Rab11 family-interacting protein 4

Overview
NameRab11 family-interacting protein 4
Smed IDSMED30007152
Length (bp)1824
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rab11 family-interacting protein 4 (SMED30007152) t-SNE clustered cells

Violin plots show distribution of expression levels for Rab11 family-interacting protein 4 (SMED30007152) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rab11 family-interacting protein 4 (SMED30007152) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rab11 family-interacting protein 4 (SMED30007152) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007152

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30007152h1SMcG0001718 dd_Smed_v4_11969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007152h1SMcG0001718 dd_Smed_v4_11969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30007152h1SMcG0001718 dd_Smed_v6_11969_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007152h1SMcG0001718 dd_Smed_v4_11969_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Human
Match: RAB11FIP3 (RAB11 family interacting protein 3 [Source:HGNC Symbol;Acc:HGNC:17224])

HSP 1 Score: 82.0333 bits (201), Expect = 1.093e-15
Identity = 86/282 (30.50%), Postives = 148/282 (52.48%), Query Frame = 1
Query:  799 KQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGE-------TADFSLEIRRYKDESDKQRAEKHALTEKLTES-------DMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIEL-------NAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS--TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            +Q  R+++EN  L+ R N LE+ LKE E R    +LEE +  ++ L + E EK  E+E +Q RL + + E       T      I R ++E  K   E  +LT +L+E          RLS  + +F R +   + L+E L+ + E  + + +E        ++  +Q+Y               R  ELE  + +LK +N+ L  Q EE N +I    I+  + + ++  +++L+ E+   S++ELM+ + K ++ NFRL+DYI++IIV +M+ NP++LEV
Sbjct:  406 EQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEYHS-----------RARESELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEV 676          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Human
Match: RAB11FIP3 (RAB11 family interacting protein 3 [Source:HGNC Symbol;Acc:HGNC:17224])

HSP 1 Score: 82.0333 bits (201), Expect = 1.093e-15
Identity = 86/282 (30.50%), Postives = 148/282 (52.48%), Query Frame = 1
Query:  799 KQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGE-------TADFSLEIRRYKDESDKQRAEKHALTEKLTES-------DMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIEL-------NAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS--TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            +Q  R+++EN  L+ R N LE+ LKE E R    +LEE +  ++ L + E EK  E+E +Q RL + + E       T      I R ++E  K   E  +LT +L+E          RLS  + +F R +   + L+E L+ + E  + + +E        ++  +Q+Y               R  ELE  + +LK +N+ L  Q EE N +I    I+  + + ++  +++L+ E+   S++ELM+ + K ++ NFRL+DYI++IIV +M+ NP++LEV
Sbjct:  406 EQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEYHS-----------RARESELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEV 676          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Human
Match: RAB11FIP3 (RAB11 family interacting protein 3 [Source:HGNC Symbol;Acc:HGNC:17224])

HSP 1 Score: 80.8777 bits (198), Expect = 1.518e-15
Identity = 83/280 (29.64%), Postives = 144/280 (51.43%), Query Frame = 1
Query:  799 KQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGE-------TADFSLEIRRYKDESDKQRAEKHALTEKLTESDM-------RLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXX-----XXQIEESNSEIRERKIKENRDMINS--TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            +Q  R+++EN  L+ R N LE+ LKE E R    +LEE +  ++ L + E EK  E+E +Q RL + + E       T      I R ++E  K   E  +LT +L+E          RLS  + +F R +   + L+E L+ + E  +  L++L A      E+ + R  +M  L + H    +   + +             Q EE N +I    I+  + + ++  +++L+ E+   S++ELM+ + K ++ NFRL+DYI++IIV +M+ NP++LEV
Sbjct:  189 EQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQ--LLKLEA------EQRRGRSSSM-GLQEYHSRARESELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEV 459          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Human
Match: RAB11FIP3 (RAB11 family interacting protein 3 [Source:HGNC Symbol;Acc:HGNC:17224])

