PKD2-4

Overview
NamePKD2-4 (AKN21730.1)
Smed IDSMED30007179
Length (bp)2552
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PKD2-4 (SMED30007179) t-SNE clustered cells

Violin plots show distribution of expression levels for PKD2-4 (SMED30007179) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PKD2-4 (SMED30007179) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PKD2-4 (SMED30007179) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007179

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007179SMESG000018492.1 SmedASXL_014784SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30007179SMESG000018492.1 dd_Smed_v4_13327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30007179SMESG000018492.1 dd_Smed_v4_13327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30007179SMESG000018492.1 dd_Smed_v6_13327_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30007179SMESG000018492.1 dd_Smed_v6_13327_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30007179SMESG000018492.1 OX_Smed_1.0.09825ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
GABAergic neuronSMED30007179SMESG000018492.1 dd_Smed_v6_13327_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PKD2-4 vs. Ensembl Human
Match: PKD2 (polycystin 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9009])

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 330/710 (46.48%), Postives = 479/710 (67.46%), Query Frame = 2
Query:  248 PNSCW-NRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGT-FAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVIL----------------------PVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNTL 2305
            P   W  R   G+R LW TR  E++  +R+ Y+K+ LRELV Y+ FL VL I+++GM +   Y++T ++S LF  +  +    T F   ++  DFWKF  G LL+GLYW    +N    +D  +F++YEN L+G+PR+RQ+RVRN SCSIP D + EIK+C+  YS+SSE +  +G +N T W+YT+   L+ + + GI+ATY G G+Y++L+ T+ ++   + +L  N+W+DRGTRA  IDF+VYNANINLFC ++L+ EFP TGG++ S QF+ +KLIRYV + DFF+ ACE++F  FI YY+VEE LEI++ K  YF S WN LD+++++ S+     NI RT  V+ ++Q L  + N  PNFE L +WQ+QF+N+ A+T+F  W+K+FK+I+FN+TM+QLS T+SRC+KDL GFAIMFFIIF+A+AQL YL+FG QV+DFS  Q CI+T FRIILGD +FA++E A+R+ GP+YF  +VFF+FF+L NMFLAII DTY EVK +LA QK E E++D +++     L KL LKK+ + DI  ++  G     GK++FDE + +LK +G+ DAEIEA+F +YD DGD+ L E E   M+ +LE ++  LDL+       + +++    L                        VS EE++ L RRVDRM+++   IV+KID V+  LE +E+ K + RE +G +L+ +
Sbjct:  185 PRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSN-QTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFL-EDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGV 888          
BLAST of PKD2-4 vs. Ensembl Human
Match: PKD2L1 (polycystin 2 like 1, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9011])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 323/695 (46.47%), Postives = 464/695 (66.76%), Query Frame = 2
Query:  206 KSTKDSIEETNF-INPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEI---EAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPV-------VSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEK 2257
            K  +D  +ET +    +SC      GIR LW T  TE+T  +R+LYIKTTLREL++YI FL  + ++++GMT+  AY++T ++S LF  +  +D   +F A ++ +DFW F  GPLL+ LYWT WYNN +      +F+YYEN L+G+PRLRQ++VRNDSC +  DF+ +I  C+  YS   E +  +G  N T W Y +   L    + G + +Y GGG+Y++L  ++  S   +  L   LW+DRGTR V IDF+VYNANINLFC ++LV EFP TGG + S Q RTVKLIRYV + DFF++ CE++F VFI YY+VEE LE+ + +  Y  SIWNILD++VI+ S+    F+I RTL V  ++  L+   N + +FE L FWQ Q++N+ A+ LF AW+K+FKYISFNKTMTQLS+TL+RC+KD+ GFA+MFFI+F A+AQLGYL+FG QV +FS    CI+T FRIILGDFD+  ++ A+RI GP YFV YVFFVFFVL NMFLAII DTY EVKEELA QK+E +++D +K+     L +L L+K+++ D+Q  +  G+     ++ F+++   L+  G+ + EI    A F ++D DG++ LDE EQ  M+++LE+++ +L+ EI+     I++  +    P        VS EE+  L RRV +++     +V++ID V   L+ +E+
Sbjct:   51 KKPEDEPQETAYRTQVSSCCLHICQGIRGLWGTTLTENTAENRELYIKTTLRELLVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTP-SDTGVSFQAISSMADFWDFAQGPLLDSLYWTKWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNGTAWTYHSQDELGGFSHWGRLTSYSGGGYYLDLPGSRQGSAEALRALQEGLWLDRGTRVVFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDFFIVGCEVIFCVFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKERVSDVQKVLQGGEQ----EIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQEKMRQDLEEERVALNTEIEKLGRSIVSSPQGKSGPEAARAGGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLER 740          
BLAST of PKD2-4 vs. Ensembl Human
Match: PKD2L2 (polycystin 2 like 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9012])

HSP 1 Score: 405.216 bits (1040), Expect = 2.333e-130
Identity = 255/656 (38.87%), Postives = 397/656 (60.52%), Query Frame = 2
Query:  296 ATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFT-TSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNIN-FTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELA-NQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKE-LEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESI 2251
            A++H    +  +++ I TTL+EL++Y  FL  L I++FGM     Y+   ++S LF  TS   +    F +  + +DFWKF+ GPLL GLYW +WYNN   +     + +YYEN L+G+PR+RQ++VRN++C + S FQ  + +C+  Y+ ++E   ++G Q +T W Y+ S+  ++  + G +  Y  GG+   L+ ++ ++ N  + L  N WI RGTR + IDF++YNAN+NLFC I+LV EFP TGG+L S QF +VKL+RYV   D+F+ +CE+ F +F+  +  +E  +IK  K  YF SIWN L++L+++       FN    + +  ++  L+ +   + +F  L  W + ++N+IAIT+F AW+K+FK+ISFNKTM+QLS+TLSRC KD+ GFAIMFFIIF A+AQLG+L+FG+QV+DFS  Q  I+  FRI+LGDF+FA ++ A+ I GP+YF+ ++FFVFFVL NMFLAII DTY EVK + +  ++ +FE+   +K+  + VL K  L                     + D D+     K++G GD    A  AR +   +  +  AEQ+   KE LE +  S++++  Y+               V+ EE+R L      ++     I  K++ V+  + ++
Sbjct:   12 ASKHKLHYR--KEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYSTSNT-NSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDYFIASCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLKSTEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQSYKNVLEKFRL------------------KKAQKDEDK-----KTKGSGDL---AEQARREGFDENEIQNAEQMKKWKERLEKKYYSMEIQDDYQP--------------VTQEEFRELFLYAVELEKELHYINLKLNQVVRKVSAL 624          
BLAST of PKD2-4 vs. Ensembl Human
Match: PKD2L2 (polycystin 2 like 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9012])

HSP 1 Score: 402.905 bits (1034), Expect = 1.108e-129
Identity = 248/604 (41.06%), Postives = 380/604 (62.91%), Query Frame = 2
Query:  296 ATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFT-TSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNIN-FTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELA-NQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKE-LEDQKNSLDLEIQYE 2095
            A++H    +  +++ I TTL+EL++Y  FL  L I++FGM     Y+   ++S LF  TS   +    F +  + +DFWKF+ GPLL GLYW +WYNN   +     + +YYEN L+G+PR+RQ++VRN++C + S FQ  + +C+  Y+ ++E   ++G Q +T W Y+ S+  ++  + G +  Y  GG+   L+ ++ ++ N  + L  N WI RGTR + IDF++YNAN+NLFC I+LV EFP TGG+L S QF +VKL+RYV   D+F+ +CE+ F +F+  +  +E  +IK  K  YF SIWN L++L+++       FN    + +  ++  L+ +   + +F  L  W + ++N+IAIT+F AW+K+FK+ISFNKTM+QLS+TLSRC KD+ GFAIMFFIIF A+AQLG+L+FG+QV+DFS  Q  I+  FRI+LGDF+FA ++ A+ I GP+YF+ ++FFVFFVL NMFLAII DTY EVK + +  ++ +FE+   +K+  + VL K  LK                    K   DE   + K++G GD   +A    +D   +  +  AEQ+   KE LE +  S++++  Y+
Sbjct:   12 ASKHKLHYR--KEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYSTSNT-NSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDYFIASCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLKSTEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQSYKNVLEKFRLK--------------------KAQKDE---DKKTKGSGDLAEQARREGFD---ENEIQNAEQMKKWKERLEKKYYSMEIQDDYQ 586          
BLAST of PKD2-4 vs. Ensembl Human
Match: PKD2L2 (polycystin 2 like 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9012])

HSP 1 Score: 391.734 bits (1005), Expect = 1.586e-125
Identity = 248/624 (39.74%), Postives = 379/624 (60.74%), Query Frame = 2
Query:  296 ATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFT-TSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNIN-FTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELA-NQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKE-LEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEE 2155
            A++H    +  +++ I TTL+EL++Y  FL  L I++FGM     Y+   ++S LF  TS   +    F +  + +DFWKF+ GPLL GLYW +WYNN   +     + +YYEN L+G+PR+RQ++VRN++C + S FQ  + +C+  Y+ ++E   ++G Q +T W Y+ S+  ++  + G +  Y  GG+   L+ ++ ++ N  + L  N WI RGTR + IDF++YNAN+NLFC I+LV EFP TGG+L S QF +VKL+RYV   D+F+ +CE+ F +F+  +  +E  +IK  K  YF SIWN                       ++ ++  L+ +   + +F  L  W + ++N+IAIT+F AW+K+FK+ISFNKTM+QLS+TLSRC KD+ GFAIMFFIIF A+AQLG+L+FG+QV+DFS  Q  I+  FRI+LGDF+FA ++ A+ I GP+YF+ ++FFVFFVL NMFLAII DTY EVK + +  ++ +FE+   +K+  + VL K  L                     + D D+     K++G GD    A  AR +   +  +  AEQ+   KE LE +  S++++  Y+      + R++ L  V LE+
Sbjct:   12 ASKHKLHYR--KEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYSTSNT-NSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDYFIASCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWN----------------------WLELLLLLLLKSTEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQSYKNVLEKFRL------------------KKAQKDEDK-----KTKGSGDL---AEQARREGFDENEIQNAEQMKKWKERLEKKYYSMEIQDDYQPV-TQEEFRELFLYAVELEK 583          
BLAST of PKD2-4 vs. Ensembl Celegans
Match: pkd-2 (Polycystin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U1S7])

HSP 1 Score: 374.4 bits (960), Expect = 7.596e-118
Identity = 249/701 (35.52%), Postives = 391/701 (55.78%), Query Frame = 2
Query:  197 EYGKSTKDSIEETNFINPNSCWNRFKNGI---RSLWATRHTEDTKVDRQLYIKTTLR---ELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLN-STQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRE 2278
            E+G S   S+    + +        K GI   ++L A+ H    K D +  IK T R   E+  Y  FL VLV ++F   ++Q+Y+++ ++S LF  S     +  F + T+  + W +L+  L+ G+YWT   N    ++D  N +YYENRL+G PR+R ++V NDSC++   FQ EIK+CFA Y    E K   G  +   ++Y  +  L+  +  G +A+YGGGGF   L  +   ++ + I TL  N WIDRG+RA+I+DF +YNANINLFC +KL+ E P +GG++ + +  T  L+ Y  S    ++  E +F  FI+Y+I EE   I   +  Y    WN++D++++ FS+   I ++ RT T  N + +++ N   +  F+ +T  +  + N+ A  +F+AWVKVFK+IS NKTM+QLS+TL+R +KD+ GFA+MF + F AFAQ GYL FG Q+ D+S L    + L R+ILGDF+F+ LE  +R FGP +F+ YVFFV F+L NMFLAII D+Y EVK ELA +K+   I D+   +   +  +           +     G+        ++++K+ L   GY + +I   F R++      +    +   +K  ED  + +   +  +K   +   RD          Y  LNRRVD+M  +   IV +I+ V   L++IEK + + ++
Sbjct:   21 EHGPSFDHSMVSEEYEHDKKKNPAQKEGISFSQALLASGHE---KSDGK--IKLTARSFMEVGGYAVFLIVLVYVAFAQNSIQSYYYSKVMSDLFVASTGASGAPAFGSCTSMDNIWDWLSQVLIPGIYWTETSN----STDNENMIYYENRLLGEPRIRMLKVTNDSCTVMKSFQREIKECFANYEEKLEDKTMVGDGSVDAFIYATAKELENLKTVGTIASYGGGGFVQRLPVAGSTEAQSAIATLKANRWIDRGSRAIIVDFALYNANINLFCVVKLLFELPASGGVITTPKLMTYDLLTYQTSGGTRMMIFEGIFCGFILYFIFEELFAIGRHRLHYLTQFWNLVDVVLLGFSVATIILSVNRTKTGVNRVNSVIENGLTNAPFDDVTSSENSYLNIKACVVFVAWVKVFKFISVNKTMSQLSSTLTRSAKDIGGFAVMFAVFFFAFAQFGYLCFGTQIADYSNLYNSAFALLRLILGDFNFSALESCNRFFGPAFFIAYVFFVSFILLNMFLAIINDSYVEVKAELARKKDGEGILDWFMNKVRGLTKR----------GKRPDAPGE-----DATYEDYKLMLYRAGYAEKDINEAFTRFN------VTSMTEHVPEKVAEDIADEV-ARMTEQKRNYMENHRD----------YANLNRRVDQMQESVFSIVDRIEGVNATLQTIEKQRVQQQD 680          
BLAST of PKD2-4 vs. Ensembl Celegans
Match: lov-1 (Location of vulva defective 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09624])

HSP 1 Score: 165.236 bits (417), Expect = 2.406e-41
Identity = 145/559 (25.94%), Postives = 259/559 (46.33%), Query Frame = 2
Query:  302 RHTEDTKV-DRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNN------INFTSDQINFLYYENRLIGLPRLRQVRVRNDS-CSIPSDFQGEIKQCFAAYSMSSESKDSY------------GQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNL----WIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVF--------IVYYIVEESLEIKMLK-----FEYF-------FSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVAND-NIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLH 1843
            R TE+ K+ D QL+I  T+R+++ +   L ++V++++       YW+   +S +   +  N    TF +     DFW +    L   L   +WY+         + +D+++      R +G+  +RQVR +  + C++   FQG I  C    +  +E K  Y            G   S  + Y  S  L T    G++ +Y GGG+ ++++ TQ +    I+TLFN L    WID  TRAVII+F+ YNA IN F  ++L+ E P +G  L +S   +V+LI+  GS    V   E+L++ F        IV+Y+      I  +K     F+         FS WN +D++V   ++   +   +R  T    ++   AN+ N + N      W++ F   +A  +F    K+ + + FN+ +  L+ATL      +  F I F    + F  + Y + G ++  +  L     T    +LG  D   ++   + F  +  + Y+     ++  +++ II   + E++ +   Q N++EI D++K +T+  L  L 
Sbjct: 2660 RDTENRKMRDEQLFI--TIRDMLCFFASLYIMVMLTYYCKDRHGYWYQLEMSTILNINQKNYGDNTFMSIQHADDFWDWARESLATAL-LASWYDGNPAYGMRAYMNDKVS------RSMGIGTIRQVRTKKSAECTMFKQFQGYINDCGEELTSKNEEKTLYMQAGWTELESENGTDASDEYTYKTSEELSTETVSGLLYSYSGGGYTISMSGTQAE----IITLFNKLDSERWIDDHTRAVIIEFSAYNAQINYFSVVQLLVEIPKSGIYLPNSWVESVRLIKSEGSDGTVVKYYEMLYIFFSVLIFVKEIVFYLYGRYKVITTMKPTRNPFKIVYQLALGNFSPWNFMDLIVGALAVASVLAYTIRQRTTNRAMEDFNANNGNSYINLTEQRNWEIVFSYCLAGAVFFTSCKMIRILRFNRRIGVLAATLDNALGAIVSFGIAFLFFSMTFNSVLYAVLGNKMGGYRSLMATFQTALAGMLGKLDVTSIQPISQ-FAFVVIMLYMIAGSKLVLQLYVTIIMFEFEEIRNDSEKQTNDYEIIDHIKYKTKRRLGLLE 3204          
BLAST of PKD2-4 vs. Ensembl Fly
Match: Pkd2 (gene:FBgn0041195 transcript:FBtr0080365)

HSP 1 Score: 239.58 bits (610), Expect = 1.979e-66
Identity = 150/403 (37.22%), Postives = 239/403 (59.31%), Query Frame = 2
Query:  584 NINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFE-YFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEF 1789
            N++F   +     YEN L+G PRLRQ+RVR +SC +   F      C+AAYS  +E  D       +P+   +   LD+T    ++A Y  GG+ VNL+  +  +   I  L +  W+DRG+R  +++F ++N N ++F  IKL+ E PPTGG++  +  +TVK+  +       +    + + + ++YY + E  EI+    + YF S+ NILD  +++      ++NI  +  V ++      +D  + + + L FW + + +++AI  FL W+K+FK+ISFNKT+ Q + TL RCSKDLAGF++MF I+F+A+AQLG L+FG +  DF      I T+ R+ILGDF +  +E A+R+ GP+YF+ Y+  VFF+L NMFLAII +TY  VK E+   ++  
Sbjct:  417 NMSFHHLEGRVFLYENLLLGPPRLRQIRVRKESCYVNDAFIRYFNTCYAAYSSGAE--DRKPMHKGSPFRTMHD--LDSTPIWTVLAFYRTGGYTVNLDYDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLFNENTDIFQSIKLIAEIPPTGGVIPQAHLQTVKMYSFFTDRSMLMTVIYIFWYIMVIYYTIYEITEIRKSGIKIYFCSMLNILDCAILLGCYLALVYNIWHSFKVMSLT-ARAHSDVTYQSLDVLCFWNIIYVDMMAILAFLVWIKIFKFISFNKTLVQFTTTLKRCSKDLAGFSLMFGIVFLAYAQLGLLLFGTKHPDFRNFITSILTMIRMILGDFQYNLIEQANRVLGPIYFLTYILLVFFILLNMFLAIIMETYNTVKGEITQGRSHL 814          
BLAST of PKD2-4 vs. Ensembl Fly
Match: brv3 (gene:FBgn0040333 transcript:FBtr0300708)

HSP 1 Score: 65.4698 bits (158), Expect = 1.563e-10
Identity = 59/216 (27.31%), Postives = 101/216 (46.76%), Query Frame = 2
Query:  626 ENRLIGLPRLRQVRVRNDSCSI-PSDFQGE--IKQCFAAYSMSSESKDSYGQQNSTPWVYTN------SSVLDTTEYQGIVATYGGGGFYVNL-NSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFF-SIWNILDILVII 1240
            ++ L+G+ RLRQ+RV N    + P  F     +      Y     S D Y +    PW+          ++L   ++ G + +Y     YV+L   +  +S   I  L  N W+   T AV IDFT+YN ++NLF    L  E  P GG++   Q  + KL+  V  + +  L   L++V+  + +   ++L +K+    +   S+WN LD+ + +
Sbjct:  210 QSVLLGVMRLRQLRVSNPQVGLGPPKFSDTYYMPDWQLPYRKLHYS-DKYWRIYE-PWIPIKMGFEFLDALLMNFDHVGSLNSYPELAGYVSLLARSAANSMKVIDYLSENHWLTLNTSAVFIDFTLYNVDVNLFSICTLRVEKTPFGGIVPDVQVDSAKLLENVDQMPYTGLLALLIYVLVFIQF--AQTLAVKLWYEPHLLKSVWNKLDLFIFM 421          
BLAST of PKD2-4 vs. Ensembl Fly
Match: brv3 (gene:FBgn0040333 transcript:FBtr0340092)

HSP 1 Score: 65.4698 bits (158), Expect = 1.685e-10
Identity = 59/216 (27.31%), Postives = 101/216 (46.76%), Query Frame = 2
Query:  626 ENRLIGLPRLRQVRVRNDSCSI-PSDFQGE--IKQCFAAYSMSSESKDSYGQQNSTPWVYTN------SSVLDTTEYQGIVATYGGGGFYVNL-NSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFF-SIWNILDILVII 1240
            ++ L+G+ RLRQ+RV N    + P  F     +      Y     S D Y +    PW+          ++L   ++ G + +Y     YV+L   +  +S   I  L  N W+   T AV IDFT+YN ++NLF    L  E  P GG++   Q  + KL+  V  + +  L   L++V+  + +   ++L +K+    +   S+WN LD+ + +
Sbjct:  210 QSVLLGVMRLRQLRVSNPQVGLGPPKFSDTYYMPDWQLPYRKLHYS-DKYWRIYE-PWIPIKMGFEFLDALLMNFDHVGSLNSYPELAGYVSLLARSAANSMKVIDYLSENHWLTLNTSAVFIDFTLYNVDVNLFSICTLRVEKTPFGGIVPDVQVDSAKLLENVDQMPYTGLLALLIYVLVFIQF--AQTLAVKLWYEPHLLKSVWNKLDLFIFM 421          
BLAST of PKD2-4 vs. Ensembl Fly
Match: brv1 (gene:FBgn0036874 transcript:FBtr0074982)

