRKLNFNMKIYIVDLCSHCLANRPSDPFARFCLECGYPVPPVPGHRLPPPEGAQMGLCVECRSMVPMNTPSCIVCEAPLLPQMTPQAS--LNDKTFCRFCGTGNPINLNYCVTCEARLPEMQKPIWSGDSAPPLPNQVGK--------MQSCSKCGRVNHSDARFCDWCGAKV-YSPISH---LTCSKCSASNHPLANFCASCGAYLEPPARYSPLHNMMLTSGEHKAFSE-------ADNRASWQPVTVSLPKPRLEIERE---DKGTQTVGLFYPSGKLIEKKEIELGLEKEK---KEKMSDRKPLVTAISPGRGYWRQQLDHICAHLRCYTQNNSEFKSLIGNPRMGRIISGTMHEDGYEVSIRLNYV 364          

HSP 2 Score: 108.227 bits (269), Expect = 5.876e-24
Identity = 59/141 (41.84%), Postives = 81/141 (57.45%), Query Frame = 1
Query: 2038 DKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQ 2460
            D+ LLKE+   GEG    +E L +EGA+PN  N +  P + VA  N H   I +L + GA++ +      NTALHEAV L          LL C +S+K +N KG T  DLAL   N+  V L +SKLG+  ++KL+KPK+
Sbjct:  379 DRKLLKEVGPKGEGNIAVVEELLDEGADPNCCNNEDRPVLTVAVLNGHNQVIPVLVQKGADIEQQSGPHNNTALHEAVMLGLDGKKCTEVLLGCNASIKTKNDKGMTAYDLALKNGNDQVVSLFASKLGQGMLDKLSKPKK 519          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Xenopus
Match: dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:NCBI gene;Acc:100158524])

HSP 1 Score: 253.832 bits (647), Expect = 3.325e-73
Identity = 147/358 (41.06%), Postives = 211/358 (58.94%), Query Frame = 1
Query:  751 LKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQP-PNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAK-----QMMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKK-----NIDKDKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFA 1791
             +C +CLA RPSDPF++FC  CG  +PP+P  RLPPPE  Q+G+C+ CRS VPMN  +C+VCEA L  Q  PQA+  L ++  C  CGT NP N++ C+TCEA+LPE  KPI   +   P PNQ             +C KC R N++DARFCDWCG KV +   S+   LTCS+C A+NH  A FC  CG  +  PA+      MM  + E K +         ++     +P T+S+    L I +    D  TQTVGLFYPS   ++K      ++K+K      + D+      +SPG+GYWR+Q++HI  HL+ +  N+SEF+++IG PR+G++I+  + E+  E+++ L + 
Sbjct:  169 FRCSHCLANRPSDPFARFCLECGYPVPPVPGHRLPPPEGAQMGLCVECRSMVPMNTPSCIVCEAPLLPQMTPQAS--LNDKTFCRFCGTGNPINLNYCVTCEARLPEMQKPIWSGDSAPPLPNQVGK--------MQSCSKCGRVNHSDARFCDWCGAKV-YSPISH---LTCSKCSASNHPLANFCASCGAYLEPPARYSPLHNMMLTSGEHKAFSE-------ADNRASWQPVTVSLPKPRLEIERE---DKGTQTVGLFYPSGKLIEKKEIELGLEKEK---KEKMSDRKPLVTAISPGRGYWRQQLDHICAHLRCYTQNNSEFKSLIGNPRMGRIISGTMHEDGYEVSIRLNYV 499          

HSP 2 Score: 84.7297 bits (208), Expect = 2.697e-16
Identity = 48/117 (41.03%), Postives = 67/117 (57.26%), Query Frame = 1
Query: 2110 EGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQ 2460
            +GA+PN  N +  P + VA  N H   I +L + GA++ +      NTALHEAV L          LL C +S+K +N KG T  DLAL   N+  V L +SKLG+  ++KL+KPK+
Sbjct:  524 KGADPNCCNNEDRPVLTVAVLNGHNQVIPVLVQKGADIEQQSGPHNNTALHEAVMLGLDGKKCTEVLLGCNASIKTKNDKGMTAYDLALKNGNDQVVSLFASKLGQGMLDKLSKPKK 640          

HSP 3 Score: 82.0333 bits (201), Expect = 2.263e-15
Identity = 42/82 (51.22%), Postives = 61/82 (74.39%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIG--DKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVE 363
            ++ +T IEI S+S +  IY+T++G KPE +K +G  +K+T K+  PF LP GK TVKA+AVS+DG RES  VTK+F +E+V+
Sbjct:   26 IDSNTPIEIKSDSPEVTIYYTLDGSKPELYKKVGFGEKNTLKYKGPFMLPDGKITVKALAVSRDG-RESGTVTKVFIVEYVQ 106          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Mouse
Match: Dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:MGI Symbol;Acc:MGI:2139080])

HSP 1 Score: 383.645 bits (984), Expect = 1.958e-120
Identity = 268/803 (33.37%), Postives = 419/803 (52.18%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIG--DKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKILNQD-VYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSST----NKKYGKTHDYISGLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKP--IKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCG------------NTIIAPAKQMMAFTNEMKEYQWNSISIPL-SNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQL-KKNIDKDKPLTTNNIWDKIVPS-NYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLK-RTGSFDSFRSDDTLQSNDLS-KPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKP 2454
            ++ +T +E+ S++ D +IY+T++G KP+  K +G  + +TFK+  P  LP GK  VKA+AVSKD  R+S IVTK+F++++     P   + ++D V   L+    +   N   +  PK      +K +    +   +N NLR +    +  R+      + ++ ++   I   +   +     +  +   F      K LT +    +R+QRETDFLKC +CLA RPSDPF++FC+ CG  +PP+   RLPPPE  Q+G+C  C S VPMN   C+VCEA L  Q +PQA+  L+ERV+C  CGT NP ++  C+TCE  LP + +       E+  PP +   +         +C +C  QN  +A FCDWCG  +   A+       C +CGA+NH  A FC  CG            N++   A     F        W S+++PL ++ +G  K                   D  TQT GLFYPS   L KK ++               P    VSPG+GYWRKQ++HI  HL+++A N+ EF+A+I EPR+GKLI+A V E+  E+++ L +     K  Y  K+ +  D  +LSS+ +   G +DS  S  +  S  +S  P+      +           K +S  V    L+  +K LL+E+ SSG+G+ + +E+L +EGA+PN  + +G P +IVA  N H +AI +L + GA++++    F NTALHEA  L     + I  LL C ++ + +N +G+T  D+AL   +++   L ++K  +   ++L+ P
Sbjct:   26 IDTNTLLEMKSDTPDVNIYYTLDGSKPDFLKKVGSGENNTFKYVKPITLPDGKIQVKAVAVSKD-CRQSGIVTKVFQVDY----EPPKMVSSEDNVEDALKGFSKQELKNG--FVGPK-----LRKKYKNAENKSTWNVNLRRLADLKVGERADPKTLKDLRFAESPLEIPAYHEGASARLPTHQAQSPGFAHITGQKSLTSTEI--MRIQRETDFLKCAHCLASRPSDPFARFCHECGAPVPPIFGYRLPPPEGAQMGLCAECGSMVPMNTPICVVCEAPLAPQLRPQASLYLKERVICRTCGTGNPAHLRYCVTCEGPLPPTQEQWLCNGDEVPHPPARNGET--------ISCSRCGCQNLWEASFCDWCGAMLGISASHS----VCPKCGASNHLTARFCGSCGIYVKSITRFRMHNSLAIVAGAPRPFPEPRS--AWQSLNVPLPTSASGSKK-------------------DTGTQTSGLFYPSGKLLAKKELEAASHRQRQEKMSDHRPVLTAVSPGRGYWRKQLDHISAHLRSYAQNNPEFRALIAEPRMGKLISATVHEDGYEVSIRLNYIQVSNKSLYFNKSVNLSD-HFLSSVTEGGNGLYDSRSSLVSAYSQSVSDTPESIKKMKNL----------KAKSFLVNPEPLTPENKLLLEEVGSSGKGRLSVLEQLLDEGADPNCCDSQGRPAVIVAVVNKHYEAIPVLAQRGADIDQQWGPFRNTALHEATLLGLEGRESIATLLGCNANAQKKNTRGQTAYDIALEMGDDLTSSLFAAKFTQGLEDQLSPP 770          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Mouse
Match: Dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:MGI Symbol;Acc:MGI:2139080])