HSP 1 Score: 80.8777 bits (198), Expect = 1.518e-15
Identity = 83/280 (29.64%), Postives = 144/280 (51.43%), Query Frame = 1
Query:  799 KQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGE-------TADFSLEIRRYKDESDKQRAEKHALTEKLTESDM-------RLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXX-----XXQIEESNSEIRERKIKENRDMINS--TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            +Q  R+++EN  L+ R N LE+ LKE E R    +LEE +  ++ L + E EK  E+E +Q RL + + E       T      I R ++E  K   E  +LT +L+E          RLS  + +F R +   + L+E L+ + E  +  L++L A      E+ + R  +M  L + H    +   + +             Q EE N +I    I+  + + ++  +++L+ E+   S++ELM+ + K ++ NFRL+DYI++IIV +M+ NP++LEV
Sbjct:  189 EQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQ--LLKLEA------EQRRGRSSSM-GLQEYHSRARESELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEV 459          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Human
Match: RAB11FIP3 (RAB11 family interacting protein 3 [Source:HGNC Symbol;Acc:HGNC:17224])

HSP 1 Score: 81.6481 bits (200), Expect = 2.018e-15
Identity = 87/282 (30.85%), Postives = 150/282 (53.19%), Query Frame = 1
Query:  799 KQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGE-------TADFSLEIRRYKDESDKQRAEKHALTEKLTES-------DMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIEL-------NAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS--TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            +Q  R+++EN  L+ R N LE+ LKE E R    +LEE +  ++ L + E EK  E+E +Q RL + + E       T      I R ++E  K   E  +LT +L+E          RLS  + +F R +   + L+E L+ + E  + + +E        ++  +Q+Y       H+      R  ELE  + +LK +N+ L  Q EE N +I    I+  + + ++  +++L+ E+   S++ELM+ + K ++ NFRL+DYI++IIV +M+ NP++LEV
Sbjct:  485 EQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEY-------HSR----ARESELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEV 755          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Celegans
Match: rfip-1 (Rab-11 Family Interacting-Protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS6])

HSP 1 Score: 56.225 bits (134), Expect = 3.938e-8
Identity = 89/368 (24.18%), Postives = 160/368 (43.48%), Query Frame = 1
Query:  535 ESHHKWSDRRLRVTSSCKNLLENHTLLPSAASRARDLFSAGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKK------QSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQ--------------GKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINSTDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVG 1578
            E   K++D  +R+  S  +     + L    SR RD  S G S   SD+         G + D L     ++ Q LNSF     +L+++      +  R+K EN  L +R++NLE+ L + E+R +  L +EK    + + R + EK  E E+   +    E +      +  R  +E+ + R E      KL E+ + +  ++EE  +L  Q                 +VE L +E E   R +    ++S+   E     I  +                  A+   L+ + EE   ++    ++  R +I  T +L+ EL      +L+D L + +  N +LR YI  I+++V++++P +LE+G
Sbjct:    8 EEESKYADSPMRLQGSSASSASVASRLYGTRSR-RD--SLGGSSSESDLIA------FGGDQDALNDFSSQMNQ-LNSFTKRYSELEERNMSLSDERTRLKTENSVLKERMHNLEEQLTDNEDRFKQLLSDEKARGTESMSRLKREKELETESWNLKYQMLEKDLISVKKDAERSNEETKRIRNELEKTENKLEEAQLLVEGMEEERIQLERQFRKFKEEAQQDIDSSSEMVEVLALETEELRRKVDGPRSESISDREDMHEEIEILK-----------------AKVAELMKEKEEMTDQLLATSVERGRSLIADTPSLADELAGGDSSQLLDALREQEICNQKLRVYINGILMRVIERHPEILEIG 348          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Celegans
Match: rfip-1 (Rab-11 Family Interacting-Protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS6])