HSP 1 Score: 56.225 bits (134), Expect = 1.248e-7
Identity = 68/295 (23.05%), Postives = 129/295 (43.73%), Query Frame = 2
Query:  632 RLIGLPRLRQVRVRND--SCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDT----TEYQGIVATYG-GGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKL-VGEFP---PTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTF---WQLQF--DNLIAITLFLAWVKVFKYISFNKTMTQLSATLS 1468
            RL+G+ RLRQ+R  ++    S+P   + +  + +          D Y     TPW+ + S   D       + G +  Y    G+ V L+ T+  S   I  L    W+D  T A+ +DF++YNA+ N F    L V +FP   P G   + S     +L  +       V    + ++ F   + ++   + + LK     ++W  +D +++  SL   +   VR     N++Q ++ +  I    + L F    QL +  D +  + + L  ++++K + F+ T    + T++
Sbjct:  208 RLLGVVRLRQLRTESNRLGLSLPVFTERDFSESWTLPYERVPYTDKYWPI-YTPWLPSVSVARDNLLMGINHVGHMFNYPESKGYKVLLSDTRHKSLKIIDYLMKKNWLDANTTALFMDFSLYNADANTFTVCTLWVEKFPYQYPDGHTRIESHTFVEQLREFTKFGMLMVFVFVVTWLQFTKAFFLKVWYDPRQLK-----TLWVQVDAMIVALSLVVGMIMSVR----DNLVQKMIKSVEIAVVVDFLDFREPAQLAYLEDVVTGLAVALVTMRLWKVLQFSATFQLFTKTIA 492          
BLAST of PKD2-4 vs. Ensembl Fly
Match: brv2 (gene:FBgn0036712 transcript:FBtr0331846)

HSP 1 Score: 53.9138 bits (128), Expect = 6.072e-7
Identity = 71/292 (24.32%), Postives = 128/292 (43.84%), Query Frame = 2
Query:  638 IGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNST--------PWV-------YTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFE-YFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTL-VANDNIHPNFE-SLTFWQLQF---DNLIAITLFLAWVKVFKYISFNKTMTQ 1450
            IG+ RLRQ+R  +  C I     G  K  +   + + E +  Y + + T        P+V       + N  +L+   Y  ++      G+ V + ST+++    I  L +  W+D+ T A+ ID T+YNA+ NLF  I L  E  P G  L      +V ++  V +     L   +LFV  ++  +    +  K+          W ++D+ + I ++  ++  I+R +    ++Q +  A    + +F+  L   Q+ F     L+ IT    W KV ++ S  +  TQ
Sbjct:  191 IGVVRLRQMRPVD--CHI-----GLGKPEWDKKTYAPEWRLPYHRMHYTEKFWRIYDPFVPAEFEPSFLNGLLLNYDHYGYLLNYPEVAGYVVLMMSTKINCLKQIEYLRDYSWLDKNTSALFIDLTMYNADANLFTLITLRVENSPFGIQLPRVHVDSVSMLGNVETRSNSELL--ILFVYTVLVILFARGVFTKIWHHPAAAHEAWTMVDLAIYILNVFLTVLAIMRDIETDALLQIIETATKGQYLDFQRPLRLHQMLFIVKGFLVCITTLRLW-KVLQFASVFQHFTQ 472          
BLAST of PKD2-4 vs. Ensembl Zebrafish
Match: pkd2 (polycystic kidney disease 2 [Source:NCBI gene;Acc:432387])

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 330/705 (46.81%), Postives = 472/705 (66.95%), Query Frame = 2
Query:  254 SCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGT-FAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQ----------YEKSEILNKTRDVILPVVSL------------EEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILN 2299
            SC  R    +R LW TR   ++  +R++Y+KT LRE++ YI FL  L II++GM +   Y++T ++S LF  +  +    T F + +T  DFWKF  GP LNG+YW  WYNN +   +Q + +YYEN L+G+PRLRQ+RVRN+SCS+  D + E+  C+  YS ++E K  +G +N T W + + S L  + Y G V+TYGGGG+Y +L+ T+  S N +  L NNLW+DRGTRAV +DF++YN N+NLFC ++L+ EFP TGG + S QF+TV+L+RYV S D+FV  CE+ F +F++YY+VEE+LEI++ +  YF S+WN LD+L++  S+   I NI RT  V + +  L+ N + +PNFE L   Q+ F+NL AI +FL+WVK+FK+I+FNKTM QLS T+SRC+KDL GFAIMFFI+F+A+AQL YL+FG QVNDFS  Q CI+T FRIILGDFDF+++E A  + GP+YF  +VFF+F +L NMFLAII DTY EVK ++A Q++E EI D +K+     + KL LKK  I DI +++        GK+ FDE + +L+ +G+ DAEIEA+FA+YD DGD+ L E E   M+ +LE ++  LDLE            + +S+  ++  D      S             EE++ L RRVDRM+++   IV+KID V+  LE++E+ K + R+ +G IL+
Sbjct:  124 SCGKRILEKMRVLWDTRLLGESNSNREMYLKTVLREMITYILFLLTLCIITYGMVSTNMYYYTKVMSQLFLDTPLSSGEPTNFKSLSTMEDFWKFTEGPFLNGMYWELWYNNKSLPENQ-SLIYYENLLLGVPRLRQLRVRNESCSVHEDLRDEVYDCYNVYSPANEDKAPFGPKNGTAWRFKDESSLGESSYWGQVSTYGGGGYYQDLSRTREKSANQLQELKNNLWLDRGTRAVFLDFSIYNGNVNLFCIVRLLVEFPATGGAVPSWQFQTVRLLRYVSSWDYFVGMCEVSFCLFVLYYLVEEALEIRLHRLRYFKSLWNCLDVLIVALSVPAIIMNICRTSAVSHRLHFLLENHSTYPNFEPLARLQVHFNNLAAIIVFLSWVKLFKFINFNKTMNQLSTTMSRCAKDLMGFAIMFFIVFLAYAQLAYLVFGTQVNDFSTFQACIFTQFRIILGDFDFSEIEEADSVLGPIYFTTFVFFIFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLIKKSYNRAMVKLKLKKSSINDIPDSL----QQAAGKLSFDELRQDLRGKGHSDAEIEAIFAKYDLDGDQELTEHEHQQMRDDLEKEREDLDLEHSSLPRPASGRSFSRSQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKMKRRDVLGRILD 823          
BLAST of PKD2-4 vs. Ensembl Zebrafish
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 313/685 (45.69%), Postives = 466/685 (68.03%), Query Frame = 2
Query:  251 NSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQ-YEKS-EILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEAL-------ESIEKDKARSRE 2278
            + C + F   I+ LW T   +DTK + +L +K  L+EL+IYI FL  L ++++GMT+   Y++T  ++ LF       N  +F++    +D W ++ GPLL+ LYWT WYN+    +   +F+YYEN L+G+PR+RQ++V+ +SC +P+DF+ EI  CF  Y++  E   ++G  N T W Y +   +  + + G++ TY G GFY +L +T+ +S   +  L  NLW+DRGTR + IDFT YNANINLFC I+LV EFP TGG + S Q RTVKLIRYV + D+F++ CE++F VFI+YYIVEE LE ++ K  +F SIWNILDI+VI+ ++   +F+  RT+ V  ++  L+   +I+ +FE L FWQ Q++N+ A+ LF AW+K+FKYISFNKTMTQL++TL+RC+ D+ GFAIMFFI+F A+AQLGYL+FG +V  FS    CI+T FRIILGDFD+  ++ A+R+ GP+YF  YVFFVFFVL NMFLAII DTY EVK ELA+QK+EF+IAD +K+       KL LKK+KI D+Q A+ +G +    +++F +++  LK  G+ D EI A F+++D DG++ LD+ EQ  M++ELE+++++L  E++  E S E   + R+ + P    E+Y+ L  +V +++N+   I++K+D V+E +       ES + DK  +R+
Sbjct:   59 SGCCSFFFRAIKGLWGTALRKDTKENPELNVKANLKELLIYIVFLVDLCLLTYGMTSSATYYYTKAMTDLFVNLP-GSNGMSFSSIGCMNDVWTYMEGPLLDNLYWTKWYNDEPLENGNQSFIYYENLLLGVPRVRQLKVKQNSCKVPTDFKKEISDCFDVYNIKKEDDGAFGLINGTAWQYHSEKEIKGSSHWGLLTTYSGAGFYQDLTTTRDESAALLEDLRENLWLDRGTRVLFIDFTAYNANINLFCVIRLVVEFPATGGAIPSYQIRTVKLIRYVTTWDYFIIGCEIVFCVFILYYIVEEILEFRIHKLSHFTSIWNILDIVVILLAVVAIVFSAFRTIKVDGLLGNLLKQPDIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLTSTLARCALDIFGFAIMFFIVFFAYAQLGYLLFGTEVETFSTFNKCIFTQFRIILGDFDYDAIDRANRVLGPIYFFSYVFFVFFVLLNMFLAIINDTYSEVKSELASQKDEFQIADLIKQSYAKTFMKLKLKKEKISDVQKALDSGAS----ELEFKDFRNALKEMGHSDREISAAFSKFDQDGNQTLDKQEQENMKQELEEKRDALSAELRDLENSVEPAEEHRNTVPP----EDYQRLVHKVSQLENSVSAIMSKLDFVMEKMRLQTFNTESRDMDKQTNRD 734          
BLAST of PKD2-4 vs. Ensembl Zebrafish
Match: pkd1l2a (polycystic kidney disease 1 like 2a [Source:ZFIN;Acc:ZDB-GENE-050208-89])

HSP 1 Score: 196.438 bits (498), Expect = 2.632e-51
Identity = 149/508 (29.33%), Postives = 255/508 (50.20%), Query Frame = 2
Query:  353 LRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQ-NST-----------PWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKL 1840
            +RE++IY+ FL +L+++++G     AY+ T+ +   F+T          + +    D + +    LL  LY         F +D        ++L+G  R+RQVRVR D+C I +  Q  ++ C A YS  SE   SY    N T           PW Y   + L      G +A Y GGGF V+L   Q ++   +  LF+N W+D  TRAV ++FTVYNAN+NLFC + L+ E    G     S+ + V L +  G    FV+A E ++ +FI+YY+V +   +K  K+ YF S WN+L++ +II S +     + RT+     I+    N ++  +F            LIA  + LA +K++  +  N  +  +++TL R   D++GF ++  I+F+A++    L++G ++N +  L     T+  + LG F++ ++   + + G       + F+ FV+ N+F+++I   + E  E+L    +E E      E  E++L K+
Sbjct:  617 IREILIYVGFLWMLLLVAYGQRDPNAYYLTHHIRQSFSTG--------ISETLNHKDIFIWANSSLLRNLYG----QYPGFITDG------NSKLVGNARIRQVRVRRDTCKIANPMQYSVRDCHAPYSWESEDMGSYSPGWNQTRNVNGSKTVLKPWYYQTQAKLRANPVWGGLALYKGGGFVVDLGPDQKNASRLLQYLFDNTWLDVYTRAVFVEFTVYNANVNLFCIVTLIFETTGVGTFQYRSEVQAVHLYQSTGGFHVFVMASEAIYYIFILYYMVVQGKLMKQQKWAYFKSKWNLLELAIIILSWSALSVFVKRTILGNRDIEFYQNNKDMFVSFNETATADAVLGYLIAFLVLLATIKLWHLLRLNPKLHMITSTLQRAWTDISGFIVVMTIMFLAYSIACNLMYGWRLNSYRTLLEAAQTIICLQLGIFNYDEVLDYNPVLGAFLIGSCIIFMTFVVLNLFISVILVAFNE--EQLHPTPSEEE------EIVELMLMKV 1098          
BLAST of PKD2-4 vs. Ensembl Zebrafish
Match: pkd1l2a (polycystic kidney disease 1 like 2a [Source:ZFIN;Acc:ZDB-GENE-050208-89])

HSP 1 Score: 194.897 bits (494), Expect = 1.501e-50
Identity = 161/568 (28.35%), Postives = 276/568 (48.59%), Query Frame = 2
Query:  188 DSYEYGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIK-----TTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQ-NST-----------PWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKL 1840
            D  EYG  + D    +N  +P++     ++   S +      D +  R   IK       +RE++IY+ FL +L+++++G     AY+ T+ +   F+T          + +    D + +    LL  LY         F +D        ++L+G  R+RQVRVR D+C I +  Q  ++ C A YS  SE   SY    N T           PW Y   + L      G +A Y GGGF V+L   Q ++   +  LF+N W+D  TRAV ++FTVYNAN+NLFC + L+ E    G     S+ + V L +  G    FV+A E ++ +FI+YY+V +   +K  K+ YF S WN+L++ +II S +     + RT+     I+    N ++  +F            LIA  + LA +K++  +  N  +  +++TL R   D++GF ++  I+F+A++    L++G ++N +  L     T+  + LG F++ ++   + + G       + F+ FV+ N+F+++I   + E  E+L    +E E      E  E++L K+
Sbjct: 1918 DQDEYGDVSIDGTL-SNTDDPDAVRIARRDSTCSFYKPPPPTDIEKMRNNMIKEQKVFALIREILIYVGFLWMLLLVAYGQRDPNAYYLTHHIRQSFSTG--------ISETLNHKDIFIWANSSLLRNLYG----QYPGFITDG------NSKLVGNARIRQVRVRRDTCKIANPMQYSVRDCHAPYSWESEDMGSYSPGWNQTRNVNGSKTVLKPWYYQTQAKLRANPVWGGLALYKGGGFVVDLGPDQKNASRLLQYLFDNTWLDVYTRAVFVEFTVYNANVNLFCIVTLIFETTGVGTFQYRSEVQAVHLYQSTGGFHVFVMASEAIYYIFILYYMVVQGKLMKQQKWAYFKSKWNLLELAIIILSWSALSVFVKRTILGNRDIEFYQNNKDMFVSFNETATADAVLGYLIAFLVLLATIKLWHLLRLNPKLHMITSTLQRAWTDISGFIVVMTIMFLAYSIACNLMYGWRLNSYRTLLEAAQTIICLQLGIFNYDEVLDYNPVLGAFLIGSCIIFMTFVVLNLFISVILVAFNE--EQLHPTPSEEE------EIVELMLMKV 2458          
BLAST of PKD2-4 vs. Ensembl Zebrafish
Match: pkd1l2b (polycystic kidney disease 1 like 2b [Source:ZFIN;Acc:ZDB-GENE-141222-87])

HSP 1 Score: 170.629 bits (431), Expect = 3.507e-43
Identity = 135/516 (26.16%), Postives = 250/516 (48.45%), Query Frame = 2
Query:  329 RQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYG------------QQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKL 1840
            +Q   +  + E++I++ FL++L+++++G     A++ T  +   F        S   + S   +D + +    LL  L+         F +D        ++L+G  R+RQVRV+ D+C +       + QC   YS  +E   SYG            ++  T W Y + S L      G+ A Y GGG+ ++L   + ++   +  LFN+ W+D  TRAV ++FTVYNAN++LFC + L+ E    G     S  + V L   VGS   F++A  +++ +F+VYY+  +   +K  K+ YF + WN+LD+ +II S +     I +T+     IQ    + N  P+F            ++A  + L  VK++  +  +  +  ++++L R   D++   ++ FII +A++    LIFG ++  +  L      +F + +G F++ ++  ++   G +     V    FV+ ++F++II     E +E   +Q +E E      E  E+V+ K+
Sbjct:  512 KQQKAQALVMEVLIFLGFLSMLLLVAYGQQDPNAFYLTQHIQQSF--------SKGISDSMKTNDVFVWANTVLLKNLF----GQYPGFITDG------NSKLVGNARIRQVRVKKDTCKVAKVMLHTVSQCNTPYSWGNEDMMSYGPGWEEFNSVNGSEEGITAWQYQSQSTLKALPVWGLTALYRGGGYVMDLGPDKQNATMKLQYLFNSTWLDEYTRAVFVEFTVYNANVDLFCIVTLILESSAVGAFQFRSVLQNVSLYSSVGSFMSFLMASRVIYFLFVVYYMFLQGKLLKRQKWAYFRNKWNLLDMAIIILSWSSLSLFIQKTVQGNIDIQYYQKHKNQFPSFHDTAAVDATLRYVMAFLVLLGCVKLWHLLRLSPKLYVIASSLQRAWDDMSTLTVVIFIILLAYSLACNLIFGWELYTYRTLPDAFTAIFSLQIGIFNYDEVMNSNPALGAVIISSCVLIATFVVLSLFISIILMAVTEEREN--HQPSEEE------ETVELVMMKI 1001          
BLAST of PKD2-4 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 315/696 (45.26%), Postives = 462/696 (66.38%), Query Frame = 2
Query:  281 IRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGT-FAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSL----------------------EEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILN 2299
            +R LW TR+TE+    R+ Y+K   REL+ YI FL ++ ++++ M T   +++T  +S LF     + +  T F    T  DFWKF  GPL++GLYW  WYNN     +  +F+YYEN L+G+PRLRQ+RV+N SCS+P D + EIK C+ +YS+ +E    +G +N T W YT    L+ +   G+++ Y G G+Y++L+  + +S   I  L NNLW+DRGTRAV IDF+VYNAN+NLFC ++L+ EFP TGGL+ S QF+TVKLI Y+ S +FF+ ACE++F +FI+YYI+EE LEI +    YF S+WN LDI++I  SL     ++ +  +V+  +   +++ N+ PN ESL +WQ+QF+++ A+ +F AWVK+FK+ +FN+TMTQLS T+SRC+KD+ GFAIMFFIIF+A+AQ  YL+FG Q++DFS  Q+CI+T FRIILGDFDF ++E A+RI GP+YF  +VFF+FF+L NMFLAII DTY EVK ++A QK+E E+ D +K+     + KL LKK  + DI  ++  G     GK++FDE + +LK +G+ DAEIEA+FA+YD DGD+ L E E   M+ +LE ++  L+++       +  ++    L                           EE++ L RRVDRM+++   IV+KID V+  LE++E+ K + RE +G +L+
Sbjct:  174 VRGLWGTRYTEERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVSKDERTNFKTLLTMDDFWKFTEGPLMDGLYWDMWYNNRTMAENH-SFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPFGLRNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIKKGCSKAMVKLKLKKTTVDDISESIRQGG----GKLNFDELRQDLKGKGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEKEREDLEMDRGSLPRPMSGRSFPRSLDDSEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLD 864          
BLAST of PKD2-4 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 318/707 (44.98%), Postives = 466/707 (65.91%), Query Frame = 2
Query:  248 PNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGT-FAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSL----------------------EEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILN 2299
            P+    +F  G R LW TR+TE+    R+ Y+K   REL+ YI FL ++ ++++ M T   +++T  +S LF     + +  T F    T  DFWKF  GPL++GLYW  WYNN     +  +F+YYEN L+G+PRLRQ+RV+N SCS+P D + EIK C+ +YS+ +E    +G +N T W YT    L+ +   G+++ Y G G+Y++L+  + +S   I  L NNLW+DRGTRAV IDF+VYNAN+NLFC ++L+ EFP TGGL+ S QF+TVKLI Y+ S +FF+ ACE++F +FI+YYI+EE LEI +    YF S+WN LDI++I  SL     ++ +  +V+  +   +++ N+ PN ESL +WQ+QF+++ A+ +F AWVK+FK+ +FN+TMTQLS T+SRC+KD+ GFAIMFFIIF+A+AQ  YL+FG Q++DFS  Q+CI+T FRIILGDFDF ++E A+RI GP+YF  +VFF+FF+L NMFLAII DTY EVK ++A QK+E E+ D +K+     + KL LKK  + DI  ++  G     GK++FDE + +LK +G+ DAEIEA+FA+YD DGD+ L E E   M+ +LE ++  L+++       +  ++    L                           EE++ L RRVDRM+++   IV+KID V+  LE++E+ K + RE +G +L+
Sbjct:    2 PSPLKAKFGLGFR-LWGTRYTEERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVSKDERTNFKTLLTMDDFWKFTEGPLMDGLYWDMWYNNRTMAENH-SFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPFGLRNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIKKGCSKAMVKLKLKKTTVDDISESIRQGG----GKLNFDELRQDLKGKGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEKEREDLEMDRGSLPRPMSGRSFPRSLDDSEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLD 702          
BLAST of PKD2-4 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 317/710 (44.65%), Postives = 464/710 (65.35%), Query Frame = 2
Query:  245 NPNSCW--NRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGT-FAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSL----------------------EEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILN 2299
             P+  W  N        LW TR+TE+    R+ Y+K   REL+ YI FL ++ ++++ M T   +++T  +S LF     + +  T F    T  DFWKF  GPL++GLYW  WYNN     +  +F+YYEN L+G+PRLRQ+RV+N SCS+P D + EIK C+ +YS+ +E    +G +N T W YT    L+ +   G+++ Y G G+Y++L+  + +S   I  L NNLW+DRGTRAV IDF+VYNAN+NLFC ++L+ EFP TGGL+ S QF+TVKLI Y+ S +FF+ ACE++F +FI+YYI+EE LEI +    YF S+WN LDI++I  SL     ++ +  +V+  +   +++ N+ PN ESL +WQ+QF+++ A+ +F AWVK+FK+ +FN+TMTQLS T+SRC+KD+ GFAIMFFIIF+A+AQ  YL+FG Q++DFS  Q+CI+T FRIILGDFDF ++E A+RI GP+YF  +VFF+FF+L NMFLAII DTY EVK ++A QK+E E+ D +K+     + KL LKK  + DI  ++  G     GK++FDE + +LK +G+ DAEIEA+FA+YD DGD+ L E E   M+ +LE ++  L+++       +  ++    L                           EE++ L RRVDRM+++   IV+KID V+  LE++E+ K + RE +G +L+
Sbjct:  161 KPSLAWATNLLDMPSHRLWGTRYTEERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVSKDERTNFKTLLTMDDFWKFTEGPLMDGLYWDMWYNNRTMAENH-SFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPFGLRNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIKKGCSKAMVKLKLKKTTVDDISESIRQGG----GKLNFDELRQDLKGKGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEKEREDLEMDRGSLPRPMSGRSFPRSLDDSEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLD 865          
BLAST of PKD2-4 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 314/694 (45.24%), Postives = 460/694 (66.28%), Query Frame = 2
Query:  287 SLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGT-FAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSL----------------------EEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILN 2299
             LW TR+TE+    R+ Y+K   REL+ YI FL ++ ++++ M T   +++T  +S LF     + +  T F    T  DFWKF  GPL++GLYW  WYNN     +  +F+YYEN L+G+PRLRQ+RV+N SCS+P D + EIK C+ +YS+ +E    +G +N T W YT    L+ +   G+++ Y G G+Y++L+  + +S   I  L NNLW+DRGTRAV IDF+VYNAN+NLFC ++L+ EFP TGGL+ S QF+TVKLI Y+ S +FF+ ACE++F +FI+YYI+EE LEI +    YF S+WN LDI++I  SL     ++ +  +V+  +   +++ N+ PN ESL +WQ+QF+++ A+ +F AWVK+FK+ +FN+TMTQLS T+SRC+KD+ GFAIMFFIIF+A+AQ  YL+FG Q++DFS  Q+CI+T FRIILGDFDF ++E A+RI GP+YF  +VFF+FF+L NMFLAII DTY EVK ++A QK+E E+ D +K+     + KL LKK  + DI  ++  G     GK++FDE + +LK +G+ DAEIEA+FA+YD DGD+ L E E   M+ +LE ++  L+++       +  ++    L                           EE++ L RRVDRM+++   IV+KID V+  LE++E+ K + RE +G +L+
Sbjct:  180 GLWGTRYTEERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVSKDERTNFKTLLTMDDFWKFTEGPLMDGLYWDMWYNNRTMAENH-SFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPFGLRNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIKKGCSKAMVKLKLKKTTVDDISESIRQGG----GKLNFDELRQDLKGKGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEKEREDLEMDRGSLPRPMSGRSFPRSLDDSEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLD 868          
BLAST of PKD2-4 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 315/695 (45.32%), Postives = 463/695 (66.62%), Query Frame = 2
Query:  284 RSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGT-FAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSL----------------------EEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILN 2299
            R LW TR+TE+    R+ Y+K   REL+ YI FL ++ ++++ M T   +++T  +S LF     + +  T F    T  DFWKF  GPL++GLYW  WYNN     +  +F+YYEN L+G+PRLRQ+RV+N SCS+P D + EIK C+ +YS+ +E    +G +N T W YT    L+ +   G+++ Y G G+Y++L+  + +S   I  L NNLW+DRGTRAV IDF+VYNAN+NLFC ++L+ EFP TGGL+ S QF+TVKLI Y+ S +FF+ ACE++F +FI+YYI+EE LEI +    YF S+WN LDI++I  SL     ++ +  +V+  +   +++ N+ PN ESL +WQ+QF+++ A+ +F AWVK+FK+ +FN+TMTQLS T+SRC+KD+ GFAIMFFIIF+A+AQ  YL+FG Q++DFS  Q+CI+T FRIILGDFDF ++E A+RI GP+YF  +VFF+FF+L NMFLAII DTY EVK ++A QK+E E+ D +K+ ++  + KL LKK  + DI  ++  G     GK++FDE + +LK +G+ DAEIEA+FA+YD DGD+ L E E   M+ +LE ++  L+++       +  ++    L                           EE++ L RRVDRM+++   IV+KID V+  LE++E+ K + RE +G +L+
Sbjct:   51 RRLWGTRYTEERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVSKDERTNFKTLLTMDDFWKFTEGPLMDGLYWDMWYNNRTMAENH-SFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPFGLRNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIKKVSKA-MVKLKLKKTTVDDISESIRQGG----GKLNFDELRQDLKGKGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEKEREDLEMDRGSLPRPMSGRSFPRSLDDSEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLD 739          
BLAST of PKD2-4 vs. Ensembl Mouse
Match: Pkd2 (polycystin 2, transient receptor potential cation channel [Source:MGI Symbol;Acc:MGI:1099818])