HSP 1 Score: 379.022 bits (972), Expect = 1.231e-118
Identity = 268/804 (33.33%), Postives = 419/804 (52.11%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIG--DKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKILNQD-VYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSST----NKKYGKTHDYISGLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQ-LGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKP--IKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCG------------NTIIAPAKQMMAFTNEMKEYQWNSISIPL-SNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQL-KKNIDKDKPLTTNNIWDKIVPS-NYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKR-TGSFDSFRSDDTLQSNDLS-KPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKP 2454
            ++ +T +E+ S++ D +IY+T++G KP+  K +G  + +TFK+  P  LP GK  VKA+AVSKD  R+S IVTK+F++++     P   + ++D V   L+    +   N   +  PK      +K +    +   +N NLR +    +  R+      + ++ ++   I   +   +     +  +   F      K LT +    +R+QRETDFLKC +CLA RPSDPF++FC+ CG  +PP+   RLPPPE  Q +G+C  C S VPMN   C+VCEA L  Q +PQA+  L+ERV+C  CGT NP ++  C+TCE  LP + +       E+  PP +   +         +C +C  QN  +A FCDWCG  +   A+       C +CGA+NH  A FC  CG            N++   A     F        W S+++PL ++ +G  K                   D  TQT GLFYPS   L KK ++               P    VSPG+GYWRKQ++HI  HL+++A N+ EF+A+I EPR+GKLI+A V E+  E+++ L +     K  Y  K+ +  D  +LSS+ +   G +DS  S  +  S  +S  P+      +           K +S  V    L+  +K LL+E+ SSG+G+ + +E+L +EGA+PN  + +G P +IVA  N H +AI +L + GA++++    F NTALHEA  L     + I  LL C ++ + +N +G+T  D+AL   +++   L ++K  +   ++L+ P
Sbjct:   26 IDTNTLLEMKSDTPDVNIYYTLDGSKPDFLKKVGSGENNTFKYVKPITLPDGKIQVKAVAVSKD-CRQSGIVTKVFQVDY----EPPKMVSSEDNVEDALKGFSKQELKNG--FVGPK-----LRKKYKNAENKSTWNVNLRRLADLKVGERADPKTLKDLRFAESPLEIPAYHEGASARLPTHQAQSPGFAHITGQKSLTSTEI--MRIQRETDFLKCAHCLASRPSDPFARFCHECGAPVPPIFGYRLPPPEGAQQMGLCAECGSMVPMNTPICVVCEAPLAPQLRPQASLYLKERVICRTCGTGNPAHLRYCVTCEGPLPPTQEQWLCNGDEVPHPPARNGET--------ISCSRCGCQNLWEASFCDWCGAMLGISASHS----VCPKCGASNHLTARFCGSCGIYVKSITRFRMHNSLAIVAGAPRPFPEPRSA--WQSLNVPLPTSASGSKK-------------------DTGTQTSGLFYPSGKLLAKKELEAASHRQRQEKMSDHRPVLTAVSPGRGYWRKQLDHISAHLRSYAQNNPEFRALIAEPRMGKLISATVHEDGYEVSIRLNYIQVSNKSLYFNKSVNLSD-HFLSSVTEGGNGLYDSRSSLVSAYSQSVSDTPESIKKMKNL----------KAKSFLVNPEPLTPENKLLLEEVGSSGKGRLSVLEQLLDEGADPNCCDSQGRPAVIVAVVNKHYEAIPVLAQRGADIDQQWGPFRNTALHEATLLGLEGRESIATLLGCNANAQKKNTRGQTAYDIALEMGDDLTSSLFAAKFTQGLEDQLSPP 771          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Mouse
Match: Ppp1r12b (protein phosphatase 1, regulatory subunit 12B [Source:MGI Symbol;Acc:MGI:1916417])

HSP 1 Score: 53.9138 bits (128), Expect = 9.721e-7
Identity = 38/105 (36.19%), Postives = 57/105 (54.29%), Query Frame = 1
Query: 2059 ISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLA 2373
            +++   G T E+++L   GA+ N  N  G+  +  A  + + D ++ L E  ANVN+ + E G T LH A S   LN  I    +  G+SV I N +GE P+DLA
Sbjct:   63 LAACSSGDTDEVKKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNE-GWTPLHAAASCGYLN--IAEYFISHGASVGIVNSEGEVPSDLA 164          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Mouse
Match: Ppp1r12b (protein phosphatase 1, regulatory subunit 12B [Source:MGI Symbol;Acc:MGI:1916417])

HSP 1 Score: 53.9138 bits (128), Expect = 1.002e-6
Identity = 38/105 (36.19%), Postives = 57/105 (54.29%), Query Frame = 1
Query: 2059 ISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLA 2373
            +++   G T E+++L   GA+ N  N  G+  +  A  + + D ++ L E  ANVN+ + E G T LH A S   LN  I    +  G+SV I N +GE P+DLA
Sbjct:   63 LAACSSGDTDEVKKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNE-GWTPLHAAASCGYLN--IAEYFISHGASVGIVNSEGEVPSDLA 164          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Mouse
Match: Ppp1r12b (protein phosphatase 1, regulatory subunit 12B [Source:MGI Symbol;Acc:MGI:1916417])

HSP 1 Score: 53.9138 bits (128), Expect = 1.002e-6
Identity = 38/105 (36.19%), Postives = 57/105 (54.29%), Query Frame = 1
Query: 2059 ISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLA 2373
            +++   G T E+++L   GA+ N  N  G+  +  A  + + D ++ L E  ANVN+ + E G T LH A S   LN  I    +  G+SV I N +GE P+DLA
Sbjct:   63 LAACSSGDTDEVKKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNE-GWTPLHAAASCGYLN--IAEYFISHGASVGIVNSEGEVPSDLA 164          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9NVP4|DZAN1_HUMAN (Double zinc ribbon and ankyrin repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=DZANK1 PE=1 SV=3)

HSP 1 Score: 402.134 bits (1032), Expect = 5.382e-127
Identity = 277/799 (34.67%), Postives = 417/799 (52.19%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIG--DKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKILNQDVYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYISGLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAK----QMMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKKNIDKDKPLTTN-----NIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKR----TGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQANDSD 2475
            ++++T +E+ S++ D +IY+T++G KPE  K IG  + +TFK+  P  LP GK  VKAIAVSKD  R+S IVTK+F +++      SP+    +V   L+D   +   N            + +K +  + +   +N NLR      L   +     YG      SG    T       +   S  +   ST+I+        R+QRETDFLKC +CLAPRPSDPF++FC  CG  +PP+   RLPPPE  Q+G+C  CRS VPMN   C+VCEA L +Q QPQA+  L+E+V+C  CGT NP ++  C+TCE  LP S + +   +   PP       +       +C +C R N  +A FC WCG  +   A    GC  C +CGA+NH +A FC  CG  + +  K    + +A   E       S++IPL   +   K                   D+ TQTVGLFYPS   L K   K++ L +       + D       +SPG+GYWR+Q++HI  HL+ +A N+ EF+A+I EPR+GKLI+A V E+  E+++ L ++    K+ Y+ K  + F    LSS  +      GS  S+ SD +  ++D      T     R +  K K   +K+ + +P       ++ LLKE+  +GEG+ + IE+L +EGA+PN  +    P I VA  N H +AI +L + GA++++      NTALHEA  L     +    LL C +S++ +N  G+T  DLAL   +++   L ++K G+   ++L + +  +  D
Sbjct:   26 IDNNTLLEMKSDTPDVNIYYTLDGSKPEFLKRIGYGENNTFKYIKPITLPDGKIQVKAIAVSKD-CRQSGIVTKVFHVDYEPPNIVSPE---DNVENVLKDSSRQEFKNGFV-------GSKLKKKYKNSENQRSWNVNLRKFPESPLEIPA-----YGGG----SGSRPPTRQSQSPGFAHVSGQKCLTSTEIM--------RIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICVVCEAPLALQLQPQASLHLKEKVICRACGTGNPAHLRYCVTCEGALPSSQESMCSGDKAPPPPTQKGGTI-------SCYRCGRWNLWEASFCGWCGAMLGIPA----GCSVCPKCGASNHLSARFCGSCGICVKSLVKLSLDRSLALAAEEPRPFSESLNIPLPRSDVGTKR------------------DIGTQTVGLFYPSGKLLAK---KEQELASQKQRQEKMSDHKPLLTAISPGRGYWRRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVN-FSDHLLSSAAEGDGGLCGSRSSWVSDYSQSTSD------TIEKIKRIKNFKTKTFQEKKEQLIPE------NRLLLKEVGPTGEGRVSVIEQLLDEGADPNCCDEDNRPVITVAVMNKHHEAIPVLVQRGADIDQQWGPLRNTALHEATLLGLAGRESTATLLGCNASIQKKNAGGQTAYDLALNTGDDLVTSLFAAKFGQGLEDQLAQTRSLSLDD 751          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q8C008|DZAN1_MOUSE (Double zinc ribbon and ankyrin repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Dzank1 PE=1 SV=2)

HSP 1 Score: 383.645 bits (984), Expect = 1.369e-119
Identity = 268/803 (33.37%), Postives = 419/803 (52.18%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIG--DKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKILNQD-VYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSST----NKKYGKTHDYISGLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKP--IKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCG------------NTIIAPAKQMMAFTNEMKEYQWNSISIPL-SNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQL-KKNIDKDKPLTTNNIWDKIVPS-NYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLK-RTGSFDSFRSDDTLQSNDLS-KPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKP 2454
            ++ +T +E+ S++ D +IY+T++G KP+  K +G  + +TFK+  P  LP GK  VKA+AVSKD  R+S IVTK+F++++     P   + ++D V   L+    +   N   +  PK      +K +    +   +N NLR +    +  R+      + ++ ++   I   +   +     +  +   F      K LT +    +R+QRETDFLKC +CLA RPSDPF++FC+ CG  +PP+   RLPPPE  Q+G+C  C S VPMN   C+VCEA L  Q +PQA+  L+ERV+C  CGT NP ++  C+TCE  LP + +       E+  PP +   +         +C +C  QN  +A FCDWCG  +   A+       C +CGA+NH  A FC  CG            N++   A     F        W S+++PL ++ +G  K                   D  TQT GLFYPS   L KK ++               P    VSPG+GYWRKQ++HI  HL+++A N+ EF+A+I EPR+GKLI+A V E+  E+++ L +     K  Y  K+ +  D  +LSS+ +   G +DS  S  +  S  +S  P+      +           K +S  V    L+  +K LL+E+ SSG+G+ + +E+L +EGA+PN  + +G P +IVA  N H +AI +L + GA++++    F NTALHEA  L     + I  LL C ++ + +N +G+T  D+AL   +++   L ++K  +   ++L+ P
Sbjct:   26 IDTNTLLEMKSDTPDVNIYYTLDGSKPDFLKKVGSGENNTFKYVKPITLPDGKIQVKAVAVSKD-CRQSGIVTKVFQVDY----EPPKMVSSEDNVEDALKGFSKQELKNG--FVGPK-----LRKKYKNAENKSTWNVNLRRLADLKVGERADPKTLKDLRFAESPLEIPAYHEGASARLPTHQAQSPGFAHITGQKSLTSTEI--MRIQRETDFLKCAHCLASRPSDPFARFCHECGAPVPPIFGYRLPPPEGAQMGLCAECGSMVPMNTPICVVCEAPLAPQLRPQASLYLKERVICRTCGTGNPAHLRYCVTCEGPLPPTQEQWLCNGDEVPHPPARNGET--------ISCSRCGCQNLWEASFCDWCGAMLGISASHS----VCPKCGASNHLTARFCGSCGIYVKSITRFRMHNSLAIVAGAPRPFPEPRS--AWQSLNVPLPTSASGSKK-------------------DTGTQTSGLFYPSGKLLAKKELEAASHRQRQEKMSDHRPVLTAVSPGRGYWRKQLDHISAHLRSYAQNNPEFRALIAEPRMGKLISATVHEDGYEVSIRLNYIQVSNKSLYFNKSVNLSD-HFLSSVTEGGNGLYDSRSSLVSAYSQSVSDTPESIKKMKNL----------KAKSFLVNPEPLTPENKLLLEEVGSSGKGRLSVLEQLLDEGADPNCCDSQGRPAVIVAVVNKHYEAIPVLAQRGADIDQQWGPFRNTALHEATLLGLEGRESIATLLGCNANAQKKNTRGQTAYDIALEMGDDLTSSLFAAKFTQGLEDQLSPP 770          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9GKS9|DZAN1_MACFA (Double zinc ribbon and ankyrin repeat-containing protein 1 OS=Macaca fascicularis OX=9541 GN=DZANK1 PE=2 SV=2)