HSP 1 Score: 56.225 bits (134), Expect = 4.163e-8
Identity = 70/294 (23.81%), Postives = 132/294 (44.90%), Query Frame = 1
Query:  757 KLNSFHSDQYDLDKK------QSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQ--------------GKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINSTDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVG 1578
            +LNSF     +L+++      +  R+K EN  L +R++NLE+ L + E+R +  L +EK    + + R + EK  E E+   +    E +      +  R  +E+ + R E      KL E+ + +  ++EE  +L  Q                 +VE L +E E   R +    ++S+   E     I  +                  A+   L+ + EE   ++    ++  R +I  T +L+ EL      +L+D L + +  N +LR YI  I+++V++++P +LE+G
Sbjct:   69 QLNSFTKRYSELEERNMSLSDERTRLKTENSVLKERMHNLEEQLTDNEDRFKQLLSDEKARGTESMSRLKREKELETESWNLKYQMLEKDLISVKKDAERSNEETKRIRNELEKTENKLEEAQLLVEGMEEERIQLERQFRKFKEEAQQDIDSSSEMVEVLALETEELRRKVDGPRSESISDREDMHEEIEILK-----------------AKVAELMKEKEEMTDQLLATSVERGRSLIADTPSLADELAGGDSSQLLDALREQEICNQKLRVYINGILMRVIERHPEILEIG 345          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Celegans
Match: rfip-1 (Rab-11 Family Interacting-Protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS6])

HSP 1 Score: 56.225 bits (134), Expect = 4.501e-8
Identity = 70/294 (23.81%), Postives = 132/294 (44.90%), Query Frame = 1
Query:  757 KLNSFHSDQYDLDKK------QSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQ--------------GKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINSTDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVG 1578
            +LNSF     +L+++      +  R+K EN  L +R++NLE+ L + E+R +  L +EK    + + R + EK  E E+   +    E +      +  R  +E+ + R E      KL E+ + +  ++EE  +L  Q                 +VE L +E E   R +    ++S+   E     I  +                  A+   L+ + EE   ++    ++  R +I  T +L+ EL      +L+D L + +  N +LR YI  I+++V++++P +LE+G
Sbjct:   55 QLNSFTKRYSELEERNMSLSDERTRLKTENSVLKERMHNLEEQLTDNEDRFKQLLSDEKARGTESMSRLKREKELETESWNLKYQMLEKDLISVKKDAERSNEETKRIRNELEKTENKLEEAQLLVEGMEEERIQLERQFRKFKEEAQQDIDSSSEMVEVLALETEELRRKVDGPRSESISDREDMHEEIEILK-----------------AKVAELMKEKEEMTDQLLATSVERGRSLIADTPSLADELAGGDSSQLLDALREQEICNQKLRVYINGILMRVIERHPEILEIG 331          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Celegans
Match: rfip-1 (Rab-11 Family Interacting-Protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS6])

HSP 1 Score: 56.225 bits (134), Expect = 4.501e-8
Identity = 70/294 (23.81%), Postives = 132/294 (44.90%), Query Frame = 1
Query:  757 KLNSFHSDQYDLDKK------QSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQ--------------GKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINSTDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVG 1578
            +LNSF     +L+++      +  R+K EN  L +R++NLE+ L + E+R +  L +EK    + + R + EK  E E+   +    E +      +  R  +E+ + R E      KL E+ + +  ++EE  +L  Q                 +VE L +E E   R +    ++S+   E     I  +                  A+   L+ + EE   ++    ++  R +I  T +L+ EL      +L+D L + +  N +LR YI  I+++V++++P +LE+G
Sbjct:   55 QLNSFTKRYSELEERNMSLSDERTRLKTENSVLKERMHNLEEQLTDNEDRFKQLLSDEKARGTESMSRLKREKELETESWNLKYQMLEKDLISVKKDAERSNEETKRIRNELEKTENKLEEAQLLVEGMEEERIQLERQFRKFKEEAQQDIDSSSEMVEVLALETEELRRKVDGPRSESISDREDMHEEIEILK-----------------AKVAELMKEKEEMTDQLLATSVERGRSLIADTPSLADELAGGDSSQLLDALREQEICNQKLRVYINGILMRVIERHPEILEIG 331          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Celegans
Match: rfip-1 (Rab-11 Family Interacting-Protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS6])