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 325/710 (45.77%), Postives = 475/710 (66.90%), Query Frame = 2
Query:  248 PNSCW-NRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGT-FAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVIL----------------------PVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNTL 2305
            P   W  R   G+R LW TR  E++  +R+ Y+K+ LRELV Y+FFL VL I+++GM +   Y++T  LS LF  +  +    T F   ++  DFWKF  G  L+GLYW    +N +  +D  +F++YEN L+G+PRLRQ+RVRN SCSIP D + EIK+C+  YS+SSE +  +G +N T W+YT+   L+ + + GI+A+Y G G+Y++L+ T+ ++   +  L  N W+DRGTRA  IDF+VYNANINLFC ++L+ EFP TGG++ S QF+ VKLIRYV + DFF+ ACE++F  FI+YY+VEE LEI++ +  YF S WN LD+++++ S+   + NI R    + ++Q L  + N  PNFE + +WQ+QF+N+ A+ +FL W+K+FK+I+FN+TM+QLS T+SRC+KDL GF IMF IIF+A+AQL YL+FG QV+DFS  Q CI+T FRIILGD +FA++E A+R+ GPLYF  +VFF+FF+L NMFLAII D+Y EVK +LA QK E E++D +++  +  L KL LK++ +  I  ++  G     GK++FDE + +LK +G+ DAEIEA+F +YD DGD+ L E E   M+ +LE ++  LDLE       + +++    L                        VS EE++ L RRVDRM+++   IV+KID V+  LE +E+ K + RE +G +L+ +
Sbjct:  183 PRVAWAERLVRGLRGLWGTRLMEESNANREKYLKSVLRELVTYLFFLVVLCILTYGMMSSNVYYYTRTLSQLFIDTPVSKTEKTNFKTLSSMEDFWKFTEGSFLDGLYWKAQTSN-HTQADNRSFIFYENLLLGVPRLRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWMYTSEKELNGSSHWGIIASYSGAGYYLDLSRTREETAAQLAGLRRNFWLDRGTRAAFIDFSVYNANINLFCVVRLLAEFPATGGVVPSWQFQPVKLIRYVTAFDFFLAACEIIFCFFIIYYVVEEILEIRIHRLSYFRSFWNCLDVVIVVLSVVAMVINIYRMSNAEGLLQFL-EDQNSFPNFEHVAYWQIQFNNISAVMVFLVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFTIMFSIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPLYFTTFVFFMFFILLNMFLAIINDSYSEVKSDLAQQKAEMELSDLIRKGCQKALVKLKLKRNTVDAISESLRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEREHQQMRDDLEKEREDLDLEHSSLPRPMSSRSFPRSLDDSEEEDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGV 886          
BLAST of PKD2-4 vs. Ensembl Mouse
Match: Pkd2l1 (polycystic kidney disease 2-like 1 [Source:MGI Symbol;Acc:MGI:1352448])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 320/676 (47.34%), Postives = 454/676 (67.16%), Query Frame = 2
Query:  251 NSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQ-------YEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEK 2257
            +SC       IR LW T  TE+T  +R+LY+KTTLRELV+YI FL  + ++++GMT+  AY++T ++S LF  +  +D+  +F   ++ SDFW F  GPLL+ LYWT WYNN +      +F+YYEN L+G PRLRQ+RVRNDSC +  DF+ +I  C+  YS   E +  +G QN T W Y + + L  + + G + +Y GGG+Y++L  ++  S   +  L   LW+DRGTR V IDF+VYNANINLFC ++LV EFP TGG + S Q RTVKLIRYV + DFF++ CE++F VFI YY+VEE LEI + +  Y  S+WNILD++VI+ S+    F+I RTL V  ++  L+   + + +FE L FWQ Q++N+ A+ LF AW+K+FKYISFNKTMTQLS+TL+RC+KD+ GFAIMFFI+F A+AQLGYL+FG QV +FS    CI+T FRIILGDFD+  ++ A+RI GP+YFV YVFFVFFVL NMFLAII DTY EVKEELA QK++ +++D++K+     L +L L+K+++ D+Q  +  G+     ++ F+++   L+  G+ + EI A F R+D DGD  LDE EQ  M++ LE+++ +L+ EI+       +     L          VS EE+  L RRV ++      +V++ID V   L+ +E+
Sbjct:   67 SSCCLHICRSIRGLWGTTLTENTAENRELYVKTTLRELVVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTP-SDSGVSFQTISSMSDFWDFAQGPLLDSLYWTKWYNNQSLGRGSHSFIYYENLLLGAPRLRQLRVRNDSCVVHEDFREDILNCYDVYSPDKEDQLPFGPQNGTAWTYHSQNELGGSSHWGRLTSYSGGGYYLDLPGSRQASAEALQGLQEGLWLDRGTRVVFIDFSVYNANINLFCILRLVVEFPATGGTIPSWQIRTVKLIRYVNNWDFFIVGCEVVFCVFIFYYVVEEILEIHLHRLRYLSSVWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQPDTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYNAIDNANRILGPVYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDQLQLSDFLKQSYNKTLLRLRLRKERVSDVQKVLKGGEP----EIQFEDFTSTLRELGHEEHEITAAFTRFDQDGDHILDEEEQEQMRQGLEEERVTLNAEIENLGRSVGHSPPGELGAEAARGQSWVSGEEFDMLTRRVLQLQCVLEGVVSQIDAVGSKLKMLER 737          
BLAST of PKD2-4 vs. Ensembl Mouse
Match: Pkd2l2 (polycystic kidney disease 2-like 2 [Source:MGI Symbol;Acc:MGI:1858231])

HSP 1 Score: 398.667 bits (1023), Expect = 4.496e-128
Identity = 255/651 (39.17%), Postives = 389/651 (59.75%), Query Frame = 2
Query:  311 EDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFT-TSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTS-DQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELA-NQKNEFEIADYVKERTEVVLAKLHL---XXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALE 2245
             D    R+  + TTL EL++Y  FL  L I++FGM     Y+   ++S LF  TS  +D   +F +  + ++FWKF+ GPL++GLYW +WY N    S    + +YYEN L+G+PR+RQ+RVRN++C +   FQ  +  C++ Y++ +E    +G + +  W +T SS      + G V  Y  GG+ V L+ ++ ++    + L  N WI RGTRAV IDF++YNAN+NLFC I+L+ EFP TGGLL S QF +VKL+RYV   D+F+ +CE++F +F+  +I++E  ++   K  YF S+WN L++L+++       F     +    ++  L+ N + +P+F  L +W + ++N+IAIT+F AW+K+FK+ISFN+TM+QLS+TLSRC KD+ GFAIMFFIIF A+AQLG+L+FG+QV+DFS  Q  I+  FRI+LGDF+FA ++ A+ I GP+YF+ ++FFVFFVL NMFLAII DTY EVK + +  ++ +FE+   +++    VL KL L   +  +   +Q   +A     DG   FDE            +EI+               EAEQ+   KE         LE +Y  +EI    +D   PV   +E+R L      ++     +  K++ ++  L 
Sbjct:   15 HDLHYRREAEVNTTLEELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFVDTSLPDDERSSFRSIRSITEFWKFMEGPLIDGLYWDSWYGNKQLYSVKNSSRIYYENVLLGIPRVRQLRVRNNTCKVYPAFQSLVSDCYSKYTVENEDFSDFGLKRNPEWTHTPSSRTAPWHW-GFVGVYRDGGYIVTLSKSKSETKAKFVDLRLNNWISRGTRAVFIDFSLYNANVNLFCIIRLLAEFPATGGLLTSWQFYSVKLLRYVSYYDYFIASCEVIFCIFLFVFIIQELRKVNEFKSAYFRSVWNWLEMLLLLLCFLAVSFYAYCNMQSFLLLGQLLKNTDSYPDFYFLAYWHIYYNNVIAITIFFAWIKIFKFISFNETMSQLSSTLSRCMKDIVGFAIMFFIIFSAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANWILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRPDFELGKIIQKSCFNVLEKLRLKKAQAKEEKKMQTTDLAQRARRDG---FDE------------SEIQ---------------EAEQMKRWKE--------RLEKKYYSTEI----QDDYQPVTQ-QEFRELFLYAVELEKELHYVSLKLNQLMRKLH 621          
BLAST of PKD2-4 vs. Ensembl Mouse
Match: Pkd2l2 (polycystic kidney disease 2-like 2 [Source:MGI Symbol;Acc:MGI:1858231])

HSP 1 Score: 398.667 bits (1023), Expect = 4.496e-128
Identity = 255/651 (39.17%), Postives = 389/651 (59.75%), Query Frame = 2
Query:  311 EDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFT-TSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTS-DQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELA-NQKNEFEIADYVKERTEVVLAKLHL---XXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALE 2245
             D    R+  + TTL EL++Y  FL  L I++FGM     Y+   ++S LF  TS  +D   +F +  + ++FWKF+ GPL++GLYW +WY N    S    + +YYEN L+G+PR+RQ+RVRN++C +   FQ  +  C++ Y++ +E    +G + +  W +T SS      + G V  Y  GG+ V L+ ++ ++    + L  N WI RGTRAV IDF++YNAN+NLFC I+L+ EFP TGGLL S QF +VKL+RYV   D+F+ +CE++F +F+  +I++E  ++   K  YF S+WN L++L+++       F     +    ++  L+ N + +P+F  L +W + ++N+IAIT+F AW+K+FK+ISFN+TM+QLS+TLSRC KD+ GFAIMFFIIF A+AQLG+L+FG+QV+DFS  Q  I+  FRI+LGDF+FA ++ A+ I GP+YF+ ++FFVFFVL NMFLAII DTY EVK + +  ++ +FE+   +++    VL KL L   +  +   +Q   +A     DG   FDE            +EI+               EAEQ+   KE         LE +Y  +EI    +D   PV   +E+R L      ++     +  K++ ++  L 
Sbjct:   15 HDLHYRREAEVNTTLEELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFVDTSLPDDERSSFRSIRSITEFWKFMEGPLIDGLYWDSWYGNKQLYSVKNSSRIYYENVLLGIPRVRQLRVRNNTCKVYPAFQSLVSDCYSKYTVENEDFSDFGLKRNPEWTHTPSSRTAPWHW-GFVGVYRDGGYIVTLSKSKSETKAKFVDLRLNNWISRGTRAVFIDFSLYNANVNLFCIIRLLAEFPATGGLLTSWQFYSVKLLRYVSYYDYFIASCEVIFCIFLFVFIIQELRKVNEFKSAYFRSVWNWLEMLLLLLCFLAVSFYAYCNMQSFLLLGQLLKNTDSYPDFYFLAYWHIYYNNVIAITIFFAWIKIFKFISFNETMSQLSSTLSRCMKDIVGFAIMFFIIFSAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANWILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRPDFELGKIIQKSCFNVLEKLRLKKAQAKEEKKMQTTDLAQRARRDG---FDE------------SEIQ---------------EAEQMKRWKE--------RLEKKYYSTEI----QDDYQPVTQ-QEFRELFLYAVELEKELHYVSLKLNQLMRKLH 621          
BLAST of PKD2-4 vs. Ensembl Mouse
Match: Pkd1l2 (polycystic kidney disease 1 like 2 [Source:MGI Symbol;Acc:MGI:2664668])

HSP 1 Score: 176.022 bits (445), Expect = 1.519e-44
Identity = 135/495 (27.27%), Postives = 238/495 (48.08%), Query Frame = 2
Query:  353 LRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQ---------QNSTP--WVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQK-NEFEIAD 1801
            +RE++ Y+ FL +L+++++G     AY F   L   F        S  F+       F+++    L+  LY     ++  F +D        ++L+G   +RQVRVR  SC++    Q  +  C   YS+  E    YG+          N  P  W Y + S        G +  YGGGG+ V L +    +   +  LF+N W+D  TRAV ++FTVYNAN+NLFC + L  E    G        ++++L  +      FV+A EL + +F+ YY+V +   ++  K+ YF S WN+L++ +I+ S +  +  + RT+     +Q    + +   +F            +IA  + L+ VK++  +  N  M  +++ L R   D++GF  +  I+ +A++    L+FG ++  +  L     T+  + LG F++ ++     I G L     + F+ FV+ N+F+++I   + E  E+ ++Q   E EIAD
Sbjct: 1943 IREILAYLAFLWMLLLVAYGQRDPNAYHFHRHLERSF--------SQGFSPVLGFRGFFEWANTTLVKNLYG----HHPGFVTDG------NSKLVGSAHIRQVRVRESSCAVAQQLQDSLDGCHGPYSLGIEDLVDYGEGWNASAYNNSNGFPQAWRYQSQSQRRGYPMWGKLTLYGGGGYVVPLGTDHQSASRILQYLFDNSWLDALTRAVFVEFTVYNANVNLFCTVTLTLETSGLGTFFSHVTLQSLRLYPFTDGWHPFVVAAELTYFLFLFYYMVVQGKLMRKQKWGYFCSKWNLLEVAIILASWSALVVFVKRTILADRDLQRYREHRDEGISFSETAAADAALGYIIAFLVLLSTVKLWHLLRLNPKMNMITSALRRAWGDISGFVAVILIMLLAYSFASNLVFGWKLRSYKTLFDAAETMVSLQLGIFNYEEVLDYSPILGSLLIGSCIVFMTFVVLNLFISVILVAFSE--EQKSDQLWEEGEIAD 2417          
BLAST of PKD2-4 vs. UniProt/SwissProt
Match: sp|Q6IVV8|PKD2_DANRE (Polycystin-2 OS=Danio rerio OX=7955 GN=pkd2 PE=1 SV=1)

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 330/705 (46.81%), Postives = 472/705 (66.95%), Query Frame = 2
Query:  254 SCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGT-FAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQ----------YEKSEILNKTRDVILPVVSL------------EEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILN 2299
            SC  R    +R LW TR   ++  +R++Y+KT LRE++ YI FL  L II++GM +   Y++T ++S LF  +  +    T F + +T  DFWKF  GP LNG+YW  WYNN +   +Q + +YYEN L+G+PRLRQ+RVRN+SCS+  D + E+  C+  YS ++E K  +G +N T W + + S L  + Y G V+TYGGGG+Y +L+ T+  S N +  L NNLW+DRGTRAV +DF++YN N+NLFC ++L+ EFP TGG + S QF+TV+L+RYV S D+FV  CE+ F +F++YY+VEE+LEI++ +  YF S+WN LD+L++  S+   I NI RT  V + +  L+ N + +PNFE L   Q+ F+NL AI +FL+WVK+FK+I+FNKTM QLS T+SRC+KDL GFAIMFFI+F+A+AQL YL+FG QVNDFS  Q CI+T FRIILGDFDF+++E A  + GP+YF  +VFF+F +L NMFLAII DTY EVK ++A Q++E EI D +K+     + KL LKK  I DI +++        GK+ FDE + +L+ +G+ DAEIEA+FA+YD DGD+ L E E   M+ +LE ++  LDLE            + +S+  ++  D      S             EE++ L RRVDRM+++   IV+KID V+  LE++E+ K + R+ +G IL+
Sbjct:  124 SCGKRILEKMRVLWDTRLLGESNSNREMYLKTVLREMITYILFLLTLCIITYGMVSTNMYYYTKVMSQLFLDTPLSSGEPTNFKSLSTMEDFWKFTEGPFLNGMYWELWYNNKSLPENQ-SLIYYENLLLGVPRLRQLRVRNESCSVHEDLRDEVYDCYNVYSPANEDKAPFGPKNGTAWRFKDESSLGESSYWGQVSTYGGGGYYQDLSRTREKSANQLQELKNNLWLDRGTRAVFLDFSIYNGNVNLFCIVRLLVEFPATGGAVPSWQFQTVRLLRYVSSWDYFVGMCEVSFCLFVLYYLVEEALEIRLHRLRYFKSLWNCLDVLIVALSVPAIIMNICRTSAVSHRLHFLLENHSTYPNFEPLARLQVHFNNLAAIIVFLSWVKLFKFINFNKTMNQLSTTMSRCAKDLMGFAIMFFIVFLAYAQLAYLVFGTQVNDFSTFQACIFTQFRIILGDFDFSEIEEADSVLGPIYFTTFVFFIFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLIKKSYNRAMVKLKLKKSSINDIPDSL----QQAAGKLSFDELRQDLRGKGHSDAEIEAIFAKYDLDGDQELTEHEHQQMRDDLEKEREDLDLEHSSLPRPASGRSFSRSQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKMKRRDVLGRILD 823          
BLAST of PKD2-4 vs. UniProt/SwissProt
Match: sp|Q4GZT3|PKD2_BOVIN (Polycystin-2 OS=Bos taurus OX=9913 GN=PKD2 PE=2 SV=1)

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 334/709 (47.11%), Postives = 480/709 (67.70%), Query Frame = 2
Query:  245 NPNSCW-NRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGT-FAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVIL----------------------PVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILN 2299
            +P   W  R   G+R LW TR  E++  DR+ Y+K+ LREL  Y+ FL VL I+++GM +   Y++T ++S LF  +  +    T F   ++  DFWKF  G LL+GLYW T  +N    +D  +F+YYEN L+G+PR+RQ+RVRN SCSIP D + EIK+C+  YS+SSE +  +G +N T W+YT+   L+ + + G++ATY G G+Y++L+ T+ ++   +  L  N+W+DRGTRA+ IDFTVYNANINLFC I+L+ EFP TGG++ S QF+ VKLIRYV + DFF+ ACE++F +FI+YY+VEE LEI++ K  YF S WN LD+++I+ S+     NI RT  V+ ++Q L  + N  PNFE+L +WQ QF+N+ A+ +F  W+K+FK+I+FN+TM+QLS T+SRC+KDL GFAIMFFIIF+A+AQL YL+FG QV+DFS  Q CI+T FRIILGD +FA++E A+R+ GP+YF  +VFF+FF+L NMFLAII DTY EVK +LA QK E E++D +++     L KL LKK+ + DI  ++  G     GK++FDE + +LK +G+ DAEIEA+F +YD DGD+ L E E   M+ +LE ++  LDL+       + +++    L                        VS EE++ L RRVDRM+++   IV+KID V+  LE +E+ K + RE +G +L+
Sbjct:  186 HPRVAWAERLVRGLRGLWGTRLMEESSTDREKYLKSVLRELATYLLFLIVLCILTYGMMSSSVYYYTRIMSQLFLDTPVSKMEKTNFKTLSSMEDFWKFTEGALLDGLYWKTQPSN-RTEADNRSFIYYENLLLGVPRIRQLRVRNGSCSIPLDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGMIATYSGAGYYLDLSRTREETAAQVANLKKNVWLDRGTRAIFIDFTVYNANINLFCVIRLLIEFPATGGVIPSWQFQPVKLIRYVTTFDFFLAACEIIFCLFILYYVVEEILEIRIHKLHYFRSFWNCLDVVIIVLSVVAIGINIYRTSNVEALLQFL-EDQNTFPNFENLAYWQTQFNNIAAVIVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALIKLKLKKNTVDDISESLRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEEDDDDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLD 888          
BLAST of PKD2-4 vs. UniProt/SwissProt
Match: sp|O35245|PKD2_MOUSE (Polycystin-2 OS=Mus musculus OX=10090 GN=Pkd2 PE=1 SV=2)

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 325/710 (45.77%), Postives = 475/710 (66.90%), Query Frame = 2
Query:  248 PNSCW-NRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGT-FAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVIL----------------------PVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNTL 2305
            P   W  R   G+R LW TR  E++  +R+ Y+K+ LRELV Y+FFL VL I+++GM +   Y++T  LS LF  +  +    T F   ++  DFWKF  G  L+GLYW    +N +  +D  +F++YEN L+G+PRLRQ+RVRN SCSIP D + EIK+C+  YS+SSE +  +G +N T W+YT+   L+ + + GI+A+Y G G+Y++L+ T+ ++   +  L  N W+DRGTRA  IDF+VYNANINLFC ++L+ EFP TGG++ S QF+ VKLIRYV + DFF+ ACE++F  FI+YY+VEE LEI++ +  YF S WN LD+++++ S+   + NI R    + ++Q L  + N  PNFE + +WQ+QF+N+ A+ +FL W+K+FK+I+FN+TM+QLS T+SRC+KDL GF IMF IIF+A+AQL YL+FG QV+DFS  Q CI+T FRIILGD +FA++E A+R+ GPLYF  +VFF+FF+L NMFLAII D+Y EVK +LA QK E E++D +++  +  L KL LK++ +  I  ++  G     GK++FDE + +LK +G+ DAEIEA+F +YD DGD+ L E E   M+ +LE ++  LDLE       + +++    L                        VS EE++ L RRVDRM+++   IV+KID V+  LE +E+ K + RE +G +L+ +
Sbjct:  183 PRVAWAERLVRGLRGLWGTRLMEESNANREKYLKSVLRELVTYLFFLVVLCILTYGMMSSNVYYYTRTLSQLFIDTPVSKTEKTNFKTLSSMEDFWKFTEGSFLDGLYWKAQTSN-HTQADNRSFIFYENLLLGVPRLRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWMYTSEKELNGSSHWGIIASYSGAGYYLDLSRTREETAAQLAGLRRNFWLDRGTRAAFIDFSVYNANINLFCVVRLLAEFPATGGVVPSWQFQPVKLIRYVTAFDFFLAACEIIFCFFIIYYVVEEILEIRIHRLSYFRSFWNCLDVVIVVLSVVAMVINIYRMSNAEGLLQFL-EDQNSFPNFEHVAYWQIQFNNISAVMVFLVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFTIMFSIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPLYFTTFVFFMFFILLNMFLAIINDSYSEVKSDLAQQKAEMELSDLIRKGCQKALVKLKLKRNTVDAISESLRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEREHQQMRDDLEKEREDLDLEHSSLPRPMSSRSFPRSLDDSEEEDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGV 886          
BLAST of PKD2-4 vs. UniProt/SwissProt
Match: sp|Q13563|PKD2_HUMAN (Polycystin-2 OS=Homo sapiens OX=9606 GN=PKD2 PE=1 SV=3)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 330/710 (46.48%), Postives = 479/710 (67.46%), Query Frame = 2
Query:  248 PNSCW-NRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGT-FAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVIL----------------------PVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNTL 2305
            P   W  R   G+R LW TR  E++  +R+ Y+K+ LRELV Y+ FL VL I+++GM +   Y++T ++S LF  +  +    T F   ++  DFWKF  G LL+GLYW    +N    +D  +F++YEN L+G+PR+RQ+RVRN SCSIP D + EIK+C+  YS+SSE +  +G +N T W+YT+   L+ + + GI+ATY G G+Y++L+ T+ ++   + +L  N+W+DRGTRA  IDF+VYNANINLFC ++L+ EFP TGG++ S QF+ +KLIRYV + DFF+ ACE++F  FI YY+VEE LEI++ K  YF S WN LD+++++ S+     NI RT  V+ ++Q L  + N  PNFE L +WQ+QF+N+ A+T+F  W+K+FK+I+FN+TM+QLS T+SRC+KDL GFAIMFFIIF+A+AQL YL+FG QV+DFS  Q CI+T FRIILGD +FA++E A+R+ GP+YF  +VFF+FF+L NMFLAII DTY EVK +LA QK E E++D +++     L KL LKK+ + DI  ++  G     GK++FDE + +LK +G+ DAEIEA+F +YD DGD+ L E E   M+ +LE ++  LDL+       + +++    L                        VS EE++ L RRVDRM+++   IV+KID V+  LE +E+ K + RE +G +L+ +
Sbjct:  185 PRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSN-QTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFL-EDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQG----GGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGV 888          
BLAST of PKD2-4 vs. UniProt/SwissProt
Match: sp|Q9P0L9|PK2L1_HUMAN (Polycystic kidney disease 2-like 1 protein OS=Homo sapiens OX=9606 GN=PKD2L1 PE=1 SV=1)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 323/695 (46.47%), Postives = 464/695 (66.76%), Query Frame = 2
Query:  206 KSTKDSIEETNF-INPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEI---EAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPV-------VSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEK 2257
            K  +D  +ET +    +SC      GIR LW T  TE+T  +R+LYIKTTLREL++YI FL  + ++++GMT+  AY++T ++S LF  +  +D   +F A ++ +DFW F  GPLL+ LYWT WYNN +      +F+YYEN L+G+PRLRQ++VRNDSC +  DF+ +I  C+  YS   E +  +G  N T W Y +   L    + G + +Y GGG+Y++L  ++  S   +  L   LW+DRGTR V IDF+VYNANINLFC ++LV EFP TGG + S Q RTVKLIRYV + DFF++ CE++F VFI YY+VEE LE+ + +  Y  SIWNILD++VI+ S+    F+I RTL V  ++  L+   N + +FE L FWQ Q++N+ A+ LF AW+K+FKYISFNKTMTQLS+TL+RC+KD+ GFA+MFFI+F A+AQLGYL+FG QV +FS    CI+T FRIILGDFD+  ++ A+RI GP YFV YVFFVFFVL NMFLAII DTY EVKEELA QK+E +++D +K+     L +L L+K+++ D+Q  +  G+     ++ F+++   L+  G+ + EI    A F ++D DG++ LDE EQ  M+++LE+++ +L+ EI+     I++  +    P        VS EE+  L RRV +++     +V++ID V   L+ +E+
Sbjct:   51 KKPEDEPQETAYRTQVSSCCLHICQGIRGLWGTTLTENTAENRELYIKTTLRELLVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTP-SDTGVSFQAISSMADFWDFAQGPLLDSLYWTKWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNGTAWTYHSQDELGGFSHWGRLTSYSGGGYYLDLPGSRQGSAEALRALQEGLWLDRGTRVVFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDFFIVGCEVIFCVFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKERVSDVQKVLQGGEQ----EIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQEKMRQDLEEERVALNTEIEKLGRSIVSSPQGKSGPEAARAGGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLER 740          
BLAST of PKD2-4 vs. TrEMBL
Match: A0A0H3YFG1 (PKD2-4 OS=Schmidtea mediterranea OX=79327 GN=PKD2-4 PE=2 SV=1)

HSP 1 Score: 1451.03 bits (3755), Expect = 0.000e+0
Identity = 789/789 (100.00%), Postives = 789/789 (100.00%), Query Frame = 2
Query:   74 MQMTLGFYFKNDLLDFVFKVMHSNGDYGTRELPSAMSDDSYEYGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHKLNQNSVSTFQRH 2440
            MQMTLGFYFKNDLLDFVFKVMHSNGDYGTRELPSAMSDDSYEYGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLAGFAIMFFIIFIAFAQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPLYFVFYVFFVFFVLFNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLKKDKIIDIQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNTLNSNDDNEDYDIDDDNDEIKKKKIKELIANEIHKLNQNSVSTFQRH
Sbjct:    1 MQMTLGFYFKNDLLDFVFKVMHSNGDYGTRELPSAMSDDSYEYGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLAGFAIMFFIIFIAFAQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPLYFVFYVFFVFFVLFNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLKKDKIIDIQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNTLNSNDDNEDYDIDDDNDEIKKKKIKELIANEIHKLNQNSVSTFQRH 789          
BLAST of PKD2-4 vs. TrEMBL
Match: A0A0H3YFR3 (PKD2L-2 OS=Schmidtea mediterranea OX=79327 GN=PKD2L-2 PE=2 SV=1)

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 396/713 (55.54%), Postives = 534/713 (74.89%), Query Frame = 2
Query:  170 PSAMSDDSYEYGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEK--SEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNT 2302
            P AM  + ++ GK T    +E  F N N CWN+FK GIRSLWAT+HTE+   D+ LY  TT+RELV+Y+ FL +L II+F M     ++FTN L+ LF T+ FNDNSGTF++   +SDFWKFL GPLLNGLYW  WYN+ N  +++ N++Y+EN+L+G+PR+RQ+RV+N+SC IP+  Q ++ QC+AAYS + E K+S+G QNS+ W YT  S+L +  +QG + TYGGGGFYV+L ++Q +S N I++LFNN W+DR TRAV++DFT+YNANINLFC IKLVGEFPP GG+L S +FRTVKLIRYV  +DFFVLACE+LFV++++YYI+EE +EI   K  YF S+WN+LD++V+   + C  F+I R   +Q ++  L+ N NIHPNFE L+FWQLQ+DNL A  LFLA  K+FKYISFNK MTQL +TL+ C KDL GF++MFFI+F+AFAQ GYLIFG+Q+ ++ +   CI+TLFRIIL D +F +L   + I GPLYF+ YVFFVFF+LFNMFLAI+ D YG++KEEL  ++NEFEI D++KE++  V  KLHLK++KI+D++NA+   DTNNDG MDFDEWK ELK RGY + EIE++FA++DTDGD+ LDE EQ+ M KEL DQK +L+ E+  E+   E L ++ D I P +S  +Y  L+R +D ++N   I+  K D +L+  ++I K K +SRE+  IILN 
Sbjct:   33 PCAMDGEYFDNGKITIIDYQEIGFKNEN-CWNKFKIGIRSLWATKHTENCDEDKNLYANTTVRELVVYMLFLVLLFIITFSMRPGYMFYFTNFLNNLFLTTQFNDNSGTFSSLQAQSDFWKFLMGPLLNGLYWNVWYNSRNMPANEQNYIYFENKLLGVPRIRQIRVKNNSCIIPNILQNKVNQCYAAYSRNIELKESFGFQNSSAWNYTEDSILQSGSFQGQITTYGGGGFYVDLATSQENSLNIILSLFNNRWLDRNTRAVLVDFTIYNANINLFCIIKLVGEFPPVGGVLPSYEFRTVKLIRYVNPLDFFVLACEILFVLYLLYYIIEELIEIDKHKSAYFCSLWNVLDVIVLSLGVICVSFHIYRMYMIQTMLSKLLENGNIHPNFEYLSFWQLQYDNLSAFLLFLAITKIFKYISFNKMMTQLISTLNYCLKDLVGFSLMFFIVFLAFAQAGYLIFGSQLANYREFYICIFTLFRIILNDCNFKELLPLNPILGPLYFILYVFFVFFILFNMFLAILDDAYGDIKEELEEKENEFEITDFLKEKSRKVFEKLHLKREKIVDLENAMKTVDTNNDGVMDFDEWKTELKRRGYAETEIESLFAKFDTDGDRVLDEQEQLKMLKELNDQKTALETELIEERDNQEKLIES-DAIQP-ISYGKYMGLSRHIDDLENIIEILTQKFDIILDNFQNIIKTKEKSRESTEIILNA 742          
BLAST of PKD2-4 vs. TrEMBL
Match: A0A0H3YJL0 (PKD2L-1 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=PKD2L-1 PE=2 SV=1)

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 414/729 (56.79%), Postives = 539/729 (73.94%), Query Frame = 2
Query:  128 KVMHSNGDYGTRELPSAMSDDSYEYGKSTKDSIEETNFINP--NSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILN-KTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNTL 2305
            K+  + G + T ++ + +  D+Y+   S  DS+   N  N      WNRF NG+RS+WAT+ TED K +R LYI+TTLREL IYI FLA+L+II+FGMTT   YW TNLL+ LF     N N+G+F +  + +DFW F  GPLLNGLYW +WYNN+N    +INF+Y+EN+LIGL RLRQVRV + SC I ++FQ  IK+C+  YS   ES + +G QNST W YT  + L +   QG ++TYGGGG+YV+L S Q  +++ +  LFNNLWIDRGTRAVI+DFTVYNANINLFC IKL+ EFP  GG++    F+TVKL+RYV   DFFVL CEL+++VFI+YY VEE +EIK+ K  YF S+WNILD++VI  S  C IFNI RT+ VQ I+++L+ NDN HPNF+ L+++Q  F+ L+AIT+FLAWVK+FKYISFNKTMTQLS+TL RCSKDLAGFA+MFFIIF AFAQLGYL+FG ++  F +L Y I+TL+RIILGDF F     A  IFGPLYF+ YVFFV FVLFNMFLAII DTY E+K EL NQKNEFEI DY KERT+++LAKL+LKKDK+  +QNA+   DTNNDG MDFDEWK  ++ +G+   EIE+VF+RYDTDG++ LD  EQI MQ +LE+QK +++ EI  E+SEI N +++   +  VS++EY+ LN R++ M+N    +V KI+ VL+ LE+++  K + R++M  IL  L
Sbjct:    1 KIKMAKG-WSTEDMKANVEYDAYD-EISHADSVSLDNDKNKVKYGFWNRFSNGMRSIWATKQTEDIKANRNLYIQTTLRELFIYIVFLAILMIIAFGMTTGTMYWLTNLLNNLFVNGQVN-NTGSFNSMASSADFWTFAQGPLLNGLYWNSWYNNLNVDQSEINFIYFENKLIGLARLRQVRVSDKSCIIANEFQKIIKRCYVTYSTQIESTEPFGLQNSTAWTYTRQTNLGSLPIQGSISTYGGGGYYVDLPSDQFSAFSLLNNLFNNLWIDRGTRAVIVDFTVYNANINLFCVIKLIAEFPAVGGVIPLYDFKTVKLLRYVSPSDFFVLGCELIYLVFIIYYTVEEIIEIKIHKISYFKSVWNILDVVVIGISFICIIFNIYRTVAVQTILESLLMNDNQHPNFDYLSYYQFTFNYLLAITVFLAWVKIFKYISFNKTMTQLSSTLGRCSKDLAGFAVMFFIIFFAFAQLGYLLFGTKLTGFRELHYSIFTLYRIILGDFTFQDFLNADIIFGPLYFLLYVFFVLFVLFNMFLAIINDTYSEIKNELINQKNEFEIGDYFKERTQMMLAKLNLKKDKLDVLQNALTNADTNNDGLMDFDEWKTAMQEKGFESHEIESVFSRYDTDGNRVLDANEQIEMQNQLENQKTAVNREIISEQSEIPNSESKKTFIHGVSIDEYQDLNFRIEEMENVINTLVLKINDVLKDLENMDNSKNKRRKSMRKILTIL 726          
BLAST of PKD2-4 vs. TrEMBL
Match: A0A077L755 (Transient receptor potential ion channel P a (Fragment) OS=Dugesia japonica OX=6161 GN=DjTRPPa PE=2 SV=1)

HSP 1 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 396/665 (59.55%), Postives = 510/665 (76.69%), Query Frame = 2
Query:  320 KVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILN---KTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNTL 2305
            K +R LYI+TTLREL++YI FLA+L+II+FGMTT   YW+TNLLS LF   N N+N+ TF   + ++DFW F TG LLNGLYW TWYNN+N    +INF++YEN+LIGLPR+RQVR++N++C IP +F+  + QC+A+Y MS ES DS+G QNST W YT+ SVL +  +QG ++TY GGGFY++L   Q  +   +  L+ NLWIDRGTRAVIIDFTVYNANINLFC IKLV EFP  GG++ +  FRT+KLIRYVG  D+F+L CEL +++F++YY +EE +EIK+ K  YF S+WN LD++VI  S  C IFNI RT+ VQ I+  L+ N N HPNF++L++ Q  F+ L+A+T+FLAWVK+FKYISFNKTMTQLS TL RCSKDLAGFA+MFFIIF AFAQLGYL+FGAQ+  F +L Y I+TL+RIILGDF F+  +  H I GPLYF+ YVFFVFFVLFNMFLAII DTY EVK ELAN KNEFEI DY KERT  +L KL+LKK+KI DIQNA+   DTNNDG MDF+EWK  +K RG+ ++EIE VF++YDTDG++ LD+ EQI MQ++LE+ K  ++ EI  E++E+ +     +  ++  VS++EY  LN RV+ M+NN   +V+KID VL  LE+++K KA+ R+ MG ILNTL
Sbjct:   21 KGNRDLYIQTTLRELILYIIFLAILMIIAFGMTTGTMYWYTNLLSNLFLNGNGNNNTNTFLTMSADADFWNFATGALLNGLYWNTWYNNLNLDPSEINFIFYENKLIGLPRMRQVRMKNNTCIIPLEFKNIVNQCYASYKMSDESTDSFGLQNSTAWNYTSGSVLGSYPFQGTISTYSGGGFYIDLPIDQPTALGVLNFLYTNLWIDRGTRAVIIDFTVYNANINLFCVIKLVAEFPAVGGVIPTYDFRTIKLIRYVGPFDYFILGCELAYLIFLIYYTIEELIEIKINKMSYFHSVWNCLDVIVISISFVCVIFNIYRTIAVQTILGDLLMNSNQHPNFDNLSYNQTTFNYLLAVTVFLAWVKIFKYISFNKTMTQLSTTLGRCSKDLAGFAVMFFIIFFAFAQLGYLLFGAQLQSFRELHYSIFTLYRIILGDFTFSDFQTVHIILGPLYFILYVFFVFFVLFNMFLAIINDTYSEVKNELANVKNEFEIGDYFKERTIKMLEKLNLKKEKIADIQNAITNADTNNDGLMDFEEWKAAMKVRGFEESEIENVFSKYDTDGNRVLDQTEQIEMQRQLENLKAEVNNEIMVEQAELTDCDLGLKKGVIRGVSIDEYNILNSRVEEMENNIISMVSKIDMVLRNLENMDKAKAKRRKAMGKILNTL 685          
BLAST of PKD2-4 vs. TrEMBL
Match: A0A267F133 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004710g1 PE=4 SV=1)

HSP 1 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 403/741 (54.39%), Postives = 526/741 (70.99%), Query Frame = 2
Query:  161 RELPSAMSDDSYEYGKS-TKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFT-SDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPV------------------------VSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNTL 2305
            +E  +  SD+ +E+    T+  +EE +      CW RFK G+R++W T  TEDT+ DR+LYIKTTLREL++Y+FFL VL++++FGMT+   Y+FT+++   F  +  ++   TF+ +TT +D+W+F+ GPLL GLY T WYNN+NF+ S ++NF+YYEN+L+G+PRLRQV+VRNDSCSI  DF+ EIK C+A YS   E K  +G  NST W +T    LD   Y G +A+Y GGG+YV+L   + DS   I  LF  LWIDRGTR   +DFTVYNANINLFC +KLV EFP TGG + SS++RTVKL+RYV   D+ VL CE++F++FI YY+VEE +EIK  K  YF S WN LDILVII SL C+ FN+ RT+ V N +  L+ +++  P+F+ L++WQLQF+N IAIT+F AWVK+FKYISFNKTMTQLS+TL  C+KDL GFA+MFFIIF AFAQLGYLIFG QV DF + Q  I+TLFRIILGDFDF +LE AHR+ GP++F+ YVFFVFFVL NMFLAII DTY EVK +LANQ N+FE+ DY KER   V+ KL++K+DKIIDIQ A+ + D NND ++DF+EW+ ELK RGY D EIEA+FA+YD DGD+ LDE EQ  M  ELE QK +L+ +IQ E+    +      L                          VS EE+  L RRVDRM+++   IV+KID VL  L+++EK K R RETM  +L+++
Sbjct:   50 QEPEACQSDNPFEHPDGQTEPEVEEAH-----GCWFRFKRGVRAIWRTNMTEDTREDRELYIKTTLRELIVYLFFLIVLMVLAFGMTSSTMYYFTSVMQAQFDQAPNSETQTTFSTATTIADWWRFVKGPLLEGLYVTNWYNNLNFSDSREVNFVYYENKLLGVPRLRQVKVRNDSCSIADDFKNEIKACYAMYSPGVEEKSPFGYMNSTAWNHTTEKELDGRSYAGQIASYDGGGYYVDLTRNRDDSAAIIEELFKGLWIDRGTRVAFVDFTVYNANINLFCVVKLVMEFPATGGAIPSSEYRTVKLLRYVEPRDYVVLICEIIFMLFICYYVVEEVIEIKRHKLGYFKSFWNWLDILVIIISLVCAGFNVYRTIAVGNKLTELLKDESKFPDFDFLSYWQLQFNNAIAITVFFAWVKIFKYISFNKTMTQLSSTLGACAKDLVGFAVMFFIIFFAFAQLGYLIFGTQVKDFREFQQAIFTLFRIILGDFDFHELENAHRVLGPIFFLLYVFFVFFVLINMFLAIINDTYSEVKSDLANQPNDFEMTDYFKERAGKVMDKLNIKRDKIIDIQKAMQSADVNNDRQLDFEEWRAELKMRGYADGEIEAMFAKYDVDGDRVLDEEEQRRMTSELEGQKAALNDQIQSERDRPASARSTADLGADADDRLRSSRRGVSGGGGGGGGAGVSSEEFTVLARRVDRMEHSIGSIVSKIDAVLVKLDTMEKAKLRRRETMSKLLDSI 785          
BLAST of PKD2-4 vs. Ensembl Cavefish
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:103043751])

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 323/702 (46.01%), Postives = 472/702 (67.24%), Query Frame = 2
Query:  263 NRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFND-NSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKT----------------------RDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILN 2299
             R    +R LW TR  ED++  R++Y+K  LRE V YIFFL  L II++GM +   Y++T ++S LF  +  +  +  TF   +T  DFWK+  GP LNG+YW  WYNN +   +Q + +YYEN L+G+PRLRQV+V N SC +  D + E+  C++ YS +SE K  +G +N+T WVY+  ++L  + Y G VATY GGG+Y +L  ++ +S   +  L +NLW+DRGTRAV +DF+VYN N+NLFC ++++ EFP TGG + S QF+TV+L+RYV S D+FV  CE++F +F++YY+VEE LEI++ +  YF S+WN LD++++  S    I NI RT  V N ++ L+ N + +PNF+ L   Q+QF++L A+ +FLAWVK+FK+I+FNKTM+QLS T+SRC+KDL GFAIMFFI+F+A+AQL YL+FG Q+NDFS  Q CI+T FRIILGDFDF+++E  +R+ GP+YF  +VFF+F +L NMFLAII DTY EVK ++A Q++E EI D +K+  +  + KL L+K  + DI +++        GK++FDE + +L+ +G+ DAEIEA+FA+YD DGD+ L E E   M+ +LE ++  LDLE       +  ++                      R      VS EE++ L RRVDRM+++   IV+KID V+  LE++E+ K + RE +G +L+
Sbjct:  130 KRILAKLRILWGTRLMEDSESSREVYLKNVLRETVTYIFFLITLCIITYGMVSTNMYFYTKVMSQLFLDTPLSKGDPTTFKTLSTMEDFWKYTEGPFLNGMYWDVWYNNKSLPENQ-SLIYYENLLLGVPRLRQVKVLNKSCPVHEDLKDEVYDCYSIYSPASEDKAPFGLKNNTAWVYSEENILGESSYWGEVATYRGGGYYQDLARSREESARQLKELKDNLWLDRGTRAVFLDFSVYNGNVNLFCIVRMLVEFPATGGAVTSWQFQTVRLVRYVSSWDYFVGTCEVVFCLFVLYYMVEEVLEIRLHRLRYFKSLWNCLDVIIVTLSAPAIIMNIYRTSAVSNRLRYLLENHSTYPNFQPLAQVQVQFNHLAAVIVFLAWVKLFKFINFNKTMSQLSTTMSRCAKDLLGFAIMFFIVFLAYAQLAYLVFGNQLNDFSTFQACIFTQFRIILGDFDFSEIEETNRVLGPIYFTTFVFFMFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLIKKGYQKAMVKLRLRKTTVDDISDSL----RQAGGKLNFDELRQDLRGKGHSDAEIEAIFAKYDLDGDQELSEHEHQQMKDDLEKEREDLDLERSSLPRPMSGRSFSRSQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLD 826          
BLAST of PKD2-4 vs. Ensembl Cavefish
Match: pkd2l1 (polycystic kidney disease 2-like 1 protein [Source:NCBI gene;Acc:103031316])

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 320/688 (46.51%), Postives = 470/688 (68.31%), Query Frame = 2
Query:  251 NSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLE-----IQYEK----SEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMG 2287
            + C +    GI+ LW T  T+DT  +R+L+++TTLRELV+YI FL  + ++++GMT+   Y++T +++ LF  +  +D+  TF +  T  DFW +  GPLL+GLYWT+WYNN +  +   +F+YYEN L+G+PR+RQ++V+N SC +  DF+ EI  CF  Y+   E   S+G  N T W Y     L  + + G++ATY GGG+Y +L  T+ +S   +  L NNLW+D GTRAV IDF+ YNANINLFC I+LV EFP TGG + S Q RTVKLIRY+ + D+F++ CE++F VFI+YYIVEE LE+++ K  YF SIWNILD+++I+ ++   +FN+ RT+ V  ++  L+   +I+ +FE L FWQ Q++N+ A+ LF AW+K+FKYISFNKTMTQLS+TL+RC+ D+ GFAIMFFI+F A+AQLGYL+FG +V  FS    CI+T FRIILGDFD+  +E A+R+ GP+YF  YVFFVFFVL NMFLAII DTY EVKEELA+QK++ +I D +K+       KL LKK+KI D+Q  + +G      +++F +++  LK  G+ D EI A F+++D DG++ LD+ EQ  M++ELE+++++L +E     I YEK    ++   KT  V+   V+ ++++ L ++V  ++ +    + KID V+E L   +  K   ++  G
Sbjct:   86 SGCCSFLLRGIKGLWGTTLTKDTTENRELFVRTTLRELVVYIVFLVDMCLLTYGMTSSTTYYYTKVMTDLFVNAP-SDSGVTFQSIGTMDDFWSYAQGPLLDGLYWTSWYNNQSLQTGTHSFIYYENMLLGVPRVRQLKVKNKSCKVHKDFEEEISDCFDVYNEKKEDDSSFGLINGTAWQYHTEKELKGSNHWGMLATYSGGGYYQDLALTKEESAGVLANLNNNLWLDHGTRAVFIDFSTYNANINLFCVIRLVVEFPATGGAIPSYQIRTVKLIRYITTWDYFIIGCEIVFCVFILYYIVEEILELRIHKLSYFKSIWNILDVVIIMLAIVAIVFNVFRTIKVDKLLGNLLKEPSIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCATDILGFAIMFFIVFFAYAQLGYLLFGTEVESFSTFHKCIFTQFRIILGDFDYDGIERANRVLGPIYFFTYVFFVFFVLLNMFLAIINDTYSEVKEELASQKDDLQITDLIKQSYSKTFMKLKLKKEKISDVQKVLRSGSK----ELEFKDFRETLKEMGHADHEISAAFSKFDYDGNQILDKEEQETMKQELEEKRDALSVELHNLGINYEKNGKETDDNEKTNSVL---VTAQQFQMLVKQVVELECSLATTMAKIDVVMEKLGLQDAGKTNKKDATG 765          
BLAST of PKD2-4 vs. Ensembl Cavefish
Match: pkd1l2a (polycystin 1 like 2 [Source:NCBI gene;Acc:103044173])

HSP 1 Score: 199.134 bits (505), Expect = 5.578e-52
Identity = 143/493 (29.01%), Postives = 252/493 (51.12%), Query Frame = 2
Query:  353 LRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYEN-RLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYG------------QQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFE 1792
            +RE++IY+ FL +L+++++G     A++ T  +   F        S   + S T  + +++    LLN L+             Q  F+   N +L+G  RLRQVRV++ SC +    +  +  C A YS   E   SYG            +   TPW Y   S L      G VA Y GGGF V+L   + ++ +++  LF N W+D  TRA+ ++FTVYNAN+NLFC + L+ E    G     S+ ++V+L +  G +  FV+A E+++ +FI YY+ ++   +K  K+EYF S WN+LD+ +II S +     I RTL     I+    + + +  F            +IA  + LA VK++  +  N  +  +++TL R   D++GF ++  I+F+A++    L++G ++  +  L     T+  + LG F++ ++   + + G       + F+ FV+ N+F+++I   + E  E++ ++ +E E
Sbjct: 2090 IREILIYMGFLWMLLLVAYGQRDPNAFYLTQHIQQSF--------SNGISDSMTHGEVFQWANSTLLNNLF-----------GQQPGFITDGNSKLVGNARLRQVRVQDGSCRVDRSMRNSVPDCHAPYSWDMEDLGSYGPGWNPSIDANLSKTLPTPWQYQTQSRLRAHPIWGGVAVYRGGGFVVDLGPNRENASSSLQYLFENTWLDMFTRAIFVEFTVYNANVNLFCIVTLMFETTAVGAFQYRSELQSVRLYQSTGGLHIFVMASEVVYFLFIFYYMFQQGKLMKQQKWEYFRSKWNLLDMAIIILSWSALPVFIKRTLLGNQSIEYYQNHKDEYAGFNETATADAVLGYIIAFLVLLATVKLWHLLRLNPKLHMITSTLQRAWNDISGFIVVMTIMFLAYSVACNLLYGWKLYSYRTLLNAAQTIVSLQLGIFNYEEVLDYNPVLGAFIVGSCIIFMTFVVLNLFISVILVAFSE--EQIHHKPSEEE 2561          
BLAST of PKD2-4 vs. Ensembl Cavefish
Match: ENSAMXT00000006495.2 (pep primary_assembly:Astyanax_mexicanus-2.0:5:35007331:35041448:1 gene:ENSAMXG00000006274.2 transcript:ENSAMXT00000006495.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.155 bits (409), Expect = 2.483e-40
Identity = 136/527 (25.81%), Postives = 250/527 (47.44%), Query Frame = 2
Query:  272 KNGIRSLWATRHTEDTKVDRQLYIK-----TTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNS------------TPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIAD 1801
            +N   S +      D    ++++IK       + E++IY+ F  +L++ ++      A++ T  +   F        S   + S ++ D + +    LL  L+    Y+   F +D        ++L+G  RLRQVRV+  SC   S  +  +  C A YS   E   SYG   +            TPW Y   S L      G +A Y GGGF V+L   Q +S + +  LF N W+D  TRA+ I+FTVYNAN+NLFC + L+ E    G     ++ + ++L +    I    L  E ++ +FI+YY+  ++  +K  K+EYF + WNIL++ +I+ S +     I + +     ++    + N  P+F            L A+ + LA +K++  +  N  +  ++ TL +   D++ F ++  I+F+A++ +  L+FG ++  +  L      +  + LG F++ ++   + + G       + F+ FV+ N+F+++I + + + +      + E EI D
Sbjct: 1177 RNSSCSFYQPPPPSDVGKMKEIWIKDQKAFALIWEILIYLGFFCMLLMAAYSQRDPNAFFLTRHIQQSF--------SNGISDSMSQQDVFIWANSSLLTNLFGQ--YSG--FITDG------NSKLVGTARLRQVRVQKSSCRKASSVRSSVPDCHAPYSWEVEDMGSYGPGWTSLIDSNMSKALFTPWQYQTQSRLRAHTVWGGMALYRGGGFVVDLEPDQQNSSSVLQYLFENAWLDIYTRALFIEFTVYNANVNLFCIVTLMLETTAVGAFQYRTELQNIRLFQTTDGIP--TLVSEAIYFLFILYYMFLQAKLMKQQKWEYFRNKWNILELAIILLSWSAFSVFIKKMVQGDQDLKYYQDHRNQFPSFYETAAADSVLGYLTAVLVLLATIKMWHLMRLNSKLNMITNTLQQAWSDISSFIVVIVIMFLAYSIVSNLLFGWKLYTYKTLIDAATAMVSLQLGIFNYEEILDLNPVLGAFIIGSCIIFMTFVVLNLFISVILEAFSQEQRHHKPSEEE-EIVD 1682          
BLAST of PKD2-4 vs. Ensembl Cavefish
Match: pkd1a (polycystic kidney disease 1a [Source:ZFIN;Acc:ZDB-GENE-100707-1])

HSP 1 Score: 63.929 bits (154), Expect = 7.321e-10
Identity = 59/250 (23.60%), Postives = 110/250 (44.00%), Query Frame = 2
Query:  857 GGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQY-CIYTL 1603
            GGF   L+    DS + I  L ++ W    TRA+ ++F++YN N +L     L+ EFP +     S   +T  L   +       L   LL ++FI+Y+ V E +        YF  +WN+  +  ++ +   S  ++ R+     +  + +       +F  L         L A  LFL  +K    + F +       TL R   +L   A+   ++ +A++ +G+L+F + +  ++ +   C+Y L
Sbjct: 3727 GGFVQELSRRMEDSRSLIQQLLSHQW----TRALFVEFSLYNTNTDLLAVFTLLLEFPVSERAQSSLDLKTCSL-HTLHHGLDLSLFLTLLLMIFIIYFSVREGVAAHRQGRSYFLRVWNLAGMCTLLLAAVVSALHLSRSALATRLWASFLQQRESFTDFFPLAQQNQVLTQLNATLLFLLVLKASHQLRFLREWAVFGRTLRRSVWELLAAALALLVLLLAYSHMGHLLFHSVLEGYATVSSACLYLL 3971          
BLAST of PKD2-4 vs. Ensembl Sea Lamprey
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 325/731 (44.46%), Postives = 465/731 (63.61%), Query Frame = 2
Query:  146 GDYGT-RELPSAMSDDSYE-YGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDN-SGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXX--XXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILN----KTRDVILPVVS------------------LEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEK 2257
            GDY   + LP +  D S   Y +  +D   +             K+ +R LW TR TED   DR  Y+KTTLREL +YI FL  L+I++FGMT+   Y +T  +  LF  +  + N S  F +  T  DFWK + GP+LNGLYW  WYN+I    +Q +F+YYEN L+G+PR+RQ++VRNDSC++ +DFQ +++ C+AAYS  +E K S+G    TPW Y+ SS ++ + + G++ATY GGG+Y++L  ++ +S   +  LF+  W+DRGTRA++IDF+ YN NINLF  I+L+ EFPPTGG + SSQ  TVKLIRYV   D+F+LACE +F  FI+YYIVEE LE+ + KF YF S+WN LD+LVI+ S+   IFN+ RT+TV  +++ L+   N + NF+ L FWQ Q++N++A+ +F  W+K FKY+SFNKTMTQLS+TL+RC+KD+ GFA+MFFIIF A+AQLGYL+FG QV DFS    CI+T FRIILGDFDF  +E A+R+ GPLYF  YVF V    +  NMFLAII DTY EVK ELA ++NEF++  Y K+    +  KL   +  I+D+ + + A       K+++D+W+++LK  G+ D EIEA FA++D D +  LD  E   M+ EL+ QK    ++       +LN    +  D     ++                     Y+ L + VD ++ +   + +K+D ++  + S+ K
Sbjct:   47 GDYPKGKPLPGSYVDSSSAVYEEIPEDGPHKAEEDQSGGPKKSRKSVLRGLWGTRLTEDI-TDRDKYVKTTLRELFVYIAFLINLIILTFGMTSDLMYKYTLAMDNLFLQNTVSPNDSVNFNSIFTFDDFWKVVQGPVLNGLYWEKWYNDIPLVENQ-SFIYYENFLLGVPRIRQLKVRNDSCTVHADFQKDVQGCYAAYSEDAEDKASFGPATGTPWKYSTSSDMNGSSHWGLLATYSGGGYYLDLTRSKSESAILLQDLFDKQWLDRGTRAILIDFSSYNGNINLFSVIRLLVEFPPTGGAVPSSQIYTVKLIRYVTGSDYFILACEGIFCCFILYYIVEEILELSIHKFAYFKSVWNCLDLLVIMLSVVAIIFNVYRTVTVNKLLKALLDEPNRYGNFQFLAFWQTQYNNMVAVNVFFCWIKFFKYVSFNKTMTQLSSTLARCAKDVLGFAVMFFIIFFAYAQLGYLLFGTQVEDFSTFSNCIFTQFRIILGDFDFNAIENANRVLGPLYFTTYVFVVFFVLLPKNMFLAIINDTYAEVKNELAEKENEFDVGGYFKKVYLDIRKKLGKNRGNIVDMISVLDASSQ----KINYDDWRLKLKRLGHSDEEIEAAFAKFDKDKNSVLDSNEMKLMRDELKSQKKDGSMDRVLSPCVLLNYVIFRNLDCSAKCINNLSGEINHRRYADDISTLYNVYKRLVQNVDNLEQSISTMFSKVDVIMNKVGSLAK 771          
BLAST of PKD2-4 vs. Ensembl Sea Lamprey
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 309/655 (47.18%), Postives = 447/655 (68.24%), Query Frame = 2
Query:  287 SLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGT-FAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGK-MDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALE 2245
              W TR TE     R+ Y KTTLREL+IY+ FL  L +++FGM     Y++T ++  LF  S  +   GT F + ++  DFWK + GP+L+GLYW  WYN      + ++F+ YEN ++G+PR+RQ++VRN SC+I   F+  I  C+  YS   E K+++G+   T W Y +   L  + + G++A Y G G+Y +L+  + +S   +  L + LW+D GTRAV IDFT YN NINLFC ++LV EFP TGG L S QFRTVKLIRYV + D+F++ACE++F  FI+YY+VEE LE+++   +YF S+WN LDI+VI+ S+   IFNI RT+ V N++  L+ + NI+ +FE L FWQ QF+N++AI +F AW+K+FKY+SFNKT+TQLS+TL+RC+KD+ GFA+MFFIIF A+AQ GYL+FG+QV DFS    CI+T FRIILGDFDF  +E A+RI GP+YF  Y+FFVFFVL NMFLAII DTY +VK ELA+ K++FEI D+ K+  + +L KL +KKD I D+Q A+     ++ GK +++D W+  L   G+ D EI A F+++D D D  LDE EQ  ++ ELE QK+ L+ +I+  K+ + N  +      V+ +++     RV +M+++   +++K++++L  LE
Sbjct:   10 GFWGTRLTE-VNSTREQYFKTTLRELIIYVVFLIDLCLLTFGMMNTNTYYYTKVMMDLFVESPVSPIDGTNFNSISSMDDFWKVVQGPVLDGLYWEKWYNGDQLPVN-LSFIQYENVMLGVPRVRQLKVRNGSCTIYPLFRNIIPGCYDGYSCGEEDKETFGRGTGTAWKYWSEEELSGSSHWGLLAQYSGAGYYRDLSRRKNESAPMLQELKDYLWLDHGTRAVFIDFTTYNGNINLFCVVRLVVEFPLTGGALPSYQFRTVKLIRYVSAFDYFIMACEVIFCCFILYYVVEECLELRLHGMKYFKSVWNCLDIIVIVLSMVAIIFNICRTIAVSNLLGALLNDPNIYADFEYLAFWQTQFNNMLAINVFFAWIKIFKYVSFNKTLTQLSSTLARCAKDVLGFAVMFFIIFFAYAQTGYLVFGSQVEDFSSFVNCIFTQFRIILGDFDFHAIENANRILGPIYFTTYIFFVFFVLLNMFLAIINDTYTDVKAELADTKDDFEIGDFFKQGYKNMLNKLKMKKDDIADMQRAL-----DSAGKHLEYDIWRKNLIRLGHSDEEIAAAFSKFDKDSDNVLDEDEQKQLRAELEGQKDKLNEDIEALKT-MDNSGKPGDASRVTKDDFNRFASRVAKMESSMDSLMSKVESLLTKLE 656          
BLAST of PKD2-4 vs. Ensembl Sea Lamprey
Match: pkd2 (polycystic kidney disease 2 [Source:NCBI gene;Acc:432387])

HSP 1 Score: 343.584 bits (880), Expect = 1.318e-106
Identity = 231/712 (32.44%), Postives = 389/712 (54.63%), Query Frame = 2
Query:  290 LWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNF-NDNSGTFAASTTESDFWK----FLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSC-SIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNS-TQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLA-CELLFVVFIVYYIVEESLEIKMLKFEYFFS-IWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIH-PNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTR------------------------------DVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNTL 2305
            LWATR TE   ++R+ Y+K  +RE V +  FLA+L ++++      AY +T+ +S +FT+S   N +  TF    T    W+    +LTGPLL  L+ +    + N T+  ++    EN ++    + Q RV N+SC S+ ++      +C+  YS ++E+KD +G  NST W + + +      +QG +  YG GG+ V L + ++  ++  +  L +  W+DR TR + +D  + N N+ L+  ++L  EFPPTGG+L +    ++   R +G+  +   A C LL  +  +YY+VEE LE++ L    F S  W  LDI +I   +  + F +   +   +++    ++  +      ++  W+  F  +  + +F+AW+KV ++ S  +T+T     L+RC+ DL G+ ++F  +F+AFAQL +LIFG  + DFS    CI T  RI+LGDFDF+ LE A RI GP+YFV YVF V  ++  MFLAI+++ Y E K E A+ + +F+++  +K+    V+ +L  KK ++  IQ  +        G+++F  W+  LK +G+ DAEIEAVFARY  DGD AL  AEQ+ M+++L  +K ++ L I     E   K +                                    VS EE+R L RRV++M+++   +V+K+D V+  LE++E+ + R R+ +  +++ +
Sbjct:    2 LWATRWTESPVLNRERYVKLAIREAVTFSVFLALLCVVAYSSRIPLAYEYTHAVSEMFTSSPLSNADPTTFHNLATIEQVWQVFHGYLTGPLLWALHNS---GSRNLTNSMVS---GENLVVEPVIIWQARVHNNSCWSLSTNLGTGTTECYGPYSSANENKDPFGPANSTVWRFDSEA---GVPWQGALGWYGPGGYAVRLPADSRTAAWQELAALRDASWLDRATRLLSVDAALLNPNLRLYMVVRLSMEFPPTGGILTA---LSLTPGRPLGTPLWDARAVCGLLAALLTIYYLVEEVLELRNLGPAGFLSSPWTFLDISIIALCVVGTAFGVHHGILSSSLLGEASSSRAMSFSTVSTVAEWEQNFIIVTGVIVFVAWIKVVRFGSMCRTLTMCGCALTRCAWDLLGYTLVFATVFLAFAQLAFLIFGGALPDFSSFSSCILTQVRILLGDFDFSSLEAASRIMGPIYFVSYVFCVGLIMMVMFLAIVSEAYSEEKSEQAHSQPQFQLSSVIKQVK--VVDRLSCKKPRVAGIQKTL-----PPSGQINFATWRQNLKGQGFADAEIEAVFARY--DGDGALTRAEQLQMRRDLRLEKQTIRLHISVSPREKKKKHQVTSRDDDDDDDDGDSDEDDDITVVRRGNHHQGGGGGVSREEFRVLVRRVNQMEHSIGSVVSKMDAVMVKLEAMERQRLRRRDVLSRLISGM 692          
BLAST of PKD2-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007306.1 (pep scaffold:Pmarinus_7.0:GL480012:400827:419749:1 gene:ENSPMAG00000006595.1 transcript:ENSPMAT00000007306.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 5.312e-29
Identity = 111/481 (23.08%), Postives = 201/481 (41.79%), Query Frame = 2
Query:  353 LRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLY-YENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQ--------------GIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTV-KLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTY 1747
            +R+L++++   A+LV I++      A+   N +   F  ++F+ N                     L   Y   WYN    +  +  +L  +    +G  RLRQ+R      S+P  +   +    A  ++S        + N      T        +YQ                +A Y GGGF   L     D    +  L +  W+D  TRAV+ +FT YN N +LFC + L+ EF    G      +  V ++  +VG ++       ++F + +V     E+L +  L   YF S WNI ++L I       +   ++       ++    + +   NF+ L  W  Q   L+A  +F++ +KV  ++   +    L    S     + GFA++  ++F +F QL  L+F   + ++     C+  LF ++LG   + +L  A+R+ GPL +  +     FV+ N  L I+++ +
Sbjct:  612 VRQLILFLMHAALLVFITYRGRDPYAFLVQNSVRNAFVLNSFDHNG-------------------FLPNFYPRAWYNGERMSWRERYYLRDFSTIRVGPGRLRQIR------SVPRAWNLLLSAPTAVATLSRAPYVVAARANQRCGEGTTQRKRAVRQYQIFSHRVTQLVPVWHPSLALYSGGGFIAELGLNLADGTEIVANLSSASWLDHSTRAVLTEFTGYNMNTDLFCSVTLLLEFSQGAGDAHGHAYIHVFRIESFVGKLETLTGVVYIVFAILLVIIAATEALRLSELGVAYFKSFWNIAELLSITLGAASVVTYFIKMSVATRTLEKFRTDPHKFVNFQELVTWDQQLSELLATLVFVSTIKVLGHMKSLRQFEVLVGAFSEARDHIQGFAVIVVVVFCSFGQLTSLLFAGSLRNYRTFTTCLEQLFSLLLGQPGYGELYAANRVLGPLIYFAFTSVNTFVIVNFSLGILSEGF 1067          
BLAST of PKD2-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002645.1 (pep scaffold:Pmarinus_7.0:GL476683:134:12081:-1 gene:ENSPMAG00000002415.1 transcript:ENSPMAT00000002645.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 1.206e-8
Identity = 72/321 (22.43%), Postives = 139/321 (43.30%), Query Frame = 2
Query:  833 GIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVL--ACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNI--HPNF------------ESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTY 1747
            G + T+ G G+  +L  T  ++   +  L  N W+D  T  +   F +YNAN NLFC ++++ E         SS  +  +L      I + +L     + +++  +Y++      I   KFEY     N+ +I+ I             TL +  +I+ +  +  +  H NF            + L     QF  L+   LFLA +++     +N TM++     + C+  L  F+++FF++ I+++ + + + G +V  +      + +LF  + G   F  L  A      L +  ++     +L NM + +I + Y
Sbjct:    1 GELNTFIGSGYIADLGLTFAEASGNMSYLEQNSWVDARTTGLYAQFIIYNANANLFCLVEVLVESLSADMFQPSSNLKVFRLFN--NRISYIILDNVAYIFYLIISMYFLTCVIFSITKEKFEYLKKPMNVAEIMNI-------------TLMIMKLIKQVSRSPALGSHLNFFFLINYCTLYSHKPLILLSTQFLGLV---LFLATLRILPLFRYNTTMSEAVTLAAHCAHKLCSFSLIFFVLLISYSLIFWNVLGTRVGAYRSFGKSVGSLFAALHGAPVFGDLYAAGGYMAALLYFSFMLLFTVLLLNMMVVVIEEVY 303          
BLAST of PKD2-4 vs. Ensembl Nematostella
Match: EDO47023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN85])

HSP 1 Score: 691.419 bits (1783), Expect = 0.000e+0
Identity = 377/754 (50.00%), Postives = 511/754 (67.77%), Query Frame = 2
Query:  167 LPSAMSDDSYEYGKSTKDSIEETNFIN-PNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTS--DQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDV--------------------------------------ILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNTL 2305
            +PSAM  +   + K     +      N P  CW RFK  IR LW TR TEDT  DR+++IKTTLREL+IY+ F+ +L I++FGMT+   Y+FT ++  LF  S+ + N  TF   TT ++FW + T  L +GLYW  +YNN N T   D + F+Y+EN+++G PR RQ+RV NDSC++  DF+  IK+C+AAYS + E  +++G+ N + W Y     L    Y G + TY GGGF   L  T+ ++   I  L  NLW+DRGTRAV IDFTVYNANINLFC ++LV E+PPTGG + S  FRTVKLIRYV + D FV+ACE +F++FI+YY +EE LEIK  K +YF S WN+LD++VI+      +FN+ RT+ V +++ +L+ + + + NF+SL FWQ QF+N++A+ +F AW+KVFKYISFNKTMTQLS+TLS+C+KD+AGFAIMFFIIF A+AQLGYLIFG QV DFS  +  I+TLFRIILGDFDF Q+E A+R+ GPL+F+ YVFFVFFVL NMFLAII DTY EVK ++A+Q++EFEI DY K+  + +L KL  K++KI+DIQ A+ + D N D K+DF+EW+  LKSRG+ DAEIEAVFA+YD DGD+ LDE EQ  MQ++LE QK  L+ EI+  + +  ++ +                                            VS EE+  L+RRVDRM+++   IV+KID VL  LE++EK K + RETM  +L+++
Sbjct:   53 MPSAMEAEPVSHQKRIAADVRVPGAKNVPVGCWTRFKRIIRGLWRTRQTEDTDSDREMHIKTTLRELIIYLVFITILCILTFGMTSSTMYYFTKVMRDLFVESSMS-NRNTFKDITTMNEFWMYTTETLSDGLYWEQYYNNQNVTKPKDDLGFIYFENKILGRPRFRQLRVLNDSCTVHDDFKSVIKECYAAYSPNVEDMNTFGKMNGSAWTYQTEKDLQGRSYWGRMTTYSGGGFTQLLAPTKAETQQIIEDLKQNLWLDRGTRAVFIDFTVYNANINLFCIVRLVFEYPPTGGCIPSFNFRTVKLIRYVDTFDHFVMACEGIFILFIIYYTIEEGLEIKKHKMKYFKSFWNVLDVVVIMLGYVAVVFNLYRTMAVGDLLSSLLEDGSQYANFDSLGFWQTQFNNMVAVAVFFAWIKVFKYISFNKTMTQLSSTLSKCAKDVAGFAIMFFIIFFAYAQLGYLIFGTQVRDFSTFEDSIFTLFRIILGDFDFHQIENANRVLGPLFFMTYVFFVFFVLLNMFLAIINDTYAEVKSDIASQESEFEITDYFKKGYQNMLNKLSFKREKILDIQKALKSADVNQDNKLDFEEWRANLKSRGHADAEIEAVFAKYDLDGDRILDEDEQRRMQEDLEGQKAELNDEIEEMERQKESRPKSASRMSFRGSDADSDDDDDDSQGGLSGRVGSAAGHRRGGGGGGGVSYEEFNVLSRRVDRMEHSIGSIVSKIDAVLVKLEAMEKAKLKRRETMAKLLDSI 805          
BLAST of PKD2-4 vs. Ensembl Nematostella
Match: EDO44884 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUD7])

HSP 1 Score: 226.483 bits (576), Expect = 7.632e-62
Identity = 163/520 (31.35%), Postives = 261/520 (50.19%), Query Frame = 2
Query:  326 DRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLF--TTSNFNDNSG---TFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQ------------NSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLA 1834
            D++  +   L ++  Y+ FL VL++I+       AYW +  +S +   TT      SG   TF   + +S+ W +    LL  LY   WY         +        ++G  R RQ+R + D+C I    +G I  C   YSMS++ + +Y  +             ST W + ++S L+   Y G ++TY GGG+ V  +S    +   I    NN WIDR T  +  +FT+YN   NLF    ++ E  PTGG  V  +F T +L   VG    F L C+++F++F  Y+   E  ++   K  YF   WN  +I++++ +        +     +  ++    N N + NF+ ++ WQ+ F++++ I +F++ +K  K + FNK M  L+ TLSR +KDLA + IMF I+F++FAQ  YL+ G+  + FS     I  L  ++LG F F +  +  RI G   F  Y+    F+L NMF+AII +++ EVK      +NEFEI ++  ER   VL 
Sbjct:  543 DKERKMSVILTDIGTYLTFLWVLLVIAHSRVDSAAYWQSRSISDVLMKTTYESPPESGLTKTFQKISNDSEIWLWTNHVLLPALYNLDWYYYTKTAPKLVR--GGAGLVVGFARWRQLRKKKDTCLITGVMRGVIHHCTDPYSMSTQDETNYNSRWRPFNTSDVPPSPSTIWSFNSASKLNGYPYFGEISTYSGGGYIVPFSSIYYKAVKEIKHARNNSWIDRYTAGLFTEFTLYNPYSNLFTASTVLVEVLPTGGFHVRPEFFTFRLYSLVGDFHIFTLVCDVVFLLFTSYFTFRELKKLYKDKCSYFRDYWNWAEIVIMVLAWIAVADYFICLGIRKWTLKLHQENPNDYTNFQYISAWQMSFESILGILVFISTIKFIKLLRFNKKMFLLAYTLSRSAKDLAHYGIMFLIVFLSFAQFYYLLLGSDYDSFSTFVKSIEKLINVLLGRFSFEEFLIPFRIMGAFGFFLYMTLTNFLLLNMFIAIIVESFTEVKLSPELARNEFEIMEFTVERVREVLG 1060          
BLAST of PKD2-4 vs. Ensembl Nematostella
Match: EDO40051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8E5])

HSP 1 Score: 214.157 bits (544), Expect = 7.938e-61
Identity = 145/505 (28.71%), Postives = 254/505 (50.30%), Query Frame = 2
Query:  326 DRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYN----NINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSY---GQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNL----WIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYV 1807
            +RQ+   + +RE+V Y+ FL +++ IS+G         TN +  +F  +++N  S  F    +  D+W +L   ++  ++   WYN    ++ + +D          ++ + RLRQ+R++  +C +    Q  I  C   YS   E +       ++  T W Y     L T  Y G  ATY  GG+      +   +Y+    L + L    W+D+ TRAV  +F++YNAN NLFC + L+ E  PTGG+       T++L RYVG   FFV ACE+++++F  Y+I  E  +   L  +   + W+IL+I V   SL+  +   +R      +++ +  +     +     F       L+ + +F +++K+ + + FN+ M+ L+ TL  C   +  F I++ I F A+AQL  L+FG     F  +     TL   +LG F   ++   +R+ GP +F  Y   + F+L NMF++II D++ EV  +++ Q N++EI D++
Sbjct:    2 ERQM--ASIMREIVWYLIFLFIVLSISYGNRDPYTQLVTNNVENVFLQASYN-GSTKFDEIGSTRDYWPWLKDTVIPSIFIEKWYNDQDYHLGYLADTPT-----AWVLAVARLRQLRMQKHTCPLLPALQHVIPSCNDFYSSDEEERGMLLPGWKEPKTAWQYQTGEELKTFPYWGQKATYSAGGYVQVFPPSTAKNYDKAQALADALNENDWLDKYTRAVFTEFSIYNANSNLFCVVTLLIEQLPTGGIFKFPSILTLRLYRYVGGEMFFVAACEIIYLLFTAYFIFREIKQAYKLGLDKLKNPWSILEIFVTCLSLSMVVLYFLRIKFTAEVVKDMRNDPTRFVSLHYTAFLDEWIKCLMGLIVFFSFIKIVRLLRFNRRMSLLAQTLKLCIPKIGAFVIVYGIAFFAYAQLACLVFGQNAEGFMTIPRSAATLMDTLLGKFTLKEMSDINRLIGPTFFYIYTLSMIFILINMFMSIINDSFAEVNSDVSKQANDYEIVDFM 498          
BLAST of PKD2-4 vs. Ensembl Nematostella
Match: EDO44744 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR6])

HSP 1 Score: 205.297 bits (521), Expect = 1.043e-54
Identity = 151/506 (29.84%), Postives = 256/506 (50.59%), Query Frame = 2
Query:  353 LRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAAS-----TTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLY-YENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTP-----------WVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEY-FFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKER 1816
            ++E++ Y  F+ V++++++G     A+     L  +F+    +D+S     S     +  + FW +    L+ GLY  +WYN     SD+  FL  + + ++G  R+RQ+RV+   C +   + G + QC   YS  +E      +    P           W Y +SS L +  Y G +A Y GGG+  +L   +  +   +  L  + W+DR TRA+ ++FTVY+   NL C   L+ E  P+GG    S+    ++ RY G+   FVL CE+LFV+F VY+  ++  EI      Y F   W+ +++++   S T  +   VR    ++ + T   + ++  NF +L      F  + A   F   +K  +   FNK M+ L+ TL   +K+LA F+I+F ++F+AF    YLIF  ++  F  +   + TL  ++LG F + +L   +R+  P  F FY   V F+L NMF++II + +  VK +   Q NE+EI D++ E+
Sbjct:  611 IQEILFYALFVWVVLVVAYGHRDPNAHVMNQGLEDVFSGRAKHDHSVPDGHSLLFQVSDITSFWNWTEAVLIPGLYSESWYNG---RSDKPGFLADHTSWMLGTARMRQLRVKAGDCKVHDVYSGYLAQCNGPYSWDTEDTTPVFRPGWRPAPSNYSTAQNAWKYRDSSELRSLPYLGKLALYSGGGYAFDLGKKE-KAMAMLAQLKRDKWVDRSTRAIFVEFTVYSPYTNLHCVGYLLLEVLPSGGTSPFSELLVTRIDRYAGNFMIFVLLCEILFVLFTVYFTYKQGKEIAREGVAYHFHEYWSWVELVLSGCSWTSIVLYFVRFGINKSTVLTYHKDTSVFVNFHALAASDQVFGYVYAFVAFFVSLKFLRLFRFNKRMSLLATTLKCSAKELAHFSIVFGLVFMAFVHFCYLIFSTELYIFHTVLSTVETLISVMLGKFSYERLLQTNRLLAPFMFFFYSIVVVFILINMFISIIIENFQRVKSQNDLQSNEYEIVDFMTEQ 1112          
BLAST of PKD2-4 vs. Ensembl Nematostella
Match: EDO49200 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHB8])

HSP 1 Score: 204.912 bits (520), Expect = 1.449e-54
Identity = 150/523 (28.68%), Postives = 251/523 (47.99%), Query Frame = 2
Query:  329 RQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNS--------GTFAASTTESDFWKFLTGPLLNGLYWTTWYNN-----INFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTE--------------YQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKER 1816
            +++ +   L+E++ Y  F+AVL+++++G     AY     L   F + + +  S        GT      +S  W +    L+  LY    YN        +  D++N+L      +G+ RLR  RV+N SC+IP +      +C+  +S S+   D Y       W++ N S   +                Y G +  Y GGG+  +L      +   +  L ++ W++  TR V I+F +YNAN NLF    L  EF PTGG     +F+  +L  YVG    FVLA E++ ++F+ Y++  E   +  LK +YF   WN L++ +I+           R   V      L  N     +F+         + +I I +F   ++  K + FN+ M  L  T++  +K +  F I F ++FI+FA  G +IFG  ++ F      + T   I LGDFD+ ++E  +R+ G +YF  +++F+   L NMFLAII D++ EVK    + KNE+E+ +++ +R
Sbjct:  606 KEIQMSMILKEILAYFIFIAVLLLVAYGNRDPNAYLLRKTLVEEFVSLDESGVSLDEVQWKNGTIIVGDGDS-LWHWARETLIKNLYPGNLYNGKPDKYTGYLEDRVNYL------VGISRLRLERVKNGSCTIPKEMDRFFDECYGEFSYSNSDSDDY----EVEWMFLNKSAAPSARKRRSIAEQFSFGFPYWGKMNFYSGGGYPADLGYDYPTALTVVADLHSHNWVNSNTRGVFIEFAIYNANTNLFGVAFLYVEFLPTGGAFPHGEFKVARLYSYVGPFANFVLAMEVIMLLFMFYFVYREVKSMYKLKKKYFKGFWNWLEVAMIVLEFLMLGLFFARMWEVDKNFIELHHNPKDFVSFQYALASDETLNYVIGILVFFVTIRFIKLLRFNRRMALLGNTIALIAKPIGQFLISFTLVFISFAFFGNMIFGIGLDKFRSFTTTMMTQLNICLGDFDYLEMEEENRMLGRIYFFSFMYFIVMYLMNMFLAIINDSFSEVKTSNDDLKNEYEMVEFILDR 1117          
BLAST of PKD2-4 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 309/727 (42.50%), Postives = 464/727 (63.82%), Query Frame = 2
Query:  200 YGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFN-DNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSL--------------------------EEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILN 2299
            Y   T +  ++    +P  C  R    IR LW T   ED   +R+ Y+   LREL+ YI FL  + I+++GM +   Y++T  +S LF  +  + +N  TF + +T  DFWK+  GP L G+YW  WYNN +   +Q +F+YYEN L+G+PRLRQVRV N++CSI  D + E++ C+  Y+ S+E    +G QN T WV+T  S ++ + + G V+ YGGGG+Y +L+ T+ +S   +  L ++LW+DRGTRA+ +DF+VYN N+NL C  +L+ EFP TGG+L S QF+TV+LI+YV S D+FV  CE+ F +F++YY+VEE LEI + +  YF ++WN LD+L++  S+   I +I R     ++++ L  N   H +F+SL   Q+QF+N+ A+ +F  WVK+FK+I+FNKTM+QLS T+SRC+KDL GFAIMFFIIF+A+AQL YL+FG QVNDFS  Q  ++T FRIILGDFDF +++ A+ + GP+YF+ +V F+FF+L NMFLAII DTY EVK ++A  ++E E+ D++K+     L KL LKK  + DI +++        GK+++DE   +LK +G+ +AEI+A+FA+YD DGD  L E +   M+ +LE ++  LDLE    ++ +   +     P                              EE++ L RRVDRM+++   IV+KID V+  LE +E+ K + R+ +  +L+
Sbjct:  113 YPTQTLNGQQQDRHEHPG-CMKRIFQNIRILWGTELMEDGDSNRERYLWNVLRELLTYIAFLITICILTYGMISTNMYYYTKAMSQLFLDAPLSSENPKTFRSLSTMEDFWKYTQGPFLGGMYWEVWYNNQSLPGNQ-SFIYYENILLGVPRLRQVRVHNETCSIHEDLRDEVQGCYGVYTPSNEDNSPFGPQNGTAWVHTTESKMNASTHWGQVSKYGGGGYYQDLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGVLTSWQFQTVRLIKYVSSWDYFVGVCEVAFCLFVLYYVVEEVLEIHIHRLHYFKNLWNCLDVLIVTLSVVAIIMSITRAAMGGDLLKGL-ENYTSHTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSVFTQFRIILGDFDFFEIKEANPVLGPIYFITFVLFIFFILMNMFLAIINDTYSEVKADMAQHRSEMEMTDFIKKGCTKALVKLRLKKTTVDDISDSL----RQAGGKLNYDELLQDLKEKGHTEAEIQAIFAKYDQDGDLELTEHDHQQMRDDLEKEREDLDLE----RNSLTRPSSGRSFPRTQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEGMERAKLKRRDVLVRLLD 828          
BLAST of PKD2-4 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 309/727 (42.50%), Postives = 464/727 (63.82%), Query Frame = 2
Query:  200 YGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFN-DNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSL--------------------------EEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILN 2299
            Y   T +  ++    +P  C  R    IR LW T   ED   +R+ Y+   LREL+ YI FL  + I+++GM +   Y++T  +S LF  +  + +N  TF + +T  DFWK+  GP L G+YW  WYNN +   +Q +F+YYEN L+G+PRLRQVRV N++CSI  D + E++ C+  Y+ S+E    +G QN T WV+T  S ++ + + G V+ YGGGG+Y +L+ T+ +S   +  L ++LW+DRGTRA+ +DF+VYN N+NL C  +L+ EFP TGG+L S QF+TV+LI+YV S D+FV  CE+ F +F++YY+VEE LEI + +  YF ++WN LD+L++  S+   I +I R     ++++ L  N   H +F+SL   Q+QF+N+ A+ +F  WVK+FK+I+FNKTM+QLS T+SRC+KDL GFAIMFFIIF+A+AQL YL+FG QVNDFS  Q  ++T FRIILGDFDF +++ A+ + GP+YF+ +V F+FF+L NMFLAII DTY EVK ++A  ++E E+ D++K+     L KL LKK  + DI +++        GK+++DE   +LK +G+ +AEI+A+FA+YD DGD  L E +   M+ +LE ++  LDLE    ++ +   +     P                              EE++ L RRVDRM+++   IV+KID V+  LE +E+ K + R+ +  +L+
Sbjct:  113 YPTQTLNGQQQDRHEHPG-CMKRIFQNIRILWGTELMEDGDSNRERYLWNVLRELLTYIAFLITICILTYGMISTNMYYYTKAMSQLFLDAPLSSENPKTFRSLSTMEDFWKYTQGPFLGGMYWEVWYNNQSLPGNQ-SFIYYENILLGVPRLRQVRVHNETCSIHEDLRDEVQGCYGVYTPSNEDNSPFGPQNGTAWVHTTESKMNASTHWGQVSKYGGGGYYQDLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGVLTSWQFQTVRLIKYVSSWDYFVGVCEVAFCLFVLYYVVEEVLEIHIHRLHYFKNLWNCLDVLIVTLSVVAIIMSITRAAMGGDLLKGL-ENYTSHTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSVFTQFRIILGDFDFFEIKEANPVLGPIYFITFVLFIFFILMNMFLAIINDTYSEVKADMAQHRSEMEMTDFIKKGCTKALVKLRLKKTTVDDISDSL----RQAGGKLNYDELLQDLKEKGHTEAEIQAIFAKYDQDGDLELTEHDHQQMRDDLEKEREDLDLE----RNSLTRPSSGRSFPRTQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEGMERAKLKRRDVLVRLLD 828          
BLAST of PKD2-4 vs. Ensembl Medaka
Match: pkd2l1 (polycystin 2 like 1, transient receptor potential cation channel [Source:NCBI gene;Acc:100820724])

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 321/733 (43.79%), Postives = 467/733 (63.71%), Query Frame = 2
Query:  152 YGTRELPSAMSDDSYEYGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEI-----QYEKSEI------LNKTRDVI-LPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKA-------RSRETMGII 2293
            YG R  P    D  Y    + K        +   S    F   I+ LW T  TE+   +R+ YI+TTLREL++Y+ FL  + ++++GMT+   Y+FT  ++ LF  S   D    F +  T +DFW F  GPLL+GLYWT WYN  +  +   +F+YYEN L+G+PR+RQ++++N+SC +  DF+ EI  C+  Y    E   ++G  N T W Y     +  + + G+++TY G G+Y +L+ T+  S   + TL +N W+ RGTR V IDF+ YNANIN+FC I L+ EFP TGG + S Q RTVKL+RYV   D+F+L CE +F VFI+YY+VEE LE+++ +F Y  S+WNILDI+VI+ +L    FN+ RT+ V N++  L+ N NI+ +FE L FWQ Q++N+ A+ LF AW+K+FKYISFNKTMTQLS TL RC+KD+ GFA+MFFI+F A+AQLGYL+FG +V+ FS    CI+T FRIILGDF+F  ++ A+R+ GP+YFV YVFFVFFVL NMFLAII DTY EVKEEL +QK+E +I D +K+       +L LKKDKI D+Q A+ AG     G++ F ++K  L   G+ D EI A F+++D DG++ LD  EQ  M++EL++++++L  E+      YEK  +       ++ R V     V  +++++L R+V ++  +   I ++++ +L  +   EK K         +RE  G++
Sbjct:   46 YGPRPAPQGPVDSPYSLDAAGKFPEASVQRVKKKSGCCSF---IKGLWGTALTENVSNNREKYIRTTLRELLVYLLFLLDICLLTYGMTSSSTYYFTKAMTDLFVNSG-GDAGVAFQSIGTMADFWSFAQGPLLDGLYWTKWYNQQSLNNGNQSFIYYENMLLGVPRMRQIKMKNNSCKVHQDFKDEIFGCYDVYDEKKEDDLNFGLINGTAWTYHTEKEMRGSSHWGLLSTYSGAGYYQDLDRTRERSAEILSTLMDNCWLGRGTRVVFIDFSAYNANINMFCVISLMVEFPATGGAVPSYQIRTVKLLRYVTRWDYFILGCEAVFCVFILYYMVEEVLELRIHRFSYLKSVWNILDIVVILLALVAIAFNVFRTIKVDNLLGKLLENPNIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSTTLGRCAKDILGFAVMFFIVFFAYAQLGYLLFGTEVDTFSTFVKCIFTQFRIILGDFNFDAIDQANRVLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELTSQKDELQITDIIKQSYMKTFTRLKLKKDKITDVQKALQAG----SGEIQFKDFKQTLIEMGHTDGEISAAFSKFDRDGNQVLDAEEQERMKRELQEKRDALSTELNHLGKNYEKEPVETESFPPHEQRSVSNQTFVDQQQFQSLARQVLQVQRSVADITSRMELILAQMGLQEKAKGGESGAGHEARERNGLL 770          
BLAST of PKD2-4 vs. Ensembl Medaka
Match: pkd2l1 (polycystin 2 like 1, transient receptor potential cation channel [Source:NCBI gene;Acc:100820724])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 318/717 (44.35%), Postives = 461/717 (64.30%), Query Frame = 2
Query:  152 YGTRELPSAMSDDSYEYGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEI-----QYEKSEI------LNKTRDVI-LPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKA 2266
            YG R  P    D  Y    + K        +   S    F   I+ LW T  TE+   +R+ YI+TTLREL++Y+ FL  + ++++GMT+   Y+FT  ++ LF  S   D    F +  T +DFW F  GPLL+GLYWT WYN  +  +   +F+YYEN L+G+PR+RQ++++N+SC +  DF+ EI  C+  Y    E   ++G  N T W Y     +  + + G+++TY G G+Y +L+ T+  S   + TL +N W+ RGTR V IDF+ YNANIN+FC I L+ EFP TGG + S Q RTVKL+RYV   D+F+L CE +F VFI+YY+VEE LE+++ +F Y  S+WNILDI+VI+ +L    FN+ RT+ V N++  L+ N NI+ +FE L FWQ Q++N+ A+ LF AW+K+FKYISFNKTMTQLS TL RC+KD+ GFA+MFFI+F A+AQLGYL+FG +V+ FS    CI+T FRIILGDF+F  ++ A+R+ GP+YFV YVFFVFFVL NMFLAII DTY EVKEEL +QK+E +I D +K+       +L LKKDKI D+Q A+ AG     G++ F ++K  L   G+ D EI A F+++D DG++ LD  EQ  M++EL++++++L  E+      YEK  +       ++ R V     V  +++++L R+V ++  +   I ++++ +L  +   EK K 
Sbjct:   46 YGPRPAPQGPVDSPYSLDAAGKFPEASVQRVKKKSGCCSF---IKGLWGTALTENVSNNREKYIRTTLRELLVYLLFLLDICLLTYGMTSSSTYYFTKAMTDLFVNSG-GDAGVAFQSIGTMADFWSFAQGPLLDGLYWTKWYNQQSLNNGNQSFIYYENMLLGVPRMRQIKMKNNSCKVHQDFKDEIFGCYDVYDEKKEDDLNFGLINGTAWTYHTEKEMRGSSHWGLLSTYSGAGYYQDLDRTRERSAEILSTLMDNCWLGRGTRVVFIDFSAYNANINMFCVISLMVEFPATGGAVPSYQIRTVKLLRYVTRWDYFILGCEAVFCVFILYYMVEEVLELRIHRFSYLKSVWNILDIVVILLALVAIAFNVFRTIKVDNLLGKLLENPNIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSTTLGRCAKDILGFAVMFFIVFFAYAQLGYLLFGTEVDTFSTFVKCIFTQFRIILGDFNFDAIDQANRVLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELTSQKDELQITDIIKQSYMKTFTRLKLKKDKITDVQKALQAG----SGEIQFKDFKQTLIEMGHTDGEISAAFSKFDRDGNQVLDAEEQERMKRELQEKRDALSTELNHLGKNYEKEPVETESFPPHEQRSVSNQTFVDQQQFQSLARQVLQVQRSVADITSRMELILAQMGLQEKAKG 754          
BLAST of PKD2-4 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 493.041 bits (1268), Expect = 2.860e-161
Identity = 281/730 (38.49%), Postives = 431/730 (59.04%), Query Frame = 2
Query:  200 YGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFN-DNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYT---LFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSL--------------------------EEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILN 2299
            Y   T +  ++    +P  C  R    IR LW T   ED   +R+ Y+   LREL+ YI FL  + I+++GM +   Y++T  +S LF  +  + +N  TF + +T  DFWK+  GP L G+YW  WYNN +   +Q +F+YYEN L+G+PRLRQVRV N++CSI  D + E++ C+  Y+ S+E    +G QN T WV+T  S ++ + + G V+ YGGGG+Y +L+ T+ +S   +  L ++LW+DRGTRA+ +DF+VYN N+NL C  +L+ EFP TGG+L S QF+TV+LI+YV S D+FV  CE+ F +F++YY+VEE LEI + +  YF ++WN LD+L++  S+   I +I R     ++++ L  N   H +F+SL   Q+QF+N+ A+ +F  WVK+FK+I+FNKTM+QLS T+SRC+KDL GFAIMFFIIF+A+AQL YL+FG QVNDFS  Q  +     L+ +    F ++  E                       ++F          VK ++A  ++E E+ D++K+     L KL LKK  + DI +++        GK+++DE   +LK +G+ +AEI+A+FA+YD DGD  L E +   M+ +LE ++  LDL    E++ +   +     P                              EE++ L RRVDRM+++   IV+KID V+  LE +E+ K + R+ +  +L+
Sbjct:  113 YPTQTLNGQQQDRHEHPG-CMKRIFQNIRILWGTELMEDGDSNRERYLWNVLRELLTYIAFLITICILTYGMISTNMYYYTKAMSQLFLDAPLSSENPKTFRSLSTMEDFWKYTQGPFLGGMYWEVWYNNQSLPGNQ-SFIYYENILLGVPRLRQVRVHNETCSIHEDLRDEVQGCYGVYTPSNEDNSPFGPQNGTAWVHTTESKMNASTHWGQVSKYGGGGYYQDLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGVLTSWQFQTVRLIKYVSSWDYFVGVCEVAFCLFVLYYVVEEVLEIHIHRLHYFKNLWNCLDVLIVTLSVVAIIMSITRAAMGGDLLKGL-ENYTSHTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSVSRTDLLYNLRPLHFLYSHGEKG-----------------ICTVSLF----------VKADMAQHRSEMEMTDFIKKGCTKALVKLRLKKTTVDDISDSL----RQAGGKLNYDELLQDLKEKGHTEAEIQAIFAKYDQDGDLELTEHDHQQMRDDLEKEREDLDL----ERNSLTRPSSGRSFPRTQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEGMERAKLKRRDVLVRLLD 804          
BLAST of PKD2-4 vs. Planmine SMEST
Match: SMESG000018492.1 (SMESG000018492.1)

HSP 1 Score: 1406.35 bits (3639), Expect = 0.000e+0
Identity = 764/769 (99.35%), Postives = 769/769 (100.00%), Query Frame = 2
Query:  134 MHSNGDYGTRELPSAMSDDSYEYGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHKLNQNSVSTFQRH 2440
            MHSNGDYGTRELPSAMSDDSYEYGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDS+NTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLAGFAIMFFIIFIAFAQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPLYFVFYVFFVFFVLFNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLKKDKIIDIQNAV+AGDTNNDGKMDFDEW+VELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTR+IVTKIDTVLEALESIEKDKARSRETMGIILNTLNSND+NEDYDIDDDNDEIKKKKIKELIANEIHKLNQNSVSTFQRH
Sbjct:    1 MHSNGDYGTRELPSAMSDDSYEYGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSFNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLAGFAIMFFIIFIAFAQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPLYFVFYVFFVFFVLFNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLKKDKIIDIQNAVLAGDTNNDGKMDFDEWRVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRVIVTKIDTVLEALESIEKDKARSRETMGIILNTLNSNDNNEDYDIDDDNDEIKKKKIKELIANEIHKLNQNSVSTFQRH 769          
BLAST of PKD2-4 vs. Planmine SMEST
Match: SMESG000018504.1 (SMESG000018504.1)

HSP 1 Score: 730.324 bits (1884), Expect = 0.000e+0
Identity = 386/713 (54.14%), Postives = 520/713 (72.93%), Query Frame = 2
Query:  170 PSAMSDDSYEYGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEK--SEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNT 2302
            P AM  + ++ GK T    +E  F N N CWN+FK GIRSLWAT+HTE+   D+ LY  TT+RELV+Y+ FL +L II+F M     ++FTN L+ LF T+ FNDNSGTF++   +SDFWKFL GPLLNGLYW  WYN+ N  +++ N++Y+EN+L+G+PR+RQ+RV+N+SC IP+  Q ++ QC+AAYS + E K+S+G QNS+ W YT  S+L +  +QG + TYGGGGFYV+L ++Q +S N I++LFNN W+DR TRAV++DFT+YNANINLFC IKLVGEFPP GG+L S +FRTVKLIRYV  +DFFVLACE+LFV++++YYI+EE +EI   K  YF S+WN+LD++V+   + C  F+I R   +Q ++  L+ N NIHPNFE L+FWQLQ+DNL A  LFLA  K+FKYISFNK MTQL +TL+ C KDL GF++MFFI+F+AFAQ GYLIFG+Q+ ++ +   CI+TLFRIIL D +F +L   + I GPLYF+ YVFFVFF+LFNMFLAI+ D Y                 D++KE++  V  KLHLK++KI+D++NA+   DTNNDG MDFDEWK ELK RGY + EIE++FA++DTDGD+ LDE EQ+ M KEL DQK +L+ E+  E+   E L ++ D I P +S  +Y  L+R +D ++N   I+  K D +L+  ++I K K +SRE+  IILN 
Sbjct:   33 PCAMDGEYFDNGKITIIDYQEIGFKNEN-CWNKFKIGIRSLWATKHTENCDEDKNLYANTTVRELVVYMLFLVLLFIITFSMRPGYMFYFTNFLNNLFLTTQFNDNSGTFSSLQAQSDFWKFLMGPLLNGLYWNVWYNSRNMPANEQNYIYFENKLLGVPRIRQIRVKNNSCIIPNILQNKVNQCYAAYSRNIELKESFGFQNSSAWNYTEDSILQSGSFQGQITTYGGGGFYVDLATSQENSLNIILSLFNNRWLDRNTRAVLVDFTIYNANINLFCIIKLVGEFPPVGGVLPSYEFRTVKLIRYVNPLDFFVLACEILFVLYLLYYIIEELIEIDKHKSAYFCSLWNVLDVIVLSLGVICVSFHIYRMYMIQTMLSKLLENGNIHPNFEYLSFWQLQYDNLSAFLLFLAITKIFKYISFNKMMTQLISTLNYCLKDLVGFSLMFFIVFLAFAQAGYLIFGSQLANYREFYICIFTLFRIILNDCNFKELLPLNPILGPLYFILYVFFVFFILFNMFLAILDDAY-----------------DFLKEKSRKVFEKLHLKREKIVDLENAMKTVDTNNDGVMDFDEWKTELKRRGYAETEIESLFAKFDTDGDRVLDEQEQLKMLKELNDQKTALETELIEERDNQEKLIES-DAIQP-ISYAKYMGLSRHIDDLENIIEILTQKFDIILDNFQNIIKTKEKSRESTEIILNA 725          
BLAST of PKD2-4 vs. Planmine SMEST
Match: SMESG000018504.1 (SMESG000018504.1)

HSP 1 Score: 730.324 bits (1884), Expect = 0.000e+0
Identity = 386/713 (54.14%), Postives = 520/713 (72.93%), Query Frame = 2
Query:  170 PSAMSDDSYEYGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEK--SEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNT 2302
            P AM  + ++ GK T    +E  F N N CWN+FK GIRSLWAT+HTE+   D+ LY  TT+RELV+Y+ FL +L II+F M     ++FTN L+ LF T+ FNDNSGTF++   +SDFWKFL GPLLNGLYW  WYN+ N  +++ N++Y+EN+L+G+PR+RQ+RV+N+SC IP+  Q ++ QC+AAYS + E K+S+G QNS+ W YT  S+L +  +QG + TYGGGGFYV+L ++Q +S N I++LFNN W+DR TRAV++DFT+YNANINLFC IKLVGEFPP GG+L S +FRTVKLIRYV  +DFFVLACE+LFV++++YYI+EE +EI   K  YF S+WN+LD++V+   + C  F+I R   +Q ++  L+ N NIHPNFE L+FWQLQ+DNL A  LFLA  K+FKYISFNK MTQL +TL+ C KDL GF++MFFI+F+AFAQ GYLIFG+Q+ ++ +   CI+TLFRIIL D +F +L   + I GPLYF+ YVFFVFF+LFNMFLAI+ D Y                 D++KE++  V  KLHLK++KI+D++NA+   DTNNDG MDFDEWK ELK RGY + EIE++FA++DTDGD+ LDE EQ+ M KEL DQK +L+ E+  E+   E L ++ D I P +S  +Y  L+R +D ++N   I+  K D +L+  ++I K K +SRE+  IILN 
Sbjct:   22 PCAMDGEYFDNGKITIIDYQEIGFKNEN-CWNKFKIGIRSLWATKHTENCDEDKNLYANTTVRELVVYMLFLVLLFIITFSMRPGYMFYFTNFLNNLFLTTQFNDNSGTFSSLQAQSDFWKFLMGPLLNGLYWNVWYNSRNMPANEQNYIYFENKLLGVPRIRQIRVKNNSCIIPNILQNKVNQCYAAYSRNIELKESFGFQNSSAWNYTEDSILQSGSFQGQITTYGGGGFYVDLATSQENSLNIILSLFNNRWLDRNTRAVLVDFTIYNANINLFCIIKLVGEFPPVGGVLPSYEFRTVKLIRYVNPLDFFVLACEILFVLYLLYYIIEELIEIDKHKSAYFCSLWNVLDVIVLSLGVICVSFHIYRMYMIQTMLSKLLENGNIHPNFEYLSFWQLQYDNLSAFLLFLAITKIFKYISFNKMMTQLISTLNYCLKDLVGFSLMFFIVFLAFAQAGYLIFGSQLANYREFYICIFTLFRIILNDCNFKELLPLNPILGPLYFILYVFFVFFILFNMFLAILDDAY-----------------DFLKEKSRKVFEKLHLKREKIVDLENAMKTVDTNNDGVMDFDEWKTELKRRGYAETEIESLFAKFDTDGDRVLDEQEQLKMLKELNDQKTALETELIEERDNQEKLIES-DAIQP-ISYAKYMGLSRHIDDLENIIEILTQKFDIILDNFQNIIKTKEKSRESTEIILNA 714          
BLAST of PKD2-4 vs. Planmine SMEST
Match: SMESG000018504.1 (SMESG000018504.1)

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 384/710 (54.08%), Postives = 518/710 (72.96%), Query Frame = 2
Query:  179 MSDDSYEYGKSTKDSIEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEK--SEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNT 2302
            M  + ++ GK T    +E  F N N CWN+FK GIRSLWAT+HTE+   D+ LY  TT+RELV+Y+ FL +L II+F M     ++FTN L+ LF T+ FNDNSGTF++   +SDFWKFL GPLLNGLYW  WYN+ N  +++ N++Y+EN+L+G+PR+RQ+RV+N+SC IP+  Q ++ QC+AAYS + E K+S+G QNS+ W YT  S+L +  +QG + TYGGGGFYV+L ++Q +S N I++LFNN W+DR TRAV++DFT+YNANINLFC IKLVGEFPP GG+L S +FRTVKLIRYV  +DFFVLACE+LFV++++YYI+EE +EI   K  YF S+WN+LD++V+   + C  F+I R   +Q ++  L+ N NIHPNFE L+FWQLQ+DNL A  LFLA  K+FKYISFNK MTQL +TL+ C KDL GF++MFFI+F+AFAQ GYLIFG+Q+ ++ +   CI+TLFRIIL D +F +L   + I GPLYF+ YVFFVFF+LFNMFLAI+ D Y                 D++KE++  V  KLHLK++KI+D++NA+   DTNNDG MDFDEWK ELK RGY + EIE++FA++DTDGD+ LDE EQ+ M KEL DQK +L+ E+  E+   E L ++ D I P +S  +Y  L+R +D ++N   I+  K D +L+  ++I K K +SRE+  IILN 
Sbjct:    1 MDGEYFDNGKITIIDYQEIGFKNEN-CWNKFKIGIRSLWATKHTENCDEDKNLYANTTVRELVVYMLFLVLLFIITFSMRPGYMFYFTNFLNNLFLTTQFNDNSGTFSSLQAQSDFWKFLMGPLLNGLYWNVWYNSRNMPANEQNYIYFENKLLGVPRIRQIRVKNNSCIIPNILQNKVNQCYAAYSRNIELKESFGFQNSSAWNYTEDSILQSGSFQGQITTYGGGGFYVDLATSQENSLNIILSLFNNRWLDRNTRAVLVDFTIYNANINLFCIIKLVGEFPPVGGVLPSYEFRTVKLIRYVNPLDFFVLACEILFVLYLLYYIIEELIEIDKHKSAYFCSLWNVLDVIVLSLGVICVSFHIYRMYMIQTMLSKLLENGNIHPNFEYLSFWQLQYDNLSAFLLFLAITKIFKYISFNKMMTQLISTLNYCLKDLVGFSLMFFIVFLAFAQAGYLIFGSQLANYREFYICIFTLFRIILNDCNFKELLPLNPILGPLYFILYVFFVFFILFNMFLAILDDAY-----------------DFLKEKSRKVFEKLHLKREKIVDLENAMKTVDTNNDGVMDFDEWKTELKRRGYAETEIESLFAKFDTDGDRVLDEQEQLKMLKELNDQKTALETELIEERDNQEKLIES-DAIQP-ISYAKYMGLSRHIDDLENIIEILTQKFDIILDNFQNIIKTKEKSRESTEIILNA 690          
BLAST of PKD2-4 vs. Planmine SMEST
Match: SMESG000018492.1 (SMESG000018492.1)

HSP 1 Score: 685.256 bits (1767), Expect = 0.000e+0
Identity = 416/420 (99.05%), Postives = 420/420 (100.00%), Query Frame = 2
Query: 1181 MLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLXXXXXXXXXXXXXXXQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPXXXXXXXXXXXXXXXNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLXXXXXXXXQNAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHKLNQNSVSTFQRH 2440
            MLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLAGFAIMFFIIFIAFAQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPLYFVFYVFFVFFVLFNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLKKDKIIDIQNAV+AGDTNNDGKMDFDEW+VELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTR+IVTKIDTVLEALESIEKDKARSRETMGIILNTLNSND+NEDYDIDDDNDEIKKKKIKELIANEIHKLNQNSVSTFQRH
Sbjct:    1 MLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLAGFAIMFFIIFIAFAQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPLYFVFYVFFVFFVLFNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLKKDKIIDIQNAVLAGDTNNDGKMDFDEWRVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRVIVTKIDTVLEALESIEKDKARSRETMGIILNTLNSNDNNEDYDIDDDNDEIKKKKIKELIANEIHKLNQNSVSTFQRH 420          
The following BLAST results are available for this feature:
BLAST of PKD2-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PKD20.000e+046.48polycystin 2, transient receptor potential cation ... [more]
PKD2L10.000e+046.47polycystin 2 like 1, transient receptor potential ... [more]
PKD2L22.333e-13038.87polycystin 2 like 2, transient receptor potential ... [more]
PKD2L21.108e-12941.06polycystin 2 like 2, transient receptor potential ... [more]
PKD2L21.586e-12539.74polycystin 2 like 2, transient receptor potential ... [more]
back to top
BLAST of PKD2-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pkd-27.596e-11835.52Polycystin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U... [more]
lov-12.406e-4125.94Location of vulva defective 1 [Source:UniProtKB/S... [more]
back to top
BLAST of PKD2-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkd21.979e-6637.22gene:FBgn0041195 transcript:FBtr0080365[more]
brv31.563e-1027.31gene:FBgn0040333 transcript:FBtr0300708[more]
brv31.685e-1027.31gene:FBgn0040333 transcript:FBtr0340092[more]
brv11.248e-723.05gene:FBgn0036874 transcript:FBtr0074982[more]
brv26.072e-724.32gene:FBgn0036712 transcript:FBtr0331846[more]
back to top
BLAST of PKD2-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd20.000e+046.81polycystic kidney disease 2 [Source:NCBI gene;Acc:... [more]
pkd2l10.000e+045.69polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
pkd1l2a2.632e-5129.33polycystic kidney disease 1 like 2a [Source:ZFIN;A... [more]
pkd1l2a1.501e-5028.35polycystic kidney disease 1 like 2a [Source:ZFIN;A... [more]
pkd1l2b3.507e-4326.16polycystic kidney disease 1 like 2b [Source:ZFIN;A... [more]
back to top
BLAST of PKD2-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp330.000e+045.26ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
usp330.000e+044.98ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
usp330.000e+044.65ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
usp330.000e+045.24ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
usp330.000e+045.32ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
back to top
BLAST of PKD2-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkd20.000e+045.77polycystin 2, transient receptor potential cation ... [more]
Pkd2l10.000e+047.34polycystic kidney disease 2-like 1 [Source:MGI Sym... [more]
Pkd2l24.496e-12839.17polycystic kidney disease 2-like 2 [Source:MGI Sym... [more]
Pkd2l24.496e-12839.17polycystic kidney disease 2-like 2 [Source:MGI Sym... [more]
Pkd1l21.519e-4427.27polycystic kidney disease 1 like 2 [Source:MGI Sym... [more]
back to top
BLAST of PKD2-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6IVV8|PKD2_DANRE0.000e+046.81Polycystin-2 OS=Danio rerio OX=7955 GN=pkd2 PE=1 S... [more]
sp|Q4GZT3|PKD2_BOVIN0.000e+047.11Polycystin-2 OS=Bos taurus OX=9913 GN=PKD2 PE=2 SV... [more]
sp|O35245|PKD2_MOUSE0.000e+045.77Polycystin-2 OS=Mus musculus OX=10090 GN=Pkd2 PE=1... [more]
sp|Q13563|PKD2_HUMAN0.000e+046.48Polycystin-2 OS=Homo sapiens OX=9606 GN=PKD2 PE=1 ... [more]
sp|Q9P0L9|PK2L1_HUMAN0.000e+046.47Polycystic kidney disease 2-like 1 protein OS=Homo... [more]
back to top
BLAST of PKD2-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFG10.000e+0100.00PKD2-4 OS=Schmidtea mediterranea OX=79327 GN=PKD2-... [more]
A0A0H3YFR30.000e+055.54PKD2L-2 OS=Schmidtea mediterranea OX=79327 GN=PKD2... [more]
A0A0H3YJL00.000e+056.79PKD2L-1 (Fragment) OS=Schmidtea mediterranea OX=79... [more]
A0A077L7550.000e+059.55Transient receptor potential ion channel P a (Frag... [more]
A0A267F1330.000e+054.39Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of PKD2-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd20.000e+046.01polycystin 2, transient receptor potential cation ... [more]
pkd2l10.000e+046.51polycystic kidney disease 2-like 1 protein [Source... [more]
pkd1l2a5.578e-5229.01polycystin 1 like 2 [Source:NCBI gene;Acc:10304417... [more]
ENSAMXT00000006495.22.483e-4025.81pep primary_assembly:Astyanax_mexicanus-2.0:5:3500... [more]
pkd1a7.321e-1023.60polycystic kidney disease 1a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of PKD2-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd2l10.000e+044.46polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
pkd2l10.000e+047.18polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
pkd21.318e-10632.44polycystic kidney disease 2 [Source:NCBI gene;Acc:... [more]
ENSPMAT00000007306.15.312e-2923.08pep scaffold:Pmarinus_7.0:GL480012:400827:419749:1... [more]
ENSPMAT00000002645.11.206e-822.43pep scaffold:Pmarinus_7.0:GL476683:134:12081:-1 ge... [more]
back to top
BLAST of PKD2-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD2-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470230.000e+050.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448847.632e-6231.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400517.938e-6128.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447441.043e-5429.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492001.449e-5428.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PKD2-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd20.000e+042.50polycystin 2, transient receptor potential cation ... [more]
pkd20.000e+042.50polycystin 2, transient receptor potential cation ... [more]
pkd2l10.000e+043.79polycystin 2 like 1, transient receptor potential ... [more]
pkd2l10.000e+044.35polycystin 2 like 1, transient receptor potential ... [more]
pkd22.860e-16138.49polycystin 2, transient receptor potential cation ... [more]
back to top
BLAST of PKD2-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018492.10.000e+099.35SMESG000018492.1[more]
SMESG000018504.10.000e+054.14SMESG000018504.1[more]
SMESG000018504.10.000e+054.14SMESG000018504.1[more]
SMESG000018504.10.000e+054.08SMESG000018504.1[more]
SMESG000018492.10.000e+099.05SMESG000018492.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30007179
GenBankAKN21730.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007179 ID=SMED30007179|Name=PKD2-4|organism=Schmidtea mediterranea sexual|type=transcript|length=2552bp
TTTACGTTCTAATTTCATATATTTTCTGATTCCATACTGTTGGGACATAA
GTTTGTAAATAACAATTTTGAAAATGCAAATGACCTTAGGTTTTTATTTC
AAAAACGATTTATTAGATTTTGTATTTAAAGTAATGCATTCAAATGGTGA
TTATGGAACGAGAGAACTCCCTTCTGCAATGTCTGATGATTCATATGAAT
ATGGTAAATCAACAAAAGATTCAATTGAAGAAACTAATTTTATCAATCCA
AATAGTTGTTGGAATCGTTTTAAAAATGGAATAAGATCTCTTTGGGCAAC
AAGGCACACAGAGGATACAAAAGTTGACAGACAGCTTTACATAAAGACCA
CACTCCGTGAATTGGTGATATATATATTTTTCTTGGCTGTTTTAGTTATA
ATTTCATTTGGTATGACAACAGTTCAAGCATATTGGTTTACAAATCTGTT
GAGCGGGTTATTTACCACTTCAAATTTTAATGATAATTCTGGAACATTTG
CAGCTTCAACGACTGAAAGTGACTTTTGGAAATTTCTTACTGGTCCGTTA
TTAAATGGCCTTTATTGGACAACGTGGTATAACAACATCAATTTTACTAG
TGATCAAATTAATTTTCTGTATTATGAAAATCGATTGATTGGCTTACCAA
GACTTAGACAGGTTCGTGTTAGAAATGATAGTTGTTCAATTCCTTCTGAC
TTTCAAGGTGAAATAAAACAATGCTTTGCAGCATATTCAATGAGCTCAGA
ATCAAAAGATTCATACGGTCAACAAAACTCAACTCCATGGGTTTACACTA
ATTCTAGTGTCTTAGACACGACAGAATATCAAGGAATAGTTGCAACGTAC
GGAGGTGGAGGATTTTACGTCAATTTAAATTCCACACAAGTTGATTCGTA
TAATACAATAATGACTCTTTTTAATAATTTGTGGATCGATCGTGGAACTC
GAGCAGTTATTATAGATTTCACAGTTTACAATGCAAATATAAATTTATTT
TGTTATATTAAATTGGTTGGTGAATTTCCACCGACGGGTGGTTTATTGGT
CAGCTCACAGTTTCGAACCGTTAAACTTATTCGCTATGTTGGTTCTATTG
ACTTTTTTGTGTTAGCTTGCGAATTGCTATTCGTTGTTTTTATTGTTTAC
TACATTGTTGAAGAATCACTTGAAATAAAAATGCTGAAATTCGAATATTT
CTTCTCTATTTGGAATATACTGGACATATTGGTTATAATATTTAGTTTAA
CTTGTTCTATTTTCAACATAGTTCGTACACTCACTGTTCAAAATATTATT
CAAACTCTCGTTGCAAATGATAACATACATCCAAATTTTGAATCACTGAC
ATTTTGGCAATTGCAGTTCGATAATCTTATCGCAATTACATTATTCTTGG
CATGGGTGAAGGTTTTTAAGTACATCAGTTTCAATAAAACTATGACTCAA
CTAAGTGCAACATTAAGTCGATGCTCTAAAGACCTGGCTGGATTTGCAAT
AATGTTTTTCATCATATTTATCGCTTTTGCACAGTTGGGTTACTTGATTT
TTGGAGCTCAAGTCAATGATTTTTCCAAACTTCAATATTGCATATATACT
TTATTTCGAATAATATTGGGTGATTTTGATTTTGCTCAACTTGAAGTGGC
TCACAGAATATTCGGTCCGTTATACTTTGTATTCTACGTTTTTTTTGTAT
TCTTTGTCTTGTTTAATATGTTTTTGGCTATTATTACTGATACGTATGGT
GAGGTCAAGGAAGAACTGGCAAATCAAAAAAATGAATTCGAAATTGCCGA
TTACGTTAAAGAAAGAACCGAGGTGGTTTTGGCAAAATTGCACTTAAAAA
AAGATAAAATTATTGATATTCAAAATGCCGTTATAGCTGGCGATACAAAC
AATGACGGCAAAATGGATTTTGATGAATGGAAAGTTGAACTTAAATCTCG
AGGATATGGTGATGCAGAAATTGAAGCTGTATTTGCAAGGTACGATACAG
ATGGTGATAAAGCTTTAGATGAAGCAGAACAGATCGCAATGCAGAAGGAA
TTAGAAGATCAAAAAAATAGTCTAGATCTCGAAATACAATACGAAAAATC
AGAAATTCTTAATAAAACTAGGGACGTTATCTTACCAGTTGTCTCTTTGG
AAGAATATCGAGCTCTGAATCGTAGAGTTGATCGCATGGATAATAATACT
AGAATTATCGTTACCAAAATTGATACAGTTTTGGAAGCACTCGAAAGTAT
AGAGAAAGATAAAGCTAGAAGCAGAGAAACTATGGGGATAATTTTAAACA
CGTTAAATTCAAATGATGATAATGAAGATTACGATATAGATGATGATAAT
GATGAAATAAAGAAGAAAAAAATAAAAGAATTAATTGCAAATGAAATTCA
CAAATTAAATCAAAATTCTGTTTCTACATTTCAGCGTCATTAGATATATC
TTTACGATAACAATAAATAAATTTGTCATCTTAGATATATATGAAAATGA
AATAAATTTGTGAAACATTTTATCATCGGCAATACATATTCTGTTTTGTT
GT
back to top

protein sequence of SMED30007179-orf-1

>SMED30007179-orf-1 ID=SMED30007179-orf-1|Name=SMED30007179-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=790bp
MQMTLGFYFKNDLLDFVFKVMHSNGDYGTRELPSAMSDDSYEYGKSTKDS
IEETNFINPNSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIY
IFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESD
FWKFLTGPLLNGLYWTTWYNNINFTSDQINFLYYENRLIGLPRLRQVRVR
NDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTT
EYQGIVATYGGGGFYVNLNSTQVDSYNTIMTLFNNLWIDRGTRAVIIDFT
VYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACE
LLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIV
RTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKY
ISFNKTMTQLSATLSRCSKDLAGFAIMFFIIFIAFAQLGYLIFGAQVNDF
SKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPLYFVFYVFFVFFVLFNMF
LAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLKKDKIIDIQ
NAVIAGDTNNDGKMDFDEWKVELKSRGYGDAEIEAVFARYDTDGDKALDE
AEQIAMQKELEDQKNSLDLEIQYEKSEILNKTRDVILPVVSLEEYRALNR
RVDRMDNNTRIIVTKIDTVLEALESIEKDKARSRETMGIILNTLNSNDDN
EDYDIDDDNDEIKKKKIKELIANEIHKLNQNSVSTFQRH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000464GABAergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR003915PKD_2
IPR011992EF-hand-dom_pair
IPR013122PKD1_2_channel
IPR018247EF_Hand_1_Ca_BS
IPR002048EF_hand_dom
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005262calcium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0050982detection of mechanical stimulus
GO:0070588calcium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 657..677
NoneNo IPR availableCOILSCoilCoilcoord: 551..571
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 455..562
e-value: 9.6E-9
score: 37.1
NoneNo IPR availableGENE3DG3DSA:1.20.5.340coord: 689..746
e-value: 2.6E-14
score: 54.9
NoneNo IPR availableGENE3DG3DSA:1.10.238.170coord: 612..657
e-value: 3.5E-21
score: 76.7
NoneNo IPR availablePANTHERPTHR10877:SF114POLYCYSTIN-2coord: 56..670
NoneNo IPR availablePANTHERPTHR10877POLYCYSTIN-RELATEDcoord: 56..670
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 353..558
NoneNo IPR availableTMHMMTMhelixcoord: 375..397
NoneNo IPR availableTMHMMTMhelixcoord: 426..448
NoneNo IPR availableTMHMMTMhelixcoord: 529..551
NoneNo IPR availableTMHMMTMhelixcoord: 99..121
NoneNo IPR availableTMHMMTMhelixcoord: 340..362
NoneNo IPR availableTMHMMTMhelixcoord: 471..493
IPR003915Polycystic kidney disease type 2 proteinPRINTSPR01433POLYCYSTIN2coord: 181..200
score: 69.0
coord: 534..555
score: 71.82
coord: 110..131
score: 36.36
coord: 574..593
score: 31.0
coord: 701..719
score: 52.63
coord: 473..494
score: 75.45
coord: 380..400
score: 35.24
coord: 426..451
score: 51.54
coord: 294..316
score: 66.09
coord: 349..371
score: 56.52
IPR013122Polycystin cation channel, PKD1/PKD2PFAMPF08016PKD_channelcoord: 142..561
e-value: 9.9E-131
score: 436.3
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 607..619
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 594..629
score: 9.325
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 630..663
score: 6.982
IPR002048EF-hand domainCDDcd00051EFhcoord: 607..656
e-value: 4.30176E-7
score: 45.6165
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 593..711