HSP 1 Score: 350.132 bits (897), Expect = 7.272e-109
Identity = 229/654 (35.02%), Postives = 341/654 (52.14%), Query Frame = 1
Query:  577 TNKKYGKTHDYISGLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTI-----IAPAKQMMAFTNEMKEYQ-----WNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKK-------------NIDKDKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSML----KRTGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPK 2457
            T++ + + H + S L +E  +  D    +   F      K LT +    +R+QRETDFLKC +CLAP PSDPF++FC  CG  +PP+   RLPPPE  Q+G+C  CRS VPMN   C+VCEA L +Q QPQA+  L+E+V+C  CGT NP ++  C+TCE  LP S + I   +   PP       +       +C +C R N  +A FC WCG  +   A    GC  C +CGA+NH +A FC  CG  +     ++  + +     E + +      W S++IPL   +   K                   D+ TQTVGLFYPS   L K              +   KPL T            +SPG+GYWR+Q++HI  HL+ +A N+ EF+A+I EPR+GKLI+A V E+  E+++ L ++    K+ Y+ K  + F    LSS      +  GS  S+ SD +  ++D      T     R R  K K   +K+ + +P       ++ LLKE+  +GEG+ + IE+L +EGA+PN  +    P I VA  N H +AI +L + GA++++      NTALHEA  L     + +  LL C +SV+ +N  G+T  DLAL   +++   L ++K G+   ++L + +
Sbjct:    3 TSESFQRVH-WKSQLTVEDQV-LDHPPAQSPGFAHISGLKCLTSTEI--MRIQRETDFLKCAHCLAPCPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICVVCEAPLALQLQPQASLHLKEKVICRACGTGNPAHLRYCVTCEGALPSSQESICSGDKASPPPTQKGGTI-------SCSRCGRWNLWEASFCGWCGAMLGIPA----GCSVCPKCGASNHLSARFCGSCGICVKSLVKLSLDRSLALAAQEPRPFSEPQCAWQSLNIPLPRSDAGTKR------------------DIGTQTVGLFYPSGKLLAKKELEIASQKQRQEKMSDHKPLLT-----------AISPGRGYWRRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVN-FSDHLLSSAAEGDGELCGSRSSWVSDYSQSTSD------TIEKIKRIRNFKTKTFQEKEEQLLPE------NRLLLKEVGPTGEGRVSVIEQLLDEGADPNCCDEDNRPVITVAVMNKHHEAIPVLVQRGADIDQQWGPLRNTALHEATLLGFAGRESVATLLGCNASVRKKNAGGQTAYDLALNTGDDLITSLFAAKFGQGLEDQLAQTR 599          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. UniProt/SwissProt
Match: sp|P25963|IKBA_HUMAN (NF-kappa-B inhibitor alpha OS=Homo sapiens OX=9606 GN=NFKBIA PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.782e-6
Identity = 37/114 (32.46%), Postives = 59/114 (51.75%), Query Frame = 1
Query: 2134 NGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQANDSD 2475
            N  G   + +A+ + +   + LL  LGA+VN  EP  G TALH AV L+  NPD+++ LL CG+ V     +G +P  L   + +      I  +LG+  +E L    ++ D +
Sbjct:  180 NYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQ--NPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPS----TRIQQQLGQLTLENLQMLPESEDEE 287          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q08353|IKBA_PIG (NF-kappa-B inhibitor alpha OS=Sus scrofa OX=9823 GN=NFKBIA PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.932e-6
Identity = 37/114 (32.46%), Postives = 59/114 (51.75%), Query Frame = 1
Query: 2134 NGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQANDSD 2475
            N  G   + +A+ + +   + LL  LGA+VN  EP  G TALH AV L+  NPD+++ LL CG+ V     +G +P  L   + +      I  +LG+  +E L    ++ D +
Sbjct:  180 NYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQ--NPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPS----TRIQQQLGQLTLENLQMLPESEDEE 287          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. TrEMBL
Match: A0A1S3HKC0 (double zinc ribbon and ankyrin repeat-containing protein 1 OS=Lingula unguis OX=7574 GN=LOC106156033 PE=4 SV=1)

HSP 1 Score: 491.5 bits (1264), Expect = 2.689e-158
Identity = 309/820 (37.68%), Postives = 458/820 (55.85%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIG--DKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKILNQDVYGFLEDIKNRN--------------NSNDLYYQEPKASSQETQK---------SHDRNNSTGIYNPNLRSITPQHLTTRSSTNK-KYGKTHDYISGLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAK--------QMMAFTNEMKE---YQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDV-STQTVGLFYPSTAQ-LKKNIDKDKPLTT-NNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKRTGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQA 2463
            ++ DTKIE+AS + +TDIY+T+NG KP+PF+ +G  D+ T K+  PF LPAGK  VKA+AVSKDG RESNIV+K FE+E++E   P P   + D   F +D++ R               +S + +  E   + +ET+          SH R   TG    N R  +P   T R +  +   G+  D  +  ++   ++                ++   D+   S+RLQRETDFLKCIYC APRPSDP+ +FC +CG ++PPLPQ+RLPP E GQ+G C+HC S VP N   C++CEA +  QNQPQA+ +L+++++C +C T NP N  +CL CEA+LP S +PI    ++ PP  + +  L        C KC R NNTDAR+CDWCG K +     +   LTCS+C A+N   + FC  CG TI+ P +             T+  +E    QW  +S+P+        P  +            +P D  +TQTVGL++PS  + +KK + +++ L     I D+      +SPG+GYWRKQ+EHI  HLK +A N++EF+A IGEPR+GK+++A V E+  E+TL + FAL+G +DP      ++ +     + ++R+       +    +   L   +     S+     K     KK+        LS  DK+LLKEI  +G+G+  E+ +L +EGA+P+  N  G P ++VA  N H + I +L + GA+VN+  P  GNTALHEAVSL S   ++I  LL C ++   +N KGET  DLA+    +  VK +++ +G+  ++KL KPK A
Sbjct:   26 VDSDTKIELASVTTNTDIYYTLNGSKPDPFQPLGTGDRVTMKYKKPFTLPAGKVIVKAMAVSKDGVRESNIVSKTFEVEYIEPELPDPGGGDDDGQNFQDDMEVRTKSKAGRSFMKKLLASSKNRHAWEETDTMRETEHRMTDLHINGSHHRKPKTGPRFMNTRLSSP---TERGTVGQDTVGRMSDVWASGDMYNGLE---------------KSRPRPDNYTQSMRLQRETDFLKCIYCYAPRPSDPYVRFCGDCGNALPPLPQSRLPPTEPGQIGRCVHCNSMVPFNTYTCVICEAPIPPQNQPQASMRLQDKLICPLCATANPTNFSNCLACEARLP-SARPIH-TGMSAPPLPSQSGEL------MTCTKCGRVNNTDARYCDWCGSKPA----PFGQSLTCSKCNASNPRYSKFCGTCGVTILPPFRVDPRNTGTTHADVTDTFRESVSAQWLPVSLPM--------PRPV-----------EIPKDTRATQTVGLYFPSEREIIKKQLAEEEKLAMEKQIRDRKPLLTAISPGRGYWRKQMEHIGTHLKVYAQNNAEFRAEIGEPRMGKILSASVHEDGYELTLTVNFALRGDRDPLT---GNKLNLMASEAYMRRSNGIMGSTNSIATEEESLVSERSASRRSTTKGGRKTIKKAKKKKVVKVEEKLSVEDKALLKEIGKNGQGRVNEVTQLIDEGADPSCVNKDGYPALMVAVTNQHANVIPVLVQEGADVNKKGPNKGNTALHEAVSLGSKGMEVIETLLGCSANPNKKNDKGETAYDLAVKAGEDRIVKKLAASMGQNALDKLIKPKSA 793          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. TrEMBL
Match: R7VBU3 (ANK_REP_REGION domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_151808 PE=4 SV=1)