HSP 1 Score: 54.6842 bits (130), Expect = 1.132e-7
Identity = 70/294 (23.81%), Postives = 132/294 (44.90%), Query Frame = 1
Query:  757 KLNSFHSDQYDLDKK------QSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQ--------------GKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINSTDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVG 1578
            +LNSF     +L+++      +  R+K EN  L +R++NLE+ L + E+R +  L +EK    + + R + EK  E E+   +    E +      +  R  +E+ + R E      KL E+ + +  ++EE  +L  Q                 +VE L +E E   R +    ++S+   E     I  +                  A+   L+ + EE   ++    ++  R +I  T +L+ EL      +L+D L + +  N +LR YI  I+++V++++P +LE+G
Sbjct:   17 QLNSFTKRYSELEERNMSLSDERTRLKTENSVLKERMHNLEEQLTDNEDRFKQLLSDEKARGTESMSRLKREKELETESWNLKYQMLEKDLISVKKDAERSNEETKRIRNELEKTENKLEEAQLLVEGMEEERIQLERQFRKFKEEAQQDIDSSSEMVEVLALETEELRRKVDGPRSESISDREDMHEEIEILK-----------------AKVAELMKEKEEMTDQLLATSVERGRSLIADTPSLADELAGGDSSQLLDALREQEICNQKLRVYINGILMRVIERHPEILEIG 293          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Fly
Match: nuf (gene:FBgn0013718 transcript:FBtr0100044)

HSP 1 Score: 68.5514 bits (166), Expect = 9.255e-12
Identity = 88/308 (28.57%), Postives = 155/308 (50.32%), Query Frame = 1
Query:  688 GMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRER-----------KIKENRDMINSTDN-LSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            G L+ EI  N   L  Q++ L++K++   SD  ++ + ++ R K E   L  R + LE+  +E E R + RL EE+K  ++ L R E E   + E  Q ++   E E      E  R +   DKQ  + H   E+L  +  ++  LQ+E +    Q ++L  + + EK+S E +++EL  +  +  E+   R  AM   S     LE+L ++L+   +     +EE N E++              +++ R ++N T N L++ELE  S+ +L     + +D N RL+ YI+ I++ +++  P LLEV
Sbjct:  226 GALSAEICDN---LNEQLELLQRKVDDL-SDTQNIAEDRTTRTKTEYAVLQARYHMLEEQYRESELRAEERLAEEQKRHREILARVEREASLQNENCQMKIRATEIEATALREEAARLRVLCDKQANDLHRTEEQLELARDQIGVLQQEHE---EQAQAL-RRHEQEKKSTEELMLELGRELQRAREESGAR--AMPTTSPESIRLEELHQELEEMRQKNRT-LEEQNEELQATMLTNQATMLTNGVEQGRHLLNGTLNSLAQELEEMSQAQLQQAFQEKEDENVRLKHYIDTILLNIVENYPQLLEV 522          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Fly
Match: nuf (gene:FBgn0013718 transcript:FBtr0100043)

HSP 1 Score: 68.5514 bits (166), Expect = 9.255e-12
Identity = 88/308 (28.57%), Postives = 155/308 (50.32%), Query Frame = 1
Query:  688 GMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRER-----------KIKENRDMINSTDN-LSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            G L+ EI  N   L  Q++ L++K++   SD  ++ + ++ R K E   L  R + LE+  +E E R + RL EE+K  ++ L R E E   + E  Q ++   E E      E  R +   DKQ  + H   E+L  +  ++  LQ+E +    Q ++L  + + EK+S E +++EL  +  +  E+   R  AM   S     LE+L ++L+   +     +EE N E++              +++ R ++N T N L++ELE  S+ +L     + +D N RL+ YI+ I++ +++  P LLEV
Sbjct:  226 GALSAEICDN---LNEQLELLQRKVDDL-SDTQNIAEDRTTRTKTEYAVLQARYHMLEEQYRESELRAEERLAEEQKRHREILARVEREASLQNENCQMKIRATEIEATALREEAARLRVLCDKQANDLHRTEEQLELARDQIGVLQQEHE---EQAQAL-RRHEQEKKSTEELMLELGRELQRAREESGAR--AMPTTSPESIRLEELHQELEEMRQKNRT-LEEQNEELQATMLTNQATMLTNGVEQGRHLLNGTLNSLAQELEEMSQAQLQQAFQEKEDENVRLKHYIDTILLNIVENYPQLLEV 522          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Fly
Match: nuf (gene:FBgn0013718 transcript:FBtr0100040)

HSP 1 Score: 63.1586 bits (152), Expect = 4.018e-10
Identity = 79/288 (27.43%), Postives = 141/288 (48.96%), Query Frame = 1
Query:  748 LEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRER-----------KIKENRDMINSTDN-LSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            L++K++   SD  ++ + ++ R K E   L  R + LE+  +E E R + RL EE+K  ++ L R E E   + E  Q ++   E E      E  R +   DKQ  + H   E+L  +  ++  LQ+E +    Q ++L  + + EK+S E +++EL  +  +  E+   R  AM   S       + L +   E +     +EE N E++              +++ R ++N T N L++ELE  S+ +L     + +D N RL+ YI+ I++ +++  P LLEV
Sbjct:  217 LQRKVDDL-SDTQNIAEDRTTRTKTEYAVLQARYHMLEEQYRESELRAEERLAEEQKRHREILARVEREASLQNENCQMKIRATEIEATALREEAARLRVLCDKQANDLHRTEEQLELARDQIGVLQQEHE---EQAQAL-RRHEQEKKSTEELMLELGRELQRAREESGAR--AMPTTSP-ESIRLEELHQELEEMRQKNRTLEEQNEELQATMLTNQATMLTNGVEQGRHLLNGTLNSLAQELEEMSQAQLQQAFQEKEDENVRLKHYIDTILLNIVENYPQLLEV 496          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Fly
Match: nuf (gene:FBgn0013718 transcript:FBtr0100039)

HSP 1 Score: 63.1586 bits (152), Expect = 4.018e-10
Identity = 79/288 (27.43%), Postives = 141/288 (48.96%), Query Frame = 1
Query:  748 LEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRER-----------KIKENRDMINSTDN-LSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            L++K++   SD  ++ + ++ R K E   L  R + LE+  +E E R + RL EE+K  ++ L R E E   + E  Q ++   E E      E  R +   DKQ  + H   E+L  +  ++  LQ+E +    Q ++L  + + EK+S E +++EL  +  +  E+   R  AM   S       + L +   E +     +EE N E++              +++ R ++N T N L++ELE  S+ +L     + +D N RL+ YI+ I++ +++  P LLEV
Sbjct:  217 LQRKVDDL-SDTQNIAEDRTTRTKTEYAVLQARYHMLEEQYRESELRAEERLAEEQKRHREILARVEREASLQNENCQMKIRATEIEATALREEAARLRVLCDKQANDLHRTEEQLELARDQIGVLQQEHE---EQAQAL-RRHEQEKKSTEELMLELGRELQRAREESGAR--AMPTTSP-ESIRLEELHQELEEMRQKNRTLEEQNEELQATMLTNQATMLTNGVEQGRHLLNGTLNSLAQELEEMSQAQLQQAFQEKEDENVRLKHYIDTILLNIVENYPQLLEV 496          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Fly
Match: nuf (gene:FBgn0013718 transcript:FBtr0100042)

HSP 1 Score: 58.9214 bits (141), Expect = 4.079e-9
Identity = 79/288 (27.43%), Postives = 141/288 (48.96%), Query Frame = 1
Query:  748 LEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRER-----------KIKENRDMINSTDN-LSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            L++K++   SD  ++ + ++ R K E   L  R + LE+  +E E R + RL EE+K  ++ L R E E   + E  Q ++   E E      E  R +   DKQ  + H   E+L  +  ++  LQ+E +    Q ++L  + + EK+S E +++EL  +  +  E+   R  AM   S       + L +   E +     +EE N E++              +++ R ++N T N L++ELE  S+ +L     + +D N RL+ YI+ I++ +++  P LLEV
Sbjct:   20 LQRKVDDL-SDTQNIAEDRTTRTKTEYAVLQARYHMLEEQYRESELRAEERLAEEQKRHREILARVEREASLQNENCQMKIRATEIEATALREEAARLRVLCDKQANDLHRTEEQLELARDQIGVLQQEHE---EQAQAL-RRHEQEKKSTEELMLELGRELQRAREESGAR--AMPTTSP-ESIRLEELHQELEEMRQKNRTLEEQNEELQATMLTNQATMLTNGVEQGRHLLNGTLNSLAQELEEMSQAQLQQAFQEKEDENVRLKHYIDTILLNIVENYPQLLEV 299          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Zebrafish
Match: rab11fip4a (RAB11 family interacting protein 4 (class II) a [Source:NCBI gene;Acc:436806])

HSP 1 Score: 85.5001 bits (210), Expect = 6.618e-17
Identity = 81/276 (29.35%), Postives = 147/276 (53.26%), Query Frame = 1
Query:  811 RIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQE--------------EFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMN----NLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS---TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            ++K+EN  L+ R++ LE+ +K+ E R +  L EE K  ++   + E +K  E+E + NR+ + E E A+  + + R K +++K   EK  +T+KL ++ +RL    +              EF + R   + L+E L+ E E  +   +E         EKP     A      N   R  ELE  +++LK EN  L +Q ++ N +I    + E +++        +L+ E+++ S++EL+D L + ++ NFRLR Y++KII+ ++D NP++LE+
Sbjct:  352 KLKQENTQLVHRVHELEEQIKDQETRAEQCLEEELKRHREAYSKMERDKSTEIELLSNRVQQLEEENAEMKVNVCRLKSQTEKLDQEKQRMTDKLEDTSLRLKDEMDLYRKMMDKLWQNRHEFQKEREAMQELIEDLRRELEHLQLFKLET--------EKPGRGRTAAGLSEYNAKTREIELEHEVKRLKQENHKLRDQNDDLNGQILSLSLYEAKNLFACHTKAQSLAAEIDNASRDELVDALKEQEEINFRLRQYMDKIILAILDHNPSILEI 619          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Zebrafish
Match: rab11fip4b (RAB11 family interacting protein 4 (class II) b [Source:NCBI gene;Acc:100151129])

HSP 1 Score: 83.9593 bits (206), Expect = 1.456e-16
Identity = 78/272 (28.68%), Postives = 154/272 (56.62%), Query Frame = 1
Query:  811 RIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSL--------------QEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS---TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            ++K+EN  L+ R++ LE+ LK+ E R +  + +E +  +   IR E++K  ++E ++NRL++ E E    ++ + R K +++K   EK  +T+KL ++ +RL                 ++EF R R   + L+E L+ E E  +  L +L A+   +  +  I +   ++ + R  ELE  + +LK EN+ L  Q E+ N ++    + E +++  +     +L+ E++H S+++L+D L + ++ N RLR Y++KII+ ++D NP++LE+
Sbjct:  232 KLKQENIQLVHRIHELEEQLKDQETRAEKIMEDELRRHRDAYIRLEKDKNIQIELLRNRLHQLEDENGKMAMNMNRLKSQTEKLDEEKQRMTDKLEDTSLRLKDEMDLYKKMMDKLRQNRQEFQRERDTMQELIEDLRRELEHLQ--LYKLEAERAGRGRRSSISLSEYSSRT-RESELEQEVRRLKQENQKLREQNEDLNGQLLSLSLHEAKNLFATQTKAQSLAMEIDHASRDQLLDALKQQEEINLRLRQYMDKIILSILDHNPSILEI 500          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Zebrafish
Match: rab11fip4b (RAB11 family interacting protein 4 (class II) b [Source:NCBI gene;Acc:100151129])

HSP 1 Score: 82.4185 bits (202), Expect = 4.284e-16
Identity = 77/272 (28.31%), Postives = 154/272 (56.62%), Query Frame = 1
Query:  811 RIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSL--------------QEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS---TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            ++K+EN  L+ R++ LE+ LK+ E R +  + +E +  +   IR E++K  ++E ++NRL++ E E    ++ + R K +++K   EK  +T+KL ++ +RL                 ++EF R R   + L+E L+ E E  +  L +L A+   +  +  I +   ++ + R  ELE  + +LK EN+ L  Q E+ N ++    + E +++  +     +L+ E++H S+++L++ L + ++ N RLR Y++KII+ ++D NP++LE+
Sbjct:  232 KLKQENIQLVHRIHELEEQLKDQETRAEKIMEDELRRHRDAYIRLEKDKNTQIELLRNRLHQLEDENGKMAMNMNRLKSQTEKLDEEKQRMTDKLEDTSLRLKDEMDLYKKMMDKLRQNRQEFQRERDTMQELIEDLRRELEHLQ--LYKLEAERAGRGRRSSISLSEYSSRT-RESELEQEVRRLKQENQKLREQNEDLNGQLLSLSLHEAKNLFATQTKAQSLAMEIDHASRDQLLEALKQQEEINLRLRQYMDKIILSILDHNPSILEI 500          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Zebrafish
Match: rab11fip4b (RAB11 family interacting protein 4 (class II) b [Source:NCBI gene;Acc:100151129])

HSP 1 Score: 82.4185 bits (202), Expect = 4.360e-16
Identity = 76/272 (27.94%), Postives = 154/272 (56.62%), Query Frame = 1
Query:  811 RIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSL--------------QEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS---TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            ++K+EN  L+ R++ LE+ LK+ E R +  + +E +  +   IR E++K  ++E ++NRL++ E E    ++ + R K +++K   EK  +T+KL ++ +RL                 ++EF R R   + L+E L+ E E  +  L +L A+   +  +  I +   ++ + R  ELE  + +LK +N+ L  Q E+ N ++    + E +++  +     +L+ E++H S+++L++ L + ++ N RLR Y++KII+ ++D NP++LE+
Sbjct:  232 KLKQENIQLVHRIHELEEQLKDQETRAEKIMEDELRRHRDAYIRLEKDKNTQIELLRNRLHQLEDENGKMAMNMNRLKSQTEKLDEEKQRMTDKLEDTSLRLKDEMDLYKKMMDKLRQNRQEFQRERDTMQELIEDLRRELEHLQ--LYKLEAERAGRGRRSSISLSEYSSRT-RESELEQEVRRLKQDNQKLREQNEDLNGQLLSLSLHEAKNLFATQTKAQSLAMEIDHASRDQLLEALKQQEEINLRLRQYMDKIILSILDHNPSILEI 500          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Zebrafish
Match: rab11fip4b (RAB11 family interacting protein 4 (class II) b [Source:NCBI gene;Acc:100151129])

HSP 1 Score: 82.4185 bits (202), Expect = 4.360e-16
Identity = 76/272 (27.94%), Postives = 154/272 (56.62%), Query Frame = 1
Query:  811 RIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSL--------------QEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS---TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            ++K+EN  L+ R++ LE+ LK+ E R +  + +E +  +   IR E++K  ++E ++NRL++ E E    ++ + R K +++K   EK  +T+KL ++ +RL                 ++EF R R   + L+E L+ E E  +  L +L A+   +  +  I +   ++ + R  ELE  + +LK +N+ L  Q E+ N ++    + E +++  +     +L+ E++H S+++L++ L + ++ N RLR Y++KII+ ++D NP++LE+
Sbjct:  232 KLKQENIQLVHRIHELEEQLKDQETRAEKIMEDELRRHRDAYIRLEKDