Serine/threonine-protein phosphatase Pgam5, mitochondrial

Overview
NameSerine/threonine-protein phosphatase Pgam5, mitochondrial
Smed IDSMED30007181
Length (bp)908
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase Pgam5, mitochondrial (SMED30007181) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase Pgam5, mitochondrial (SMED30007181) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein phosphatase Pgam5, mitochondrial (SMED30007181) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase Pgam5, mitochondrial (SMED30007181) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007181

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30007181SMESG000060665.1 SmedASXL_008035SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymal cellSMED30007181SMESG000060665.1 dd_Smed_v4_6361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007181SMESG000060665.1 dd_Smed_v4_6361_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30007181SMESG000060665.1 dd_Smed_v4_6361_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Human
Match: PGAM5 (PGAM family member 5, mitochondrial serine/threonine protein phosphatase [Source:HGNC Symbol;Acc:HGNC:28763])

HSP 1 Score: 189.119 bits (479), Expect = 6.370e-58
Identity = 106/237 (44.73%), Postives = 133/237 (56.12%), Query Frame = 3
Query:  189 WDYNWD------FLNNRK-----------NSFDTSKNYACHHIVLVRHGQYVLTGD-PQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS 845
            WD NWD       +N RK           +  D  K  A  HI L+RH QY + G   +DR LT LGREQA LTG RL  L LKF+K+V S+M RAIETTD+I   +      S   L EG P  P+PP S++K      +   ARIE+AFR   +R +        + D Y + +CHANVIRY +CRALQFP +GWLR SL++ SIT L I  +GRV L    D G +P   +TRS
Sbjct:   58 WDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRAD-----ARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS 289          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Human
Match: PGAM5 (PGAM family member 5, mitochondrial serine/threonine protein phosphatase [Source:HGNC Symbol;Acc:HGNC:28763])

HSP 1 Score: 134.806 bits (338), Expect = 2.418e-37
Identity = 79/187 (42.25%), Postives = 100/187 (53.48%), Query Frame = 3
Query:  189 WDYNWD------FLNNRK-----------NSFDTSKNYACHHIVLVRHGQYVLTGD-PQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLC 695
            WD NWD       +N RK           +  D  K  A  HI L+RH QY + G   +DR LT LGREQA LTG RL  L LKF+K+V S+M RAIETTD+I   +      S   L EG P  P+PP S++K      +   ARIE+AFR   +R +        + D Y + +CHANVIRY +C
Sbjct:   58 WDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRAD-----ARQEEDSYEIFICHANVIRYIVC 239          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Human
Match: PGAM5 (PGAM family member 5, mitochondrial serine/threonine protein phosphatase [Source:HGNC Symbol;Acc:HGNC:28763])

HSP 1 Score: 125.946 bits (315), Expect = 2.171e-35
Identity = 65/145 (44.83%), Postives = 84/145 (57.93%), Query Frame = 3
Query:  411 MVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS 845
            M RAIETTD+I   +      S   L EG P  P+PP S++K      +   ARIE+AFR   +R +        + D Y + +CHANVIRY +CRALQFP +GWLR SL++ SIT L I  +GRV L    D G +P   +TRS
Sbjct:    1 MTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRAD-----ARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS 140          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Human
Match: PGAM5 (PGAM family member 5, mitochondrial serine/threonine protein phosphatase [Source:HGNC Symbol;Acc:HGNC:28763])

HSP 1 Score: 125.946 bits (315), Expect = 2.171e-35
Identity = 65/145 (44.83%), Postives = 84/145 (57.93%), Query Frame = 3
Query:  411 MVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS 845
            M RAIETTD+I   +      S   L EG P  P+PP S++K      +   ARIE+AFR   +R +        + D Y + +CHANVIRY +CRALQFP +GWLR SL++ SIT L I  +GRV L    D G +P   +TRS
Sbjct:    1 MTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRAD-----ARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS 140          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Human
Match: BPGM (bisphosphoglycerate mutase [Source:HGNC Symbol;Acc:HGNC:1093])

HSP 1 Score: 48.9062 bits (115), Expect = 3.046e-7
Identity = 27/72 (37.50%), Postives = 43/72 (59.72%), Query Frame = 3
Query:  258 HHIVLVRHGQYVLTGDPQ-----DRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIG 458
            + ++++RHG+     + +     D+KL   G E+A   GK+LK LN +FD V TS + R+I T  LI+ E+G
Sbjct:    4 YKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILEELG 75          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Celegans
Match: pgam-5 (Serine/threonine-protein phosphatase Pgam5, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q09422])

HSP 1 Score: 179.489 bits (454), Expect = 1.085e-54
Identity = 96/235 (40.85%), Postives = 137/235 (58.30%), Query Frame = 3
Query:  186 QWDYNWDFLN----------------NRKNSFDTSKNYACHHIVLVRHGQYVLTGDPQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNH-TVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVT 839
            +WD NWDF +                 +K   +  K  A  +I L+RHGQY L  D + + LT LGREQA L GKRL   ++KF  +  STMVRA ET ++I+  + +  T  S   +EEGPP  P P    ++ +    +  +ARIESA+RK+F+R     ++ + K D + L+VCHANVIRYF+CRALQFP +GWLR SL + S+T ++I   G V +    D GH+P + ++
Sbjct:   55 EWDKNWDFRDPISLVDKGKWEKADEEGKKKLIEEKKATATRNIFLIRHGQYHL--DHEVKMLTPLGREQAELLGKRLANSDIKFTNMTMSTMVRATETANIILKHLPDDLTRTSSPFIEEGPPYPPVPDHKTWRPLDPEFYTEAARIESAYRKIFHR-----ASPSQKEDSFELIVCHANVIRYFICRALQFPPEGWLRMSLGNCSLTWITIRPKGHVSVRSIGDIGHLPPNKIS 282          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Fly
Match: Pgam5 (gene:FBgn0023517 transcript:FBtr0070366)

HSP 1 Score: 185.652 bits (470), Expect = 6.025e-57
Identity = 103/237 (43.46%), Postives = 141/237 (59.49%), Query Frame = 3
Query:  189 WDYNWDFLN----------------NRKNS-FDTSKNYACHHIVLVRHGQYVLTGDPQD-RKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIG--NHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVT 839
            WD NWD                   NR N+  + +K     HI+LVRHG+Y+  GD  D   LTE GR+QA  TGKRL EL +K+DKVV STMVRA ET+D+I+ +I      V +   L EG P  P+PP  ++K          +RIE+ FR+ F+R     +  + +++ YTL+V H NVIRYF+CRALQFPA+GWLR +++HASIT L+I   G V ++   D+G +PA  +T
Sbjct:   47 WDTNWDCREPRALVRPLRNSQPEEENRYNAELEKAKAKKARHIILVRHGEYLDVGDSDDTHHLTERGRKQAEFTGKRLCELGIKWDKVVASTMVRAQETSDIILKQIDFEKEKVVNCAFLREGAPIPPQPPVGHWKPEASQFLRDGSRIEAGFRRYFHR-----AYPDQEKESYTLIVGHGNVIRYFVCRALQFPAEGWLRININHASITWLTISPSGNVSIKYLGDSGFMPAELLT 278          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Fly
Match: Pgam5 (gene:FBgn0023517 transcript:FBtr0339601)

HSP 1 Score: 181.8 bits (460), Expect = 2.062e-55
Identity = 103/237 (43.46%), Postives = 142/237 (59.92%), Query Frame = 3
Query:  189 WDYNWDFLN----------------NRKNS-FDTSKNYACHHIVLVRHGQYVLTGDPQD-RKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIG--NHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVT 839
            WD NWD                   NR N+  + +K     HI+LVRHG+Y+  GD  D   LTE GR+QA  TGKRL EL +K+DKVV STMVRA ET+D+I+ +I      V +   L EG P  P+PP  ++K    +     +RIE+ FR+ F+R     +  + +++ YTL+V H NVIRYF+CRALQFPA+GWLR +++HASIT L+I   G V ++   D+G +PA  +T
Sbjct:   47 WDTNWDCREPRALVRPLRNSQPEEENRYNAELEKAKAKKARHIILVRHGEYLDVGDSDDTHHLTERGRKQAEFTGKRLCELGIKWDKVVASTMVRAQETSDIILKQIDFEKEKVVNCAFLREGAPIPPQPPVGHWKPEA-SFLRDGSRIEAGFRRYFHR-----AYPDQEKESYTLIVGHGNVIRYFVCRALQFPAEGWLRININHASITWLTISPSGNVSIKYLGDSGFMPAELLT 277          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Fly
Match: Pgam5-2 (gene:FBgn0035004 transcript:FBtr0072356)

HSP 1 Score: 152.91 bits (385), Expect = 2.382e-44
Identity = 91/227 (40.09%), Postives = 129/227 (56.83%), Query Frame = 3
Query:  189 WDYNWDF----LNNRKNSFDTSKNYACHHIVLVRHGQYVLTGDPQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEK--DLEEGPPCTPEPPSSNYKIVTRNLFVH----SARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVT 839
            W ++WD     L    N  ++S   A  HI+LVRHG+Y  T  P    LTELGR QA  TG+RL+E+ L +D VV STM RA ET  +I+ ++    +  ++   L EG P   +PPS   K   R+L +       RIE+AFR+ F+R     ++   + D Y L+V H+NVIRY + RALQ P   W R +L+H SIT L+++  G V L C  D+G +P + +T
Sbjct:   55 WRHHWDLDKPQLQKVANGEESS---ALRHIILVRHGEYTRT--PNGSHLTELGRRQAERTGQRLREMGLSWDHVVASTMPRAEETAMIILKQLNLDPLKMKRCTLLPEGTPYPGDPPS---KRSARSLDLAYQRDGPRIEAAFRRYFFR-----ASPEQEHDSYLLIVGHSNVIRYLILRALQLPPAAWTRLNLNHGSITWLTVWPSGYVTLRCLGDSGFMPVTEIT 268          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Zebrafish
Match: pgam5 (PGAM family member 5, serine/threonine protein phosphatase, mitochondrial [Source:NCBI gene;Acc:492357])

HSP 1 Score: 181.415 bits (459), Expect = 4.016e-55
Identity = 98/239 (41.00%), Postives = 134/239 (56.07%), Query Frame = 3
Query:  177 TVTQWDYNWD------FLNNRK---------NSFDTSKNYACHHIVLVRHGQYVLTGDP-QDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS 845
            T   WDYNWD       +N ++            + +K  A  HI L+RH QY L GD  ++R LT LGREQA  TG+RL    LK+D ++ S+M RA ET ++I   +    + S   L EG P  P PP +++K          ARIE+AFR+  +R +        K D Y ++VCHANVIRYF+CRALQFP +GWLR  L++ SIT L++   GRV L    D+G +P   +TR+
Sbjct:   56 TANGWDYNWDKREPSSMVNGKRKESTGENGSQDAENNKPRATRHIFLIRHSQYNLKGDGDKERFLTPLGREQAEFTGQRLASFGLKYDTLIHSSMTRATETANIISKYLPGVELVSCDLLREGAPIEPVPPVTHWKPEAVQYHEDGARIEAAFRRYIHRAD-----AKQKEDSYEIIVCHANVIRYFVCRALQFPPEGWLRLGLNNGSITWLTVRPSGRVSLRALGDSGFMPPDKLTRT 289          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Xenopus
Match: pum1 (pumilio RNA binding family member 1 [Source:Xenbase;Acc:XB-GENE-957401])

HSP 1 Score: 164.081 bits (414), Expect = 2.128e-48
Identity = 99/241 (41.08%), Postives = 132/241 (54.77%), Query Frame = 3
Query:  186 QWDYNWD------FLNNRKNSFDTS-----------KNYACHHIVLVRHGQYVLTGDPQ-DRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVH---SARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS 845
            QWD NWD       +N  K + +T            K+ A  HI L+RH QY L G    DR LT LGREQA LTGKRL  L  K++ +V STM RA ETT++I   + +    S   L EG P  PEP   ++K      FV+    +RIE+AFR   +R +    A     D Y +++CHANVIRY +CRALQ P + WLR SL++ SI+ L I  +G V L    D+G +P   ++R+
Sbjct:   47 QWDRNWDRREPISMVNLSKINGETGEEELQLHLNKHKSKATRHIFLIRHSQYKLDGKTDFDRVLTPLGREQADLTGKRLSSLGFKYNHIVYSTMTRAKETTEIISKYLPDVKKSSSDLLREGAPIRPEPQVCHWK----PDFVYYEDGSRIEAAFRHFIHRADPKQEA-----DSYEILICHANVIRYIVCRALQLPPEAWLRMSLNNGSISYLVIRPNGNVSLRMLGDSGFMPPEKISRT 278          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Mouse
Match: Pgam5 (phosphoglycerate mutase family member 5 [Source:MGI Symbol;Acc:MGI:1919792])

HSP 1 Score: 188.734 bits (478), Expect = 6.827e-58
Identity = 103/237 (43.46%), Postives = 135/237 (56.96%), Query Frame = 3
Query:  189 WDYNWD------FLNNRKNSFDTS-----------KNYACHHIVLVRHGQYVLTGD-PQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS 845
            WD NWD       +N +K + ++            K  A  HI L+RH QY + G   +DR LT LGREQA LTG RL  L LKF+K+V S+M RA+ETTD+I   +   +  S   L EG P  P+PP S++K      +   ARIE+AFR   +R +        + D Y + +CHANVIRY +CRALQFP +GWLR SL++ SIT L I  +GRV L    D G +P   +TRS
Sbjct:   57 WDTNWDRREPLSLINLKKRNVESGEDELTSRLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAVETTDIISKHLPGVSRVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRAD-----ARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS 288          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Mouse
Match: Pgam5 (phosphoglycerate mutase family member 5 [Source:MGI Symbol;Acc:MGI:1919792])

HSP 1 Score: 184.111 bits (466), Expect = 4.188e-56
Identity = 103/237 (43.46%), Postives = 135/237 (56.96%), Query Frame = 3
Query:  189 WDYNWD------FLNNRKNSFDTS-----------KNYACHHIVLVRHGQYVLTGD-PQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS 845
            WD NWD       +N +K + ++            K  A  HI L+RH QY + G   +DR LT LGREQA LTG RL  L LKF+K+V S+M RA+ETTD+I   +   +  S   L EG P  P+PP S++K      +   ARIE+AFR   +R +        + D Y + +CHANVIRY +CRALQFP +GWLR SL++ SIT L I  +GRV L    D G +P   +TRS
Sbjct:   57 WDTNWDRREPLSLINLKKRNVESGEDELTSRLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAVETTDIISKHLPGVSRVSTDLLREGAPIEPDPPVSHWKPEA-VYYEDGARIEAAFRNYIHRAD-----ARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS 287          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Mouse
Match: Pgam5 (phosphoglycerate mutase family member 5 [Source:MGI Symbol;Acc:MGI:1919792])

HSP 1 Score: 112.464 bits (280), Expect = 8.597e-30
Identity = 65/159 (40.88%), Postives = 87/159 (54.72%), Query Frame = 3
Query:  189 WDYNWD------FLNNRKNSFDTS-----------KNYACHHIVLVRHGQYVLTGD-PQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIE 611
            WD NWD       +N +K + ++            K  A  HI L+RH QY + G   +DR LT LGREQA LTG RL  L LKF+K+V S+M RA+ETTD+I   +   +  S   L EG P  P+PP S++K      +   ARIE+AFR   +R +
Sbjct:   21 WDTNWDRREPLSLINLKKRNVESGEDELTSRLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAVETTDIISKHLPGVSRVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRAD 179          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Mouse
Match: Bpgm (2,3-bisphosphoglycerate mutase [Source:MGI Symbol;Acc:MGI:1098242])

HSP 1 Score: 50.0618 bits (118), Expect = 1.660e-7
Identity = 28/76 (36.84%), Postives = 44/76 (57.89%), Query Frame = 3
Query:  258 HHIVLVRHGQYVLTGDPQ-----DRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTV 470
            H ++++RHG+     + +     D+KL   G E+A   G++LK LN +FD V TS + R+I T  LI+ E+G   V
Sbjct:    4 HKLIILRHGEGQWNKENRFCSWVDQKLNNDGLEEARNCGRQLKALNFEFDLVFTSILNRSIHTAWLILEELGQEWV 79          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Mouse
Match: Bpgm (2,3-bisphosphoglycerate mutase [Source:MGI Symbol;Acc:MGI:1098242])

HSP 1 Score: 50.447 bits (119), Expect = 1.757e-7
Identity = 28/76 (36.84%), Postives = 44/76 (57.89%), Query Frame = 3
Query:  258 HHIVLVRHGQYVLTGDPQ-----DRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTV 470
            H ++++RHG+     + +     D+KL   G E+A   G++LK LN +FD V TS + R+I T  LI+ E+G   V
Sbjct:    4 HKLIILRHGEGQWNKENRFCSWVDQKLNNDGLEEARNCGRQLKALNFEFDLVFTSILNRSIHTAWLILEELGQEWV 79          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. UniProt/SwissProt
Match: sp|B3P9N0|PGAM5_DROER (Serine/threonine-protein phosphatase Pgam5, mitochondrial OS=Drosophila erecta OX=7220 GN=Pgam5 PE=3 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 9.055e-58
Identity = 106/237 (44.73%), Postives = 142/237 (59.92%), Query Frame = 3
Query:  189 WDYNWDFLN----------------NRKNS-FDTSKNYACHHIVLVRHGQYVLTGDPQD-RKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIG--NHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVT 839
            WD NWD                   NR N+  + +K     HI+LVRHG+Y+  GD  D   LTE GR+QA  TGKRL EL +K+DKVV STMVRA ET+D+I+ +I      V +   L EG P  P+PP  ++K          +RIE+AFR+ FYR     +  + +++ YTL+V H NVIRYF+CRALQFPA+GWLR S++HASIT L+I   G V ++   D+G +PA  +T
Sbjct:   47 WDTNWDCREPRALVRPLRNSQPEEENRYNAELEKAKAKKARHIILVRHGEYLDVGDSDDTHHLTERGRKQAEFTGKRLCELGIKWDKVVASTMVRAQETSDIILKQIDFEKEKVVNCAFLREGAPIPPQPPVGHWKPEASQFLRDGSRIEAAFRRYFYR-----AYPDQEKESYTLIVGHGNVIRYFVCRALQFPAEGWLRISINHASITWLTISPSGNVSIKYLGDSGFMPAELLT 278          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. UniProt/SwissProt
Match: sp|Q96HS1|PGAM5_HUMAN (Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5 PE=1 SV=2)

HSP 1 Score: 189.119 bits (479), Expect = 3.059e-57
Identity = 106/237 (44.73%), Postives = 133/237 (56.12%), Query Frame = 3
Query:  189 WDYNWD------FLNNRK-----------NSFDTSKNYACHHIVLVRHGQYVLTGD-PQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS 845
            WD NWD       +N RK           +  D  K  A  HI L+RH QY + G   +DR LT LGREQA LTG RL  L LKF+K+V S+M RAIETTD+I   +      S   L EG P  P+PP S++K      +   ARIE+AFR   +R +        + D Y + +CHANVIRY +CRALQFP +GWLR SL++ SIT L I  +GRV L    D G +P   +TRS
Sbjct:   58 WDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRAD-----ARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS 289          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. UniProt/SwissProt
Match: sp|Q8BX10|PGAM5_MOUSE (Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Mus musculus OX=10090 GN=Pgam5 PE=1 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 4.776e-57
Identity = 103/237 (43.46%), Postives = 135/237 (56.96%), Query Frame = 3
Query:  189 WDYNWD------FLNNRKNSFDTS-----------KNYACHHIVLVRHGQYVLTGD-PQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS 845
            WD NWD       +N +K + ++            K  A  HI L+RH QY + G   +DR LT LGREQA LTG RL  L LKF+K+V S+M RA+ETTD+I   +   +  S   L EG P  P+PP S++K      +   ARIE+AFR   +R +        + D Y + +CHANVIRY +CRALQFP +GWLR SL++ SIT L I  +GRV L    D G +P   +TRS
Sbjct:   57 WDTNWDRREPLSLINLKKRNVESGEDELTSRLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAVETTDIISKHLPGVSRVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRAD-----ARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS 288          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. UniProt/SwissProt
Match: sp|B4GXS1|PGAM5_DROPE (Serine/threonine-protein phosphatase Pgam5, mitochondrial OS=Drosophila persimilis OX=7234 GN=Pgam5 PE=3 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 7.809e-57
Identity = 104/237 (43.88%), Postives = 140/237 (59.07%), Query Frame = 3
Query:  189 WDYNWDF-------------LNNRKNSFDTSKNYA----CHHIVLVRHGQYVLTGDPQD-RKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIG--NHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVT 839
            WD+NWD              L+  +N ++T           HI+L+RHG+Y+  GD  +   LTE GREQA  TGKRL EL +K+DKV+ STMVRA ET D+I++EI      V +   L EG P  P+PP  ++K      F   ARIE+AFR+ FYR     +  +  +D YTL+V H NVIRYF+CRALQFP + WLR S++HASIT L+I   G V ++   D G +P + +T
Sbjct:   47 WDHNWDLRDPKSLVKPVKNDLSQEQNRYNTELEKVVPKHARHIILIRHGEYLDVGDTDETHHLTERGREQAKYTGKRLCELGIKWDKVIASTMVRAQETADIILNEIDYEKTKVKNCAFLREGAPIPPQPPVGHWKPEASQFFRDGARIEAAFRRYFYR-----AYPDQTKDSYTLLVGHGNVIRYFVCRALQFPPEAWLRISINHASITWLTISPSGNVSIKYLGDTGFMPVNHLT 278          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. UniProt/SwissProt
Match: sp|Q29HG0|PGAM5_DROPS (Serine/threonine-protein phosphatase Pgam5, mitochondrial OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Pgam5 PE=3 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.138e-56
Identity = 104/237 (43.88%), Postives = 139/237 (58.65%), Query Frame = 3
Query:  189 WDYNWDFLNNR------KNSFDTSKN-----------YACHHIVLVRHGQYVLTGDPQD-RKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIG--NHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVT 839
            WD+NWD  + +      KN     +N               HI+L+RHG+Y+  GD  +   LTE GREQA  TGKRL EL +K+DKV+ STMVRA ET D+I++EI      V +   L EG P  P+PP  ++K      F   ARIE+AFR+ FYR     +  +  +D YTL+V H NVIRYF+CRALQFP + WLR S++HASIT L+I   G V ++   D G +P + +T
Sbjct:   47 WDHNWDLRDPKSLVKPVKNDLSQEQNRYNSELEKVVPKHARHIILIRHGEYLDVGDTDETHHLTERGREQAKYTGKRLCELGIKWDKVIASTMVRAQETADIILNEIDYEKAKVKNCAFLREGAPIPPQPPVGHWKPEASQFFRDGARIEAAFRRYFYR-----AYPDQTKDSYTLLVGHGNVIRYFVCRALQFPPEAWLRISINHASITWLTISPSGNVSIKYLGDTGFMPVNHLT 278          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. TrEMBL
Match: A0A182JUA4 (Uncharacterized protein OS=Anopheles christyi OX=43041 PE=4 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 1.294e-64
Identity = 111/246 (45.12%), Postives = 148/246 (60.16%), Query Frame = 3
Query:  165 FNNETVTQWDYNWDF------------------LNNRKNSFDTSKNYACHHIVLVRHGQYVLTG--DPQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTR 842
            +      +WD+NWD                    N+   + +  K  A  H++LVRHGQY + G  D Q R LTELGR+QA+L+G+RLK+L + +D++V STM RA ET ++I   + +  + +   LEEG P  PEPP  +++      F   ARIE AFRK FYR +      + K D YTL+VCHANVIRYF+CRALQ+PA+GWLR SL HAS+T +SIY DGRV L    D GH+P   +TR
Sbjct:   47 YEPSPCARWDWNWDHRDPKSLVKPLKKVDDPESQNDYNKAVEMKKGRAIRHLILVRHGQYNMDGLTDSQ-RTLTELGRKQAVLSGERLKQLAMPYDEIVRSTMTRAQETAEIIGKSLSHLKLVNCPLLEEGSPIPPEPPVGHWRPEASQFFQDGARIEGAFRKYFYRAD-----PSQKSDSYTLIVCHANVIRYFVCRALQYPAEGWLRISLGHASLTWVSIYPDGRVSLRTLGDCGHMPKECLTR 286          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. TrEMBL
Match: A0A182P039 (Uncharacterized protein OS=Anopheles epiroticus OX=199890 PE=4 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 2.822e-64
Identity = 113/246 (45.93%), Postives = 146/246 (59.35%), Query Frame = 3
Query:  165 FNNETVTQWDYNWDF------------------LNNRKNSFDTSKNYACHHIVLVRHGQYVLTG--DPQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTR 842
            +      +WD+NWD                    N+   + +  K  A  H++LVRHGQY L G  D Q R LTELGR+QA L+G+RLK+L L +D +V STM RA ET ++I   +    + +   LEEG P  PEPP  +++      F   ARIESAFRK FYR +      + K D YT++VCHANVIRYF+CRALQ+PA+GWLR SL HAS+T +SIY DGRV L    D GH+P   +TR
Sbjct:   47 YEPSPCAKWDWNWDHRDPKSLVKPLKKVDDPEAQNDYNKAVEMKKGRAIRHLILVRHGQYNLDGITDVQ-RTLTELGRKQAALSGERLKQLALPYDNIVRSTMTRAQETAEIIGKSLPQLKLINCPLLEEGSPIPPEPPVGHWRPEASQFFQDGARIESAFRKYFYRAD-----PSQKSDSYTIIVCHANVIRYFVCRALQYPAEGWLRISLGHASLTWVSIYPDGRVSLRTLGDCGHMPKECLTR 286          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. TrEMBL
Match: A0A182MRH9 (Uncharacterized protein OS=Anopheles culicifacies OX=139723 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 5.890e-64
Identity = 113/246 (45.93%), Postives = 146/246 (59.35%), Query Frame = 3
Query:  165 FNNETVTQWDYNWDF------------------LNNRKNSFDTSKNYACHHIVLVRHGQYVLTG--DPQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTR 842
            +      +W++NWD                    N+   + +T K  A  H++LVRHGQY L G  D Q R LTELGR+QA L+G+RLK L L +D++V STM RA ET  +I   + +  +     LEEG P  PEPP  +++      F   ARIESAFRK FYR +      + K D YT++VCHANVIRYF+CRALQ+PA+GWLR SL HAS+T +SIY DGRV L    D GH+P   +TR
Sbjct:   47 YEPSPCARWEWNWDHRDPKSLVKPLKKVDDPESQNDYNKAVETKKGRAIRHLILVRHGQYNLDGMTDSQ-RTLTELGRKQAALSGERLKHLALPYDEIVRSTMTRAQETAAIIGKSLSHLKLVDCPLLEEGSPIPPEPPVGHWRPEASQFFQDGARIESAFRKYFYRAD-----PSQKSDSYTIIVCHANVIRYFVCRALQYPAEGWLRISLGHASLTWVSIYPDGRVSLRTLGDCGHMPKECLTR 286          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. TrEMBL
Match: A0A182TWA7 (Uncharacterized protein OS=Anopheles melas OX=34690 PE=4 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.177e-63
Identity = 118/283 (41.70%), Postives = 157/283 (55.48%), Query Frame = 3
Query:  108 KKIFAKGFIGCTA-----ILTASMFNNETV-------------TQWDYNWDF------------------LNNRKNSFDTSKNYACHHIVLVRHGQYVLTG--DPQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTR 842
            KK+F    IG           ++ F  +TV              +WD+NWD                    N+   + +  K  A  H++LVRHGQY + G  D Q R LTELGR QA L+G+RLK+L L +D++V STM RA ET ++I   + +  + +   LEEG P  PEPP  +++      F   ARIE AFRK FYR +      + K D YT++VCHANVIRYF+CRALQ+PA+GWLR SL HAS++ +SIY DGRV L    D GH+P   +TR
Sbjct:   10 KKLFTGTVIGVVGGASGYWFASNAFERQTVENSFTTNYEPSPCARWDWNWDHRDPKSLVKPLRKVDDPESQNDYNKAVEMKKGRAIRHLILVRHGQYNMDGLTDAQ-RSLTELGRRQAALSGERLKQLALPYDEIVRSTMTRAQETAEIIGKSLSHLKLINCPLLEEGSPIPPEPPVGHWRPEASQFFQDGARIEGAFRKYFYRAD-----PSQKSDSYTIIVCHANVIRYFVCRALQYPAEGWLRISLGHASLSWVSIYPDGRVSLRTLGDCGHMPKECLTR 286          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. TrEMBL
Match: A0A182VWU6 (Uncharacterized protein OS=Anopheles minimus OX=112268 PE=4 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.243e-63
Identity = 120/283 (42.40%), Postives = 158/283 (55.83%), Query Frame = 3
Query:  108 KKIFAKGFIGCTAILTASMFNNETVTQ------------------WDYNWDF------------------LNNRKNSFDTSKNYACHHIVLVRHGQYVLTG--DPQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTR 842
            KK+ +   +G     +A  F ++T T+                  W++NWD                    N+   + +T K  A  H++LVRHGQY L G  D Q R LTELGR+QA L+G+RLK L L +D++V STM RA ET  +I   + +  +     LEEG P  PEPP  +++      F   ARIESAFRK FYR +      + K D YT++VCHANVIRYF+CRALQ+PA+GWLR SL HAS+T +SIY DGRV L    D GH+P   +TR
Sbjct:   10 KKLVSGTVVGVIGGASAYWFVSDTATRQTVENSFTTNYEPSPCARWEWNWDHRDPKSLVKPLKKVDDPESQNDYNKAVETKKGRAIRHLILVRHGQYNLDGMTDSQ-RTLTELGRKQAGLSGERLKHLALPYDEIVRSTMTRAQETAAIIGKSLMHLKLVDCPLLEEGSPIPPEPPVGHWRPEASQFFQDGARIESAFRKYFYRAD-----PSQKSDSYTIIVCHANVIRYFVCRALQYPAEGWLRISLGHASLTWVSIYPDGRVSLRTLGDCGHMPKECLTR 286          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Cavefish
Match: pgam5 (PGAM family member 5, mitochondrial serine/threonine protein phosphatase [Source:NCBI gene;Acc:103044000])

HSP 1 Score: 172.94 bits (437), Expect = 8.229e-52
Identity = 99/239 (41.42%), Postives = 135/239 (56.49%), Query Frame = 3
Query:  183 TQWDYNWD------FLNNRKNS---------FDTSKNYACHHIVLVRHGQYVLTGDP-QDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVH--SARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS 845
            + WD NWD       L+ R+            + +K  A  HI L+RH QY L G+  ++R LT LGREQA L G+RL +L LK+D ++ S+M RA ET  +I   +    + S   L EG P  P PP +++K        H   ARIE+AFR+  +R +        K D Y ++VCHANVIRYF+CRALQFP +GWLR  L++ SIT L+I   GRV L    D+G +P   +TR+
Sbjct:   69 SGWDSNWDRRDPSTMLSPRRKESSGEENSTEVENNKPRATRHIFLIRHSQYNLNGNGDRERTLTPLGREQAELLGQRLADLGLKYDVMIHSSMARATETASIISRYLPGVEMVSCDLLREGAPIEPVPPVTHWKP---EAVYHEDGARIEAAFRRYIHRAD-----PKQKEDSYEIIVCHANVIRYFVCRALQFPPEGWLRMGLNNGSITWLTIRPSGRVALRALGDSGFMPPDKLTRT 299          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Medaka
Match: pgam5 (PGAM family member 5, mitochondrial serine/threonine protein phosphatase [Source:NCBI gene;Acc:101155203])

HSP 1 Score: 180.259 bits (456), Expect = 1.021e-54
Identity = 102/235 (43.40%), Postives = 135/235 (57.45%), Query Frame = 3
Query:  189 WDYNWD-----FLNN--RKNSF--------DTSKNYACHHIVLVRHGQYVLTG-DPQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS 845
            WD+NWD      L+N  RK S         D SK  A  +I+L+RH QY L+G   +DR LT LGREQA  TG+RL  L LK+D ++ S+M RA ET  ++   +    + S   L EG P  P PP +++K          ARIE+AFR+  +R +        K D Y ++VCHANVIRYF+CRALQFP +GWLR  L++ SIT ++I   GRV L    D G +P   VTR+
Sbjct:   68 WDFNWDKRDPSVLSNGKRKESSTEDPSSEQDNSKPKATRNILLIRHSQYNLSGTSDKDRILTPLGREQAEFTGQRLAALGLKYDVLIHSSMARATETAQILSKYLPGVDLVSCDMLREGAPIQPVPPVTHWKPDAVQYHEDGARIEAAFRRYIHRAD-----PKQKEDSYEIIVCHANVIRYFVCRALQFPPEGWLRMGLNNGSITWITIRPSGRVALRTLGDTGFMPVDKVTRT 297          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Planmine SMEST
Match: SMESG000060665.1 (SMESG000060665.1)

HSP 1 Score: 520.005 bits (1338), Expect = 0.000e+0
Identity = 247/247 (100.00%), Postives = 247/247 (100.00%), Query Frame = 3
Query:  105 MKKIFAKGFIGCTAILTASMFNNETVTQWDYNWDFLNNRKNSFDTSKNYACHHIVLVRHGQYVLTGDPQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS 845
            MKKIFAKGFIGCTAILTASMFNNETVTQWDYNWDFLNNRKNSFDTSKNYACHHIVLVRHGQYVLTGDPQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS
Sbjct:    1 MKKIFAKGFIGCTAILTASMFNNETVTQWDYNWDFLNNRKNSFDTSKNYACHHIVLVRHGQYVLTGDPQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS 247          
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Planmine SMEST
Match: SMESG000061306.1 (SMESG000061306.1)

HSP 1 Score: 192.971 bits (489), Expect = 2.536e-60
Identity = 105/257 (40.86%), Postives = 149/257 (57.98%), Query Frame = 3
Query:  129 FIGCTAILTASMFNN------------------ETVTQWDYNWDFLNNRKNSFDTSKNYACHHIVLVRHGQYVLTGDPQDRKLTELGREQAILTGKRLKELNLKFDKVVTSTMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNLFVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRALQFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS 845
            F G TAI    ++NN                    + +W+YNWD  NN     ++ K+ A  H++L+RHGQYV        KLT LGR+QA  TG RL ELN+ FD++V STM RA+ET ++I       T+ ++ DL EG P   EP   ++ I    + V ++RIE  FRK FYR     +    ++D Y ++VCHANVIRY LCRALQFP +GW+RFSLDHAS++ +SI  +G V +    ++G++P   ++ S
Sbjct:    7 FFGGTAISGIVIYNNFDISNCYKTAWSLTFDPIAPIKKWNYNWDGFNND----NSIKSKAVRHLILIRHGQYVYKDTDSQCKLTLLGRQQAKYTGLRLNELNITFDRLVHSTMTRAVETANIIKEHNPAITMVNDPDLVEGTPYVNEPFLPHWVIAEDVIKVDNSRIEKVFRKYFYR-----APLEQEKDSYEILVCHANVIRYMLCRALQFPPEGWIRFSLDHASMSWVSIKPNGSVTVRSIGNSGYMPPDKISVS 254          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGAM56.370e-5844.73PGAM family member 5, mitochondrial serine/threoni... [more]
PGAM52.418e-3742.25PGAM family member 5, mitochondrial serine/threoni... [more]
PGAM52.171e-3544.83PGAM family member 5, mitochondrial serine/threoni... [more]
PGAM52.171e-3544.83PGAM family member 5, mitochondrial serine/threoni... [more]
BPGM3.046e-737.50bisphosphoglycerate mutase [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pgam-51.085e-5440.85Serine/threonine-protein phosphatase Pgam5, mitoch... [more]
back to top
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pgam56.025e-5743.46gene:FBgn0023517 transcript:FBtr0070366[more]
Pgam52.062e-5543.46gene:FBgn0023517 transcript:FBtr0339601[more]
Pgam5-22.382e-4440.09gene:FBgn0035004 transcript:FBtr0072356[more]
back to top
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pgam54.016e-5541.00PGAM family member 5, serine/threonine protein pho... [more]
back to top
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pum12.128e-4841.08pumilio RNA binding family member 1 [Source:Xenbas... [more]
back to top
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pgam56.827e-5843.46phosphoglycerate mutase family member 5 [Source:MG... [more]
Pgam54.188e-5643.46phosphoglycerate mutase family member 5 [Source:MG... [more]
Pgam58.597e-3040.88phosphoglycerate mutase family member 5 [Source:MG... [more]
Bpgm1.660e-736.842,3-bisphosphoglycerate mutase [Source:MGI Symbol;... [more]
Bpgm1.757e-736.842,3-bisphosphoglycerate mutase [Source:MGI Symbol;... [more]
back to top
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B3P9N0|PGAM5_DROER9.055e-5844.73Serine/threonine-protein phosphatase Pgam5, mitoch... [more]
sp|Q96HS1|PGAM5_HUMAN3.059e-5744.73Serine/threonine-protein phosphatase PGAM5, mitoch... [more]
sp|Q8BX10|PGAM5_MOUSE4.776e-5743.46Serine/threonine-protein phosphatase PGAM5, mitoch... [more]
sp|B4GXS1|PGAM5_DROPE7.809e-5743.88Serine/threonine-protein phosphatase Pgam5, mitoch... [more]
sp|Q29HG0|PGAM5_DROPS1.138e-5643.88Serine/threonine-protein phosphatase Pgam5, mitoch... [more]
back to top
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A182JUA41.294e-6445.12Uncharacterized protein OS=Anopheles christyi OX=4... [more]
A0A182P0392.822e-6445.93Uncharacterized protein OS=Anopheles epiroticus OX... [more]
A0A182MRH95.890e-6445.93Uncharacterized protein OS=Anopheles culicifacies ... [more]
A0A182TWA71.177e-6341.70Uncharacterized protein OS=Anopheles melas OX=3469... [more]
A0A182VWU61.243e-6342.40Uncharacterized protein OS=Anopheles minimus OX=11... [more]
back to top
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pgam58.229e-5241.42PGAM family member 5, mitochondrial serine/threoni... [more]
back to top
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pgam51.021e-5443.40PGAM family member 5, mitochondrial serine/threoni... [more]
back to top
BLAST of Serine/threonine-protein phosphatase Pgam5, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000060665.10.000e+0100.00SMESG000060665.1[more]
SMESG000061306.12.536e-6040.86SMESG000061306.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007181 ID=SMED30007181|Name=Serine/threonine-protein phosphatase Pgam5, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=908bp
ATTTTTTTAAATTCTATTTTTAGTTTTAAAATTGACAGTTTATTTTACAA
TACTTATTTTATATTTTGTTAAATTAAATATTTTTTTTGATTAAAAGTTA
GTATATGAAAAAAATATTTGCAAAAGGTTTCATAGGATGTACTGCAATTC
TAACCGCATCTATGTTCAATAATGAAACAGTTACACAGTGGGATTATAAT
TGGGATTTTTTAAATAATCGAAAAAATTCCTTTGACACATCTAAAAACTA
CGCATGTCATCACATCGTCTTAGTTCGCCATGGGCAATATGTTTTAACTG
GCGATCCTCAAGATCGAAAATTGACTGAACTTGGTAGAGAACAAGCAATT
TTAACTGGGAAAAGATTGAAAGAATTAAATTTAAAATTTGATAAAGTGGT
TACCTCAACAATGGTTCGAGCAATTGAAACAACCGATTTAATAATTTCTG
AAATTGGAAATCACACTGTTTTCAGTGAAAAAGATTTAGAAGAAGGGCCA
CCATGCACACCTGAGCCGCCTTCTTCCAATTACAAAATTGTGACGAGGAA
TCTCTTTGTCCATTCTGCGAGAATTGAATCGGCATTTAGGAAATTGTTTT
ATCGAATAGAAAGACCTAATTCTGCGGAAAATGGCAAGCGGGACTATTAT
ACCCTCATGGTGTGTCACGCCAATGTGATTCGGTATTTTCTCTGCAGGGC
TCTCCAGTTTCCCGCTGACGGGTGGCTCAGGTTCAGTCTTGATCACGCCA
GCATTACGCGGCTCTCCATCTATTCCGATGGGCGTGTATTCCTTGAATGC
TACAGTGATGCGGGTCACATTCCGGCATCCAGCGTTACTCGCTCATGATG
TTATTACATCATATTCATTGACTGTAAACTTTTATAATACAATTTTGTTG
TTGAAAAA
back to top

protein sequence of SMED30007181-orf-1

>SMED30007181-orf-1 ID=SMED30007181-orf-1|Name=SMED30007181-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=248bp
MKKIFAKGFIGCTAILTASMFNNETVTQWDYNWDFLNNRKNSFDTSKNYA
CHHIVLVRHGQYVLTGDPQDRKLTELGREQAILTGKRLKELNLKFDKVVT
STMVRAIETTDLIISEIGNHTVFSEKDLEEGPPCTPEPPSSNYKIVTRNL
FVHSARIESAFRKLFYRIERPNSAENGKRDYYTLMVCHANVIRYFLCRAL
QFPADGWLRFSLDHASITRLSIYSDGRVFLECYSDAGHIPASSVTRS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000034epidermis
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013078His_Pase_superF_clade-1
IPR029033His_PPase_superfam
Vocabulary: molecular function
TermDefinition
GO:0004721phosphoprotein phosphatase activity
GO:0004722protein serine/threonine phosphatase activity
GO:0016787hydrolase activity
GO:0019900kinase binding
GO:0043539protein serine/threonine kinase activator activity
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005739mitochondrion
GO:0005741mitochondrial outer membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0009408response to heat
GO:0010821regulation of mitochondrion organization
GO:0035970peptidyl-threonine dephosphorylation
GO:0071902positive regulation of protein serine/threonine kinase activity
GO:0072347response to anesthetic
GO:0090141positive regulation of mitochondrial fission
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013078Histidine phosphatase superfamily, clade-1SMARTSM00855PGAM_5coord: 53..195
e-value: 1.4E-11
score: 54.5
IPR013078Histidine phosphatase superfamily, clade-1PFAMPF00300His_Phos_1coord: 54..130
e-value: 1.3E-12
score: 47.8
coord: 175..230
e-value: 5.8E-8
score: 32.6
IPR013078Histidine phosphatase superfamily, clade-1CDDcd07067HP_PGM_likecoord: 53..231
e-value: 1.95746E-36
score: 124.357
IPR029033Histidine phosphatase superfamilyGENE3DG3DSA:3.40.50.1240coord: 43..247
e-value: 1.1E-47
score: 164.6
IPR029033Histidine phosphatase superfamilySUPERFAMILYSSF53254Phosphoglycerate mutase-likecoord: 53..240
NoneNo IPR availablePANTHERPTHR20935PHOSPHOGLYCERATE MUTASE-RELATEDcoord: 26..246
NoneNo IPR availablePANTHERPTHR20935:SF0SERINE/THREONINE-PROTEIN PHOSPHATASE PGAM5, MITOCHONDRIALcoord: 26..246