HSP 1 Score: 486.493 bits (1251), Expect = 1.395e-156
Identity = 302/814 (37.10%), Postives = 443/814 (54.42%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIGD--KHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKILNQDVYGFLEDI-----------------KNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYISGLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAKQ---------MMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQL--KKNIDKDKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKRTGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQANDSD 2475
            ++ +T++E+ SE+    IY+T NG KPEPF V G   K TFK+  PFCLP GKRTVKA+AVS DG RES++++K F++E +E+   SP     D   F+ D+                 +  N  N L       SSQE Q+  D  +                L TR       G     +     +TN           EF   +  ++  D++  ++RLQRETDFLKC+YC APRPSDP+++FCN CG  +P +PQ RLPPPE GQ+G C+ C S VP N S+CLVCEA +  QN PQA+ KL ER +C++CGT NP N+ +C+TCE++LP  G  I    L+  P       L S      C KC+R NN DAR+CDWCG K     ++    L C++C ANN+  A  C  CG  +  P +           M    +  + QW  +++P +                          D++TQTVGLF+PS  ++  K   ++DK      + D+      +SPG+GYWRKQ+EH+  HLKA+A+N+ EF+A+IGEPR+GKL +  V E+  E++L + FAL+G  DP+V K      + +LSS    TG   S +S  +++S   ++           R  K+     KQ+K++ + + +E DK LL+E+   G G   E+ +L +EGA+P+  N  G+P + +A  N H DAI +L + GA+VN   P  GNTALHEAV L +   ++++ LL CG++ + +N K ET  D A+   +E  VK +++K+G+  ++KLTKP+ +   D
Sbjct:   26 IDTNTRLELRSETAGATIYYTTNGGKPEPFLVHGPAAKSTFKYREPFCLPGGKRTVKALAVSDDGLRESHVMSKTFDVEQLET---SPLRNQDDAINFVNDLPANEVMRKFASKMVTSKEAWNEVNRLKDTAAGQSSQERQEYQDGRHFC-------------ELLTR-------GFFFHPVELFTFQTN-----GLNGSPEFTSPLK-RLPPDTATQTMRLQRETDFLKCVYCFAPRPSDPYARFCNECGNPVPAMPQNRLPPPEPGQMGTCVSCGSHVPFNTSSCLVCEAPIGPQNTPQASIKLTERRMCSMCGTANPCNLTTCVTCESRLPTVGTSI-FHGLSPAPAPRDDGRLQS------CTKCSRVNNPDARYCDWCGAKPLPTTSN----LICAKCEANNNPYAKHCASCGAILEPPMRADARNGGVTLNMTSGQQTMQAQWTPVTLPAT---------------------PTAKYDMATQTVGLFFPSQKEINAKDKEEEDKLAIERQMRDRKPLMTAISPGRGYWRKQMEHVCAHLKAYAANNPEFRALIGEPRMGKLTSGTVHEDGYELSLTVNFALRGTNDPFVGKPMG-VSRDFLSSYT--TGRKSSLKSYGSMESLSSAQSTARSGKKKSARKVKKTKKISKQTKTLEDDLTTE-DKQLLQELGKGGSGSVEEVHQLIDEGADPSCVNRDGIPVLHLAVLNKHVDAIPVLVQEGADVNRKGPNRGNTALHEAVGLGTGGHEVVDVLLGCGANPQKKNDKNETAYDFAVKAGHETIVKKLAAKVGQSALDKLTKPRSSQTID 774          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. TrEMBL
Match: V4CHK7 (ANK_REP_REGION domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_238231 PE=4 SV=1)

HSP 1 Score: 472.626 bits (1215), Expect = 1.732e-151
Identity = 294/798 (36.84%), Postives = 444/798 (55.64%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIGDKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKIL--NQDVYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYISGLNLETNMDTDKNYKRK--------SEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIE-LNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAKQMMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPST-------AQLKKNIDKDKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKRTGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEF--GNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPK 2457
            ++ +TKIEI S++ ++ I++T+NG  PEPFK IG K T ++  PF LPAG++TVKA+AVS+DG RES +VTK F++++V+     P IL    D  GF +D+    +   +     K ++ ++  + D   ++  Y+          +    STN++    H     LN      +DK+Y+ +             + + ++  D++  +LRLQRETDFLKCIYC A RPSDPF +FCN CG S+P +P    P  E GQ+GMC++C+S VPMN + C+VCE  + +QNQP+A  KL ++ +C++CGT NP N+ +C+TC+++LP + +   M+  ++ PP     SN   D  F  C KC+R NN DARFCDWCG K S         L CS+CGA+N+  +++C  C   I AP +         K     S+ +P++             Q  S   R  V  + STQTVGLFYPS        A  +K + + KPL T            VSPG+GYWRKQ+EH+  HLK +  N+++F+A+IGEP++GKLIT+ VQE+  E++L + F L+G  D           + YLS    R     + R+D     +++  P+     + +    K+K +  K         LS +D+ LLKE+S  GEG  TE+++L +EGA+ N  +  G+P I VA RN   D I +L + G ++N+  P    GNTALH+A++L      +I+ LL+ G++   +N +GETP DLA     +  V   +S LG  Q+ K+TKP+
Sbjct:   26 IDSNTKIEIKSDTRNSPIHYTINGSTPEPFKKIGQKCTLQYHGPFTLPAGRQTVKAVAVSEDGMRESYVVTKTFDVDYVK-----PPILPPEDDDLGFQQDLNLERSKLQVKRAVSKVTTPKSAWNDDHFGASQRYS---------DMRVTGSTNRR---PHSGTRFLNSRMGHTSDKSYRTEPLDSLDLARSESRRSARRLPPDNTTQALRLQRETDFLKCIYCFADRPSDPFCRFCNTCGNSLPEIPAKLTPA-EPGQMGMCVYCKSMVPMNTTACIVCEGPIKIQNQPKANIKLHDKTVCSLCGTANPSNLVTCVTCDSRLPTTAQQRAMLNGVSAPP----VSN--PDRKFVRCDKCSRVNNGDARFCDWCGCKASAPPT----LLQCSQCGASNNVYSSYCGGCAVKIEAPGRTEYKLDGSGK-----SLFLPVT-------------QTSSHAPRPIV--NASTQTVGLFYPSRGPSKSEEATFEKQLKERKPLLTP-----------VSPGRGYWRKQVEHVCQHLKIYTQNNADFRALIGEPKMGKLITSTVQEDGYELSLTMTFPLRGGSDKQTGSKLGVSHQGYLSQHTLRD---TTDRTDSEDYDSEIETPKAHKKKTVKKTKAKKKQTGPK---------LSTLDQQLLKELSHEGEGVATEVQQLLDEGADVNCVDKNGLPAIYVAVRNKQVDCIPVLIDGGVDINKKGPSALKGNTALHDAINLGPSGLHVIDVLLENGANQNRKNDRGETPLDLAKKAGFDSIVTKFASALGMSQLAKMTKPR 752          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. TrEMBL
Match: A0A2B4SEB8 (Double zinc ribbon and ankyrin repeat-containing protein 1 OS=Stylophora pistillata OX=50429 GN=DZANK1 PE=4 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 2.332e-148
Identity = 301/808 (37.25%), Postives = 456/808 (56.44%), Query Frame = 1
Query:  121 FLNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIGDKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIF---EIEHVESVNPSPKI--LNQDVYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYISGLNLETNMDTDKNYKRK-SEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLI--FANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAKQMMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVP------CDVSTQTVGLFYPSTAQLKKNIDKDKPLTTNNI---WDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEE--DTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKRTGSFDSFRSDDTLQSNDL--SKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQANDSDDE 2481
             ++  T IE+ SE+ DT IY+T+NG KPEPFK IG K T+K++ PF L  GKRTVKA+A S DG+RES+IVTK F   E E  E ++    +  L Q +     ++  R++S  L+ Q  + +   ++        T   +    + TP  L     ++ +  ++    +     +N  T     +  +E + ++  K    +   + ++Q++TDFLKCIYC+APRPSDP+++FC+ CG  IPPLP +RLPPPE GQLGMC+ C S VP+N  NC++CEA ++ Q QPQAT KL  +++C +CGT NPP+M  C+TCEAKLP + K I     + PP       +P D +  F +C KC+R N++DARFCDWCG K       Y   L CS+C A+N+  A FC  CG +I  P +         ++   N I   +  K  I   ET+     + ++  ++P       D +T TVGLFY S   ++  ++ D  L  + +    D+      VSPGKG+WR+Q++H+  H++AH  N+ +F+A IGEPR+GK+I+A + E+    E+TL + FA +  K+ +  K+      R LSS L+   + + +RS+   +  DL  S+ Q      +  +  K+K   K+ +K+ P    SE DK LLKEI + GEG+  E++RL +EGANP  ++  G+P II+AT N H ++I  L   GA +N      GNTALHEAV L +     I+ LL   +   I N  G+T  DLA++   +   +  +S +G + ++KLTKPK+A   D++
Sbjct:   24 LIDTHTPIELRSETPDTLIYYTINGMKPEPFKQIGIKCTYKYNRPFVLGPGKRTVKAMATSSDGTRESSIVTKTFMVEEPEEREGLDGEGNVSELQQSISSSTGNL--RDSSGTLFGQILENARGGSKLKTSEAWGTETKSKRFLTSTPDDLENVRGSDYRKPRSEARFTTSRFGSNQATLGTPDQSLAEVDGELKEKRGPQNRIHASKIQQQTDFLKCIYCMAPRPSDPYARFCSECGSPIPPLPSSRLPPPEGGQLGMCVSCNSMVPLNTPNCIICEAPISPQRQPQATKKLAHKLMCAVCGTGNPPDMTVCVTCEAKLPYNAKQI-FTATSAPP-------MPKDSVSSFMSCSKCSRVNSSDARFCDWCGSK----PQPYQSPLICSQCQASNNAFARFCNTCGCSIEPPPRV-------SRQSPGNVIGT-VVEKRSIR--ETVGRSENTTWLPVSIPSTPAEKADKATSTVGLFYKSATSIQSQMESDA-LERSRLDASRDRRPALAAVSPGKGFWRQQMDHVCSHIRAHTQNNPDFRATIGEPRLGKIISATIHEDLNGEEVTLTVTFARRDGKELWKEKS------RALSSSLR---ALNLYRSESGSR-EDLRGSRKQTQNGLRTTAKGKKQKRKGKENNKAKP----SEQDKLLLKEIGAKGEGRDEEVKRLLDEGANPECESSDGIPAIILATMNKHAESIPPLVNAGAKINVKGITKGNTALHEAVLLGANGLKCIDTLLGLSARTNIANDAGQTAYDLAMSSGLDSVAQKFTSSVGDEMLQKLTKPKKARSVDED 792          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. TrEMBL
Match: A0A3M6UCI4 (ANK_REP_REGION domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00012623 PE=4 SV=1)

HSP 1 Score: 460.685 bits (1184), Expect = 2.061e-146
Identity = 295/806 (36.60%), Postives = 451/806 (55.96%), Query Frame = 1
Query:  121 FLNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIGDKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIF---EIEHVESVNPSPKI--LNQDVYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYISGLNLETNMDTDKNYKRK-SEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLI--FANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAKQMMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVP------CDVSTQTVGLFYPSTAQLKKNIDKDKPLTTNNI---WDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEE--DTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKRTGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQANDSDDE 2481
             ++  T IE+ SE+ DT IY+T+NG KPEPFK IG K T+K++ PF L  GKR VKA+A S DG+RES+IVTK F   E E  E ++    +  L Q +     ++  R++S  L+ Q  + + + ++        T   +    + TP  L     ++ +  ++    +     +N  T     +  +E + ++  +    +   + ++Q++TDFLKCIYC+APRPSDP+++FC+ CG  IPPLP +RLPPPE GQLGMC+ C S VP+N  NC++CEA ++ Q QPQAT KL  +++C +CGT NPP+M  C+TCEAKLP + K I     + PP       +P D +    +C KC+R N++DARFCDWCG K       Y   L CS+C A+N   A FC  CG  I  P +         ++   N I   +  K  I   ET+     + ++  ++P       D +T TVGLFY S   ++  ++ +  L  + +    D+      VSPGKG+WR+Q++H+  H++AH  N+ +F+A IGEPR+GK+ITA + E+    E+TL + FA +  K+ +  K+      + LSS L+    + S    ++    DL + +K      R  T  +K   K +  +   + LSE DK LLKEI + GEG+  E++RL +EGANP  ++  G+P +I+AT N H ++I  L   GA +N      GNTALHEAV L +   + I+ LL  G+   + N  G+T  DLA++   +  V+  +S +G + ++KLTKPK+A   D++
Sbjct:   24 IIDTHTPIELRSETPDTLIYYTINGMKPEPFKQIGIKCTYKYNRPFVLGPGKRIVKALATSSDGTRESSIVTKTFMVEEPEEREGLDGEDNVSELQQSISSSTGNL--RDSSGTLFGQILENAGRGSKLKTSEAWGTAGQSKRFLTSTPDDLENVRGSDYRKPRSEARFTASRFGSNQATLGTPDQSLTEVDGELKERRGPQNRIHASKIQQQTDFLKCIYCMAPRPSDPYARFCSECGSPIPPLPSSRLPPPEGGQLGMCVSCNSMVPLNTPNCIICEAPISPQRQPQATKKLAHKLMCAVCGTGNPPDMTVCVTCEAKLPYNAKQI-FTGTSAPP-------MPKDSVSSLMSCSKCSRVNSSDARFCDWCGSK----PQPYQSPLICSQCQASNSAFARFCNTCGCGIEPPPRV-------SRQSPGNVIGT-VVEKRSIR--ETVGRSENATWLPVSIPSTPAEKADKATSTVGLFYKSATSIQSQMESEA-LERSRLDASRDRRPALAAVSPGKGFWRQQMDHVCSHIRAHVQNNPDFRATIGEPRLGKIITATIHEDLNGEEVTLTVTFARRDGKELWKEKS------KALSSSLRALNLYGS----ESGSKEDLRRSRKQTQNGLRTTTKGKKQKRKGKENTT--IKLSEQDKLLLKEIGARGEGRDEEVQRLVDEGANPECESSDGIPALILATINKHAESIPPLVNAGAKINVKSITKGNTALHEAVHLGANGLNCIDTLLGLGARTNVANDAGQTAYDLAMSSGLDSVVQRFTSSVGDEMLQKLTKPKKARSVDED 792          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Cavefish
Match: dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:ZFIN;Acc:ZDB-GENE-051113-296])

HSP 1 Score: 221.861 bits (564), Expect = 6.527e-63
Identity = 140/406 (34.48%), Postives = 214/406 (52.71%), Query Frame = 1
Query:  727 RLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLP-SDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATF--CCQCGNTIIAPAKQMMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKKNIDKDKPLTTNN--IWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYV----RKNSDEFDKRYLSSMLK-RTGSFDSFRSDDTLQ 1914
            R+Q ETDFL+C  CL+ RPSDPF++FC +CG  +PP+P  RLPP E G++ +C+ C+S VP N S+C+VCE  L  Q QPQA+ +L+++++C  CGT NP ++  C+TCE +LP+  K    +  + PP       LP ++    +C KC R N++DARFCDWC                    GA   H  +   C  CG  +  P +     T  +                       L +  GS+  R     D  TQT G+FYPST  L++   + +        + D+      +SPG+GYWRKQ++HI  HL+++  N+SEF+A+IGEPR+G+L++  ++E+  E++L + F     + P      + N   ++   LS++ + R     S  S  TLQ
Sbjct:  153 RIQLETDFLRCTTCLSHRPSDPFARFCLHCGAPVPPIPGQRLPPTEGGRMMLCVQCKSMVPANTSSCVVCEVPLAPQLQPQASLRLQDKLICQSCGTGNPAHITYCVTCETRLPQIDK---TLSRSAPP-------LPCTEGKMVSCPKCKRVNHSDARFCDWC--------------------GAKPGHVRSLVRCSHCGLFLEGPPRPPPRTTQPVSS-------------------SVLDVVAGSVAER----LDAQTQTTGIFYPSTTDLQRRSQRREEELNRQEKMSDRKPLLTAISPGRGYWRKQLDHICAHLRSYTQNNSEFRALIGEPRMGRLVSVVIEEDSYEVSLRINFISAAPQRPTSCATGQMNGSVYEGHSLSAVTEGRATRATSLSSIGTLQ 505          

HSP 2 Score: 67.0106 bits (162), Expect = 5.159e-11
Identity = 32/83 (38.55%), Postives = 54/83 (65.06%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKV--IGDKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVES 366
            ++  T +EI S+S D  +++T++G KPE  +   +    T  +S P  LP+GK +V+A+AV+ DG R+S +VTK+F +E + S
Sbjct:   26 IDTSTPVEIKSDSPDVSVFYTLDGSKPEVLRRPEVRGSSTMTYSEPIYLPSGKVSVRALAVTSDG-RQSAVVTKVFVVEQIPS 107          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Cavefish
Match: anks3 (ankyrin repeat and sterile alpha motif domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-080204-51])

HSP 1 Score: 59.6918 bits (143), Expect = 1.008e-8
Identity = 41/110 (37.27%), Postives = 59/110 (53.64%), Query Frame = 1
Query: 2101 LFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEI-EPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGR 2427
            L ++GA   GK+G+G   ++ +T N H+  ++ L  L  N N I +P FG T L EA +  S +  I+  LLD G+ V+ RN KGET   LA+T  +     LI     R
Sbjct:  123 LLQQGAELEGKDGRGWTALLHSTSNRHQQMVKFL--LDNNANAISKPVFGFTPLMEAAA--SGHEIIVQYLLDHGARVEERNSKGETARVLAMTYGHTKIASLIDMHCMR 228          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Cavefish
Match: anks3 (ankyrin repeat and sterile alpha motif domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-080204-51])

HSP 1 Score: 59.6918 bits (143), Expect = 1.107e-8
Identity = 41/112 (36.61%), Postives = 60/112 (53.57%), Query Frame = 1
Query: 2101 LFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEI-EPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQ 2433
            L ++GA   GK+G+G   ++ +T N H+  ++ L  L  N N I +P FG T L EA +  S +  I+  LLD G+ V+ RN KGET   LA+T  +     LI     R +
Sbjct:  123 LLQQGAELEGKDGRGWTALLHSTSNRHQQMVKFL--LDNNANAISKPVFGFTPLMEAAA--SGHEIIVQYLLDHGARVEERNSKGETARVLAMTYGHTKIASLIDMHCMRAK 230          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Cavefish
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:103046804])

HSP 1 Score: 53.5286 bits (127), Expect = 9.571e-7
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 2059 ISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDL------ALTKNNEIAVKLISSKLGRKQVEKL 2445
            +++   G T E+ RL + GA+ N  N  G+  +  A  +++ D +  L E GA +N+ + E G   LH A S   +  DI   L+  G+SV + N +GETP D+           NEI  + +  +  RK+ E++
Sbjct:   45 LAACSSGDTEEVLRLLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGACINQPDNE-GWIPLHAAASCGYM--DIAEYLISQGASVGVVNSEGETPLDIAEEEAMEELLQNEINRQGVDIEAARKEEERI 176          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Cavefish
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:103046804])

HSP 1 Score: 53.1434 bits (126), Expect = 1.159e-6
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 2059 ISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDL------ALTKNNEIAVKLISSKLGRKQVEKL 2445
            +++   G T E+ RL + GA+ N  N  G+  +  A  +++ D +  L E GA +N+ + E G   LH A S   +  DI   L+  G+SV + N +GETP D+           NEI  + +  +  RK+ E++
Sbjct:   45 LAACSSGDTEEVLRLLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGACINQPDNE-GWIPLHAAASCGYM--DIAEYLISQGASVGVVNSEGETPLDIAEEEAMEELLQNEINRQGVDIEAARKEEERI 176          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Sea Lamprey
Match: dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:ZFIN;Acc:ZDB-GENE-051113-296])

HSP 1 Score: 396.356 bits (1017), Expect = 7.557e-126
Identity = 279/831 (33.57%), Postives = 423/831 (50.90%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIG--DKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKIL---NQDVYGFLEDIKNRNNS-----------NDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYISGLNLETNMDTDKNYKRKSE-FEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLR-ERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELN----QPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAKQ--------MMAFT----NEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKKNIDK--DKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKRTGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEE--------------GANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQAN 2466
            ++ +T I I S++ +  IYF+V+G KPE  K  G  + +  K+  PF L  GKRTVKA+AV++DG RES +VTK+F +E+      +P+ L     +   FL + +N+  +           N +  QE K++  +T +        G++           +T   S  ++       + G  +    D+   +   S+      ++   T  S  +LRLQ+E ++LKC  CLA RPSDPF+ FC  CG ++PP+P    PPP+  ++ +C+ C+S VP N  NC+VCE  +  +  PQA+   + + VLC  CGT NP N+  C+TCE +LPE+     M+  +     PP QT      +D    NC KC R NN+DARFCDWCG K S    SY   L C++CGA +H  A FC  CG  +  PA+         +M        +     W  +S+PL          +L +Q            D +TQTVGLFYPS   L++ + +   K +  + + D+  P   VSPGKGYWRKQI+H+  HL+++  N++EF+A+IGEPR+GK+++A VQEE   + L L F L+   D  V   S       +S   +R GS    ++      +  S  Q +  +  + R        KK+   +    +S  ++ LL+E+ +SG G+   ++RL  E              GA+PN  + +G P + +A  N H  AI +L E GANV++      NTALHEAV L +     +  LL C +S+K RN +G T  DLA+   N+  V L +S  G+  +EKLT+ K A+
Sbjct:   26 IDSNTYIAIKSDTPEVLIYFSVDGSKPELLKKPGHNEMNAMKYKGPFTLNEGKRTVKAMAVTRDG-RESGVVTKVFLVEYA-----APQHLAGPEDNAENFLLEYQNQRETLEGLKTTTDVINKVVNQEQKSAWGDTTQKMK-----GLFT---------EMTLDGSRRQRPRTGKRIMEGGPISPGRDSGLPFSHSSQSLLSDATSPTKTLFSSQTLRLQKELEYLKCAKCLAARPSDPFALFCQECGCTLPPVPGPSQPPPKAEKMILCLSCKSMVPTNTLNCIVCEVPIPGKTPPQASKVTKKDMVLCKACGTGNPANVKHCVTCETRLPET----PMVAFSTISVAPPPQT------TDKRLLNCSKCGRLNNSDARFCDWCGAKPSPPV-SY---LACTKCGATSHSEARFCGTCGTYLDPPARLNAKPPTAVVMGLPCCSWRQPLRASWQMVSLPLVRA-------SLGLQTA----------DQATQTVGLFYPSGRGLEQKVQEVSTKRVQQDRMSDRRPPITAVSPGKGYWRKQIDHVCAHLRSYTQNTTEFRALIGEPRMGKIMSATVQEEGDILNLTLKFVLR---DNEVSNYSLLLLNHSVSLGERRGGSLHGSQASLGGSYSLSSSDQASVGSDMKLRNI-----KKKKKAFLKEDTMSAENRQLLEEVGTSGRGQAEFLQRLLNEAAPFLPHVETNITQGADPNLVSFEGRPVLTLAVMNRHATAISILVEAGANVDQASGLINNTALHEAVELGAQGVKCVEALLACNASLKKRNDRGMTAQDLAVAGGNDCLVTLFASHFGQSLLEKLTQAKPAS 797          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Sea Lamprey
Match: CDKN2D (cyclin dependent kinase inhibitor 2D [Source:HGNC Symbol;Acc:HGNC:1790])

HSP 1 Score: 51.6026 bits (122), Expect = 3.898e-8
Identity = 42/125 (33.60%), Postives = 62/125 (49.60%), Query Frame = 1
Query: 2050 LKEIS-SSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKL 2421
            ++E+S ++  GKT E+E L   G NPNG N  G   I V    +   A R L   GA+ +  +   G T  H+A   R     ++ EL   G+S+  R+K G TP DLA  + +   V  I+S +
Sbjct:    7 IEELSKAAALGKTVEVELLLARGVNPNGTNSCGRTPIQVMMMGSTPVA-RALLAAGADPDVRDAVLGLTPAHDAA--REGFVAVLAELRAAGASLWQRDKLGRTPADLAAAEGHLDVVDFINSAV 128          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007954.1 (pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gene:ENSPMAG00000007165.1 transcript:ENSPMAT00000007954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 6.580e-8
Identity = 38/112 (33.93%), Postives = 59/112 (52.68%), Query Frame = 1
Query: 2077 GKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDL-ALTKNNEIAVKLI 2409
            G T  ++ L   GA+ N K+ KG   +  A  + H   +RLL  L A +NE    FGNTALH  V+  +    +++ELLD G+    RN++G T     A + +  I ++L+
Sbjct:   91 GHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFN-GFGNTALH--VACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELL 199          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.305e-7
Identity = 32/95 (33.68%), Postives = 55/95 (57.89%), Query Frame = 1
Query: 2077 GKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETP 2361
            G T  ++ L   GA+   K+ KG   +  A+ +     ++LL +LG ++++    FGNTALH  V+  +    ++NEL+DCG++V   N++G TP
Sbjct:  182 GHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPN-SFGNTALH--VACYNGQDVVVNELIDCGANVNQANERGFTP 273          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004672.1 (pep scaffold:Pmarinus_7.0:GL477315:17052:39954:-1 gene:ENSPMAG00000004227.1 transcript:ENSPMAT00000004672.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 1.069e-6
Identity = 37/107 (34.58%), Postives = 53/107 (49.53%), Query Frame = 1
Query: 2083 TTEIERLFEEGANPNGKNGKGV-PFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAV 2400
            T  +  L  +G + +  +  G+ P +  A R    D  RLL    A VN  +    NTALH AV   + N ++I  LLD G++V  +N KGE+  DLA  + N   V
Sbjct:  174 TAIVAYLIAKGLDVDMMDQNGMTPLMWAAYRTYGVDPTRLLLTFNATVNLGDKFHKNTALHWAV--LASNTNVIGLLLDAGANVDAQNVKGESALDLAKQRKNAWIV 278          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Nematostella
Match: EDO34794 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN94])

HSP 1 Score: 311.612 bits (797), Expect = 5.501e-97
Identity = 209/576 (36.28%), Postives = 300/576 (52.08%), Query Frame = 1
Query:  754 KCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAKQMMAFTNEMKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPC------DVSTQTVGLFYPSTAQL--KKNIDKDKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEE--DTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKRTGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTK 2451
            KCI+C A RPSDPF++FC  CG  +PP+PQ+RLPPPE G+LGMC+ C S VPMN +NC+VCE  +  Q QPQAT KL  +++C  CGT NPP++  C+TCEA+LP+  K I     N PP     S++ S   F  C KC R N++DAR+CDWCG K S     Y   + CS+C A+N   + FC  CG TI  P +     T+ M     +S+   L  K+ I   E +   + + ++  ++P       D +T TVGLFYPS+  L  +  ++  +        D+      VSPG+GYWR+Q++H+  HL+AHA N+ +F+++IGEPR+GK+I+A V E+    E+TL +          Y R++  E  K         TG     +  + L   +L                      K Q +        EV++ L                   +EGANP+ +   G P II AT N H D +  L   GANVN      GNTALH AV L       ++ LL  G+   ++N  G+TP DLA++  ++   K  +S +G + ++KLTK
Sbjct:    1 KCIFCFAARPSDPFARFCTECGSPLPPMPQSRLPPPEGGKLGMCVSCHSMVPMNTTNCIVCEVPIPPQWQPQATKKLLAKLVCVSCGTANPPDLKVCVTCEARLPQDAKQI-YSGTNAPP--IPKSDMGS---FITCSKCTRVNSSDARYCDWCGEKPSL----YLSPIVCSQCEASNKPFSRFCNSCGCTIDPPPR----VTHSMA----SSVIGMLVEKDTIR--ERMGRTDSATWLPVSMPTSFAEKEDKATSTVGLFYPSSQALSAQSELEGTERGRLEASRDRRPALAAVSPGQGYWRQQMDHVCSHLRAHAQNNPDFRSIIGEPRLGKIISAAVHEDLNGDEVTLTVT---------YARRDGKEHQK---------TGKVPKLKESERLLIKELGA--------------------KGQGRE------EEVERLL-------------------DEGANPDVEAPDGTPLIIHATANKHLDCLATLVNAGANVNAKNLSKGNTALHTAVLLGGDGAKFVDALLGLGAKSDLKNDAGQTPYDLAVSSGHDSIAKRFASNVGDELLQKLTK 493          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Nematostella
Match: EDO34793 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN93])

HSP 1 Score: 67.781 bits (164), Expect = 4.392e-14
Identity = 31/54 (57.41%), Postives = 42/54 (77.78%), Query Frame = 1
Query:  136 TKIEIASESNDTDIYFTVNGFKPEPFKVIGDKHTFKFSVPFCLPAGKRTVKAIA 297
            T IE+ +++ DT IY+T+NG KPEPFK IG K T++++ PF L  GKRTVKA+A
Sbjct:   29 TPIELHTDTPDTIIYYTINGMKPEPFKQIGMKCTYRYNKPFVLGIGKRTVKAMA 82          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Nematostella
Match: EDO43161 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7RZK6])

HSP 1 Score: 67.3958 bits (163), Expect = 1.250e-11
Identity = 39/111 (35.14%), Postives = 66/111 (59.46%), Query Frame = 1
Query: 2062 SSSGEGKTTEIERLFEEGANPNGKNGKGV-PFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNE 2391
            +++  G+T+ +  L  +G + +  +  G+ P +  A R    DA+R+L  +GA+VN+ +    NTALH AVS  S N ++I+ +   G+S+ + N KGETP D+A  K N+
Sbjct:   25 AAAQNGQTSIMAYLLAKGMDVDLPDKNGMTPLMWAAYRCFSVDAVRMLVTMGASVNKTDSVHSNTALHWAVS--SNNHNVIHPIAKAGASIDLVNAKGETPADIATEKKNK 133          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Medaka
Match: ENSORLT00000025874.2 (pep primary_assembly:ASM223467v1:1:438626:448849:1 gene:ENSORLG00000020895.2 transcript:ENSORLT00000025874.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 6.512e-44
Identity = 133/518 (25.68%), Postives = 212/518 (40.93%), Query Frame = 1
Query:  880 MCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATFCCQCGNTIIAPAKQMMAFTNEMK-EYQWNSISIPLSNKNGILK--PETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKKNIDKDKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKRTGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLG 2424
            +C+ C S +P N   CLVCE  ++V            R L     T NPP++  CLTCE  L                     S+ PS  +   C +CN +N +DARFC+ CG KVS+                                 AP    +  + ++K   + +  S P S+    LK  P T+               D  TQT+GL+YPS  +L++     +P       D   P   VSPG+G+WRKQ++H+  HL+++A N++ F+A++GEPR G++++A +QE+  E++L + FA  G K   V  N   + +        +TG F        +Q   L                                         LKE+   G G+   ++RL ++GA+P+     G   + VA  N H D + +L + GA+ ++                +S +P          +SV+ RN  GETP D+A +        L++++ G
Sbjct:    3 LCVSCNSALPENAHMCLVCEEPVHV-----------SRALQVRACTGNPPDISRCLTCEGFL---------------------SSTPSAQVTITCSRCNSENRSDARFCNSCGSKVSW---------------------------------APPTCHLHLSKDLKTAAKVSQKSTPSSDPTPSLKVTPPTV---------------DKHTQTIGLYYPSFTELQRK----EPQRQQGPRDPQPPLTAVSPGRGFWRKQLDHVCGHLRSYAQNNAPFRALLGEPRFGRMVSAVIQEDQFEVSLTVSFASAGLKPQQVGLNQSSWTEG--EETFTQTGVF--------VQGGQL-----------------------------------------LKELGPGG-GRVGTVQRLLDQGADPSCCGSDGRHALAVAVMNRHPDVLPVLLQRGADPDQ----------------QSGSPPAFRW----KASVRQRNAVGETPYDVAASSGGGDMASLLAAQTG 364          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Medaka
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:101161524])

HSP 1 Score: 58.151 bits (139), Expect = 4.197e-8
Identity = 43/135 (31.85%), Postives = 71/135 (52.59%), Query Frame = 1
Query: 2059 ISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTK------NNEIAVKLISSKLGRKQVEKL 2445
            +++   G T E+ R+ + GA+ N  N  G+  +  A  +++ D +  L E GA+VN+ + E G   LH A S   L  DI   L+  G+SV + N +GETP D+A  +       NEI  + +  +  RK+ E++
Sbjct:   45 LAACSSGDTEEVLRMLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGASVNQPDNE-GWIPLHAAASCGYL--DIAEYLISQGASVGVVNSEGETPLDIAEEEAMGELLKNEINRQGVDIEAARKEEERI 176          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Medaka
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:101161524])

HSP 1 Score: 57.7658 bits (138), Expect = 4.565e-8
Identity = 43/135 (31.85%), Postives = 71/135 (52.59%), Query Frame = 1
Query: 2059 ISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTK------NNEIAVKLISSKLGRKQVEKL 2445
            +++   G T E+ R+ + GA+ N  N  G+  +  A  +++ D +  L E GA+VN+ + E G   LH A S   L  DI   L+  G+SV + N +GETP D+A  +       NEI  + +  +  RK+ E++
Sbjct:   45 LAACSSGDTEEVLRMLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGASVNQPDNE-GWIPLHAAASCGYL--DIAEYLISQGASVGVVNSEGETPLDIAEEEAMGELLKNEINRQGVDIEAARKEEERI 176          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Medaka
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:101161524])

HSP 1 Score: 57.7658 bits (138), Expect = 5.130e-8
Identity = 43/135 (31.85%), Postives = 71/135 (52.59%), Query Frame = 1
Query: 2059 ISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTK------NNEIAVKLISSKLGRKQVEKL 2445
            +++   G T E+ R+ + GA+ N  N  G+  +  A  +++ D +  L E GA+VN+ + E G   LH A S   L  DI   L+  G+SV + N +GETP D+A  +       NEI  + +  +  RK+ E++
Sbjct:   45 LAACSSGDTEEVLRMLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGASVNQPDNE-GWIPLHAAASCGYL--DIAEYLISQGASVGVVNSEGETPLDIAEEEAMGELLKNEINRQGVDIEAARKEEERI 176          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Medaka
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:101161524])

HSP 1 Score: 57.3806 bits (137), Expect = 7.442e-8
Identity = 43/135 (31.85%), Postives = 71/135 (52.59%), Query Frame = 1
Query: 2059 ISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTK------NNEIAVKLISSKLGRKQVEKL 2445
            +++   G T E+ R+ + GA+ N  N  G+  +  A  +++ D +  L E GA+VN+ + E G   LH A S   L  DI   L+  G+SV + N +GETP D+A  +       NEI  + +  +  RK+ E++
Sbjct:   45 LAACSSGDTEEVLRMLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGASVNQPDNE-GWIPLHAAASCGYL--DIAEYLISQGASVGVVNSEGETPLDIAEEEAMGELLKNEINRQGVDIEAARKEEERI 176          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Planmine SMEST
Match: SMESG000018144.1 (SMESG000018144.1)

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 415/418 (99.28%), Postives = 418/418 (100.00%), Query Frame = 1
Query:   52 MAAGQXXXXXXXXXXXXXXXXTKFLNDDTKIEIASESNDTDIYFTVNGFKPEPFKVIGDKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESVNPSPKILNQDVYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYISGLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIXXXXXXXXXXXENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATF 1305
            MAAGQIKAPIIIPLKPLHLTKTKFLN+DTKIEIASESNDTDIYFTVNGFKPEPFKVIGDKHTFKFSVPFCLPAGKRTVKA+AVSKDGSRESNIVTK+FEIEHVESVNPSPKILNQDVYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYISGLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIPPLPQTRLPPPENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATF
Sbjct:    1 MAAGQIKAPIIIPLKPLHLTKTKFLNNDTKIEIASESNDTDIYFTVNGFKPEPFKVIGDKHTFKFSVPFCLPAGKRTVKAMAVSKDGSRESNIVTKVFEIEHVESVNPSPKILNQDVYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHDRNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYISGLNLETNMDTDKNYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSKFCNNCGQSIPPLPQTRLPPPENGQLGMCIHCRSTVPMNLSNCLVCEAQLNVQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIELNQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYNGCLTCSRCGANNHHNATF 418          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Planmine SMEST
Match: SMESG000018145.1 (SMESG000018145.1)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 369/371 (99.46%), Postives = 369/371 (99.46%), Query Frame = 1
Query: 1369 MKEYQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKKNIDKDKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKRTGSFDSFRSDDTLQSNDLSKPQXXXXXXXXXXXXXXXXXNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQANDSDDE 2481
            MKE QWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKKNIDKDKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKRTGSFDSFRSDDTLQSNDLSKPQKTPTTSSRCRTTKRKPSNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQ NDSDDE
Sbjct:    1 MKESQWNSISIPLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKKNIDKDKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQAMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRYLSSMLKRTGSFDSFRSDDTLQSNDLSKPQKTPTTSSRCRTTKRKPSNKKQSKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTKPKQVNDSDDE 371          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Planmine SMEST
Match: SMESG000023108.1 (SMESG000023108.1)

HSP 1 Score: 64.6994 bits (156), Expect = 2.447e-10
Identity = 32/84 (38.10%), Postives = 55/84 (65.48%), Query Frame = 1
Query:  124 LNDDTKIEIASESNDTDIYFTVNGFKPEPFKVI--GDKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEIEHVESV 369
            ++  T IE+ +E+ +  +YFT +G KP P+K +  G + T++++ PF L  GKRT+KAIA+ K    ES+++TK F ++ +  V
Sbjct:   27 IDTGTYIELDTETPNCVVYFTTDGTKPNPWKRVINGKELTYRYNGPFTLKPGKRTLKAIALHKVTKVESHVITKTFYVDDIVDV 110          
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Planmine SMEST
Match: SMESG000063189.1 (SMESG000063189.1)

HSP 1 Score: 49.6766 bits (117), Expect = 7.734e-6
Identity = 32/109 (29.36%), Postives = 55/109 (50.46%), Query Frame = 1
Query: 2059 ISSSGEGKTTEIERLFEEGANPNGKNGKGVPFIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDIINELLDCGSSVKIRNKKGETPNDLALTKN 2385
            + ++G     E++RL  EGA+P+  N  G+  +     +N     +LL + GANVN  + E   T LH A +   +  +I   L+D G+++   N +G  P D+   +N
Sbjct:   73 LEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMW-TPLHAAAACAHI--EICACLIDYGANLLALNAEGNMPYDICEEEN 178          
The following BLAST results are available for this feature:
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DZANK11.121e-12734.67double zinc ribbon and ankyrin repeat domains 1 [S... [more]
DZANK11.121e-12734.67double zinc ribbon and ankyrin repeat domains 1 [S... [more]
DZANK13.962e-10935.99double zinc ribbon and ankyrin repeat domains 1 [S... [more]
DZANK17.028e-9936.35double zinc ribbon and ankyrin repeat domains 1 [S... [more]
DZANK13.525e-7131.68double zinc ribbon and ankyrin repeat domains 1 [S... [more]
back to top
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG31049.181e-730.69gene:FBgn0031473 transcript:FBtr0335132[more]
CG31049.181e-730.69gene:FBgn0031473 transcript:FBtr0077686[more]
CG31049.181e-730.69gene:FBgn0031473 transcript:FBtr0077687[more]
back to top
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dzank13.553e-11932.03double zinc ribbon and ankyrin repeat domains 1 [S... [more]
dzank12.597e-9334.75double zinc ribbon and ankyrin repeat domains 1 [S... [more]
ppp1r12a8.486e-730.37protein phosphatase 1, regulatory subunit 12A [Sou... [more]
pla2g68.852e-733.33phospholipase A2, group VI (cytosolic, calcium-ind... [more]
pla2g68.961e-733.33phospholipase A2, group VI (cytosolic, calcium-ind... [more]
back to top
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dzank12.099e-13936.63double zinc ribbon and ankyrin repeat domains 1 [S... [more]
dzank13.527e-9937.72double zinc ribbon and ankyrin repeat domains 1 [S... [more]
dzank14.254e-8041.94double zinc ribbon and ankyrin repeat domains 1 [S... [more]
dzank12.883e-7439.54double zinc ribbon and ankyrin repeat domains 1 [S... [more]
dzank13.325e-7341.06double zinc ribbon and ankyrin repeat domains 1 [S... [more]
back to top
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dzank11.958e-12033.37double zinc ribbon and ankyrin repeat domains 1 [S... [more]
Dzank11.231e-11833.33double zinc ribbon and ankyrin repeat domains 1 [S... [more]
Ppp1r12b9.721e-736.19protein phosphatase 1, regulatory subunit 12B [Sou... [more]
Ppp1r12b1.002e-636.19protein phosphatase 1, regulatory subunit 12B [Sou... [more]
Ppp1r12b1.002e-636.19protein phosphatase 1, regulatory subunit 12B [Sou... [more]
back to top
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NVP4|DZAN1_HUMAN5.382e-12734.67Double zinc ribbon and ankyrin repeat-containing p... [more]
sp|Q8C008|DZAN1_MOUSE1.369e-11933.37Double zinc ribbon and ankyrin repeat-containing p... [more]
sp|Q9GKS9|DZAN1_MACFA7.272e-10935.02Double zinc ribbon and ankyrin repeat-containing p... [more]
sp|P25963|IKBA_HUMAN1.782e-632.46NF-kappa-B inhibitor alpha OS=Homo sapiens OX=9606... [more]
sp|Q08353|IKBA_PIG1.932e-632.46NF-kappa-B inhibitor alpha OS=Sus scrofa OX=9823 G... [more]
back to top
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HKC02.689e-15837.68double zinc ribbon and ankyrin repeat-containing p... [more]
R7VBU31.395e-15637.10ANK_REP_REGION domain-containing protein OS=Capite... [more]
V4CHK71.732e-15136.84ANK_REP_REGION domain-containing protein OS=Lottia... [more]
A0A2B4SEB82.332e-14837.25Double zinc ribbon and ankyrin repeat-containing p... [more]
A0A3M6UCI42.061e-14636.60ANK_REP_REGION domain-containing protein OS=Pocill... [more]
back to top
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dzank16.527e-6334.48double zinc ribbon and ankyrin repeat domains 1 [S... [more]
anks31.008e-837.27ankyrin repeat and sterile alpha motif domain cont... [more]
anks31.107e-836.61ankyrin repeat and sterile alpha motif domain cont... [more]
ppp1r12a9.571e-730.37protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a1.159e-630.37protein phosphatase 1 regulatory subunit 12A [Sour... [more]
back to top
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dzank17.557e-12633.57double zinc ribbon and ankyrin repeat domains 1 [S... [more]
CDKN2D3.898e-833.60cyclin dependent kinase inhibitor 2D [Source:HGNC ... [more]
ENSPMAT00000007954.16.580e-833.93pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gen... [more]
ENSPMAT00000003991.11.305e-733.68pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000004672.11.069e-634.58pep scaffold:Pmarinus_7.0:GL477315:17052:39954:-1 ... [more]
back to top
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO347945.501e-9736.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347934.392e-1457.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431611.250e-1135.14Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000025874.26.512e-4425.68pep primary_assembly:ASM223467v1:1:438626:448849:1... [more]
ppp1r12a4.197e-831.85protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a4.565e-831.85protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a5.130e-831.85protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a7.442e-831.85protein phosphatase 1 regulatory subunit 12A [Sour... [more]
back to top
BLAST of Double zinc ribbon and ankyrin repeat-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000018144.10.000e+099.28SMESG000018144.1[more]
SMESG000018145.10.000e+099.46SMESG000018145.1[more]
SMESG000023108.12.447e-1038.10SMESG000023108.1[more]
SMESG000063189.17.734e-629.36SMESG000063189.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007189 ID=SMED30007189|Name=Double zinc ribbon and ankyrin repeat-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2545bp
TTTAACTTTTAAATTTAAATATTTATTTATAAAAAACGTAAGTTCTATTC
AATGGCTGCTGGTCAAATAAAAGCGCCAATCATTATTCCTTTGAAACCTT
TACATCTTACAAAGACAAAGTTTCTTAATGATGATACAAAAATAGAGATA
GCATCAGAATCCAACGATACAGATATATATTTTACTGTCAATGGATTTAA
GCCAGAACCTTTTAAAGTCATTGGCGATAAACATACGTTTAAATTTTCAG
TTCCATTTTGTTTGCCAGCTGGGAAAAGAACAGTAAAAGCCATTGCAGTA
TCAAAAGATGGCAGTCGTGAGAGTAACATCGTAACAAAGATTTTCGAAAT
TGAACATGTTGAAAGTGTGAATCCTTCGCCTAAAATTCTAAATCAAGATG
TTTATGGATTTTTAGAGGATATAAAAAATAGAAATAATTCAAATGATTTA
TATTACCAAGAGCCGAAAGCATCTTCACAAGAAACGCAGAAATCCCATGA
TAGAAACAACTCAACGGGAATTTACAATCCTAACCTGAGATCAATTACTC
CTCAGCACTTGACCACAAGATCATCAACAAATAAGAAATATGGAAAAACG
CATGATTATATTTCTGGCTTAAACCTGGAAACTAACATGGACACCGATAA
AAATTACAAAAGGAAGAGTGAATTTGAAGAGAAAATGTCGACCAAAATTT
TAACTGACTCGAGCTATTCATCTTTAAGATTACAACGAGAAACAGACTTT
TTAAAATGCATATATTGTTTGGCACCAAGGCCGTCAGATCCTTTTTCGAA
ATTCTGCAATAATTGTGGACAATCTATCCCTCCATTACCACAAACTCGCT
TACCTCCTCCAGAAAACGGACAATTAGGAATGTGCATTCATTGCCGATCA
ACAGTGCCAATGAACCTTTCTAACTGTCTGGTTTGTGAGGCTCAACTTAA
TGTTCAAAATCAACCTCAAGCTACAAATAAATTAAGAGAGCGCGTTTTAT
GCACTATTTGTGGTACCACAAATCCGCCAAATATGGACTCGTGTTTAACG
TGTGAAGCAAAACTTCCAGAAAGTGGTAAACCAATCAAAATGATCGAGCT
AAATCAGCCGCCCAATCAGACAATGACGTCTAACTTACCTTCAGATCTTA
TATTTGCAAATTGTCTGAAATGCAACCGGCAAAACAATACCGATGCAAGG
TTCTGTGATTGGTGTGGATATAAAGTTTCATTTGATGCAAACTCCTATAA
TGGATGCCTCACTTGTTCAAGATGTGGAGCTAATAATCATCACAATGCTA
CTTTTTGTTGTCAATGTGGAAATACTATCATCGCACCCGCAAAACAAATG
ATGGCTTTTACTAATGAAATGAAAGAATATCAATGGAATTCAATTTCAAT
ACCACTTTCTAATAAAAATGGAATTTTAAAGCCCGAAACCCTGAGCATGC
AAAATGGATCTTTGTTTATCAGAAAAAACGTTCCGTGTGATGTTTCCACA
CAAACAGTTGGATTATTTTATCCTAGTACAGCTCAGCTGAAAAAGAATAT
AGATAAAGATAAACCATTGACAACAAATAATATCTGGGATAAAATAGTTC
CTTCAAATTATGTCAGTCCAGGAAAAGGATATTGGCGGAAACAGATTGAA
CATATCATTTGTCATTTAAAGGCTCATGCCTCAAATTCTTCAGAATTTCA
AGCTATGATCGGAGAACCACGAATTGGCAAACTTATTACTGCAGATGTAC
AAGAAGAGGATACTGAAATTACTTTAAATTTAGTTTTTGCACTTAAAGGT
TATAAGGACCCTTATGTTCGAAAAAATTCAGACGAATTTGACAAGAGATA
TCTAAGTTCAATGCTAAAGAGAACCGGAAGTTTTGATTCATTCAGAAGTG
ACGATACTTTACAAAGCAACGATTTGTCAAAACCGCAGAAAACTCCTACC
ACAAGTTCTAGATGTAGAACAACCAAAAGAAAGCCATCAAATAAAAAGCA
ATCCAAATCTGTACCAAATGTTGTTTTATCGGAAGTTGATAAAAGCCTGC
TAAAAGAAATCAGTTCATCTGGTGAAGGTAAAACTACAGAAATCGAGCGC
CTTTTCGAAGAAGGAGCTAATCCTAATGGTAAAAACGGTAAAGGTGTTCC
GTTTATTATAGTTGCAACACGTAATAATCATAAAGATGCAATCAGATTGT
TACATGAGCTTGGGGCTAATGTCAATGAAATAGAACCCGAATTTGGAAAT
ACAGCGTTACACGAAGCTGTTAGTTTACGATCACTAAATCCTGATATAAT
TAATGAACTATTAGACTGTGGTTCAAGTGTCAAAATTAGAAACAAGAAAG
GTGAAACCCCAAATGACTTAGCGCTAACAAAAAATAACGAAATAGCAGTA
AAGTTAATATCCAGTAAGTTAGGGAGAAAACAAGTGGAAAAACTGACCAA
ACCGAAGCAAGCGAATGATTCTGATGATGAAAAGATATAGATCATTTATT
AAATTTGGAAGACAATTAAATCTTTGTATGCAGAGATCGGAAGAG
back to top

protein sequence of SMED30007189-orf-1

>SMED30007189-orf-1 ID=SMED30007189-orf-1|Name=SMED30007189-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=813bp
MAAGQIKAPIIIPLKPLHLTKTKFLNDDTKIEIASESNDTDIYFTVNGFK
PEPFKVIGDKHTFKFSVPFCLPAGKRTVKAIAVSKDGSRESNIVTKIFEI
EHVESVNPSPKILNQDVYGFLEDIKNRNNSNDLYYQEPKASSQETQKSHD
RNNSTGIYNPNLRSITPQHLTTRSSTNKKYGKTHDYISGLNLETNMDTDK
NYKRKSEFEEKMSTKILTDSSYSSLRLQRETDFLKCIYCLAPRPSDPFSK
FCNNCGQSIPPLPQTRLPPPENGQLGMCIHCRSTVPMNLSNCLVCEAQLN
VQNQPQATNKLRERVLCTICGTTNPPNMDSCLTCEAKLPESGKPIKMIEL
NQPPNQTMTSNLPSDLIFANCLKCNRQNNTDARFCDWCGYKVSFDANSYN
GCLTCSRCGANNHHNATFCCQCGNTIIAPAKQMMAFTNEMKEYQWNSISI
PLSNKNGILKPETLSMQNGSLFIRKNVPCDVSTQTVGLFYPSTAQLKKNI
DKDKPLTTNNIWDKIVPSNYVSPGKGYWRKQIEHIICHLKAHASNSSEFQ
AMIGEPRIGKLITADVQEEDTEITLNLVFALKGYKDPYVRKNSDEFDKRY
LSSMLKRTGSFDSFRSDDTLQSNDLSKPQKTPTTSSRCRTTKRKPSNKKQ
SKSVPNVVLSEVDKSLLKEISSSGEGKTTEIERLFEEGANPNGKNGKGVP
FIIVATRNNHKDAIRLLHELGANVNEIEPEFGNTALHEAVSLRSLNPDII
NELLDCGSSVKIRNKKGETPNDLALTKNNEIAVKLISSKLGRKQVEKLTK
PKQANDSDDEKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR025874DZR
IPR020683Ankyrin_rpt-contain_dom
IPR026876Fn3_assoc_repeat
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0046872metal ion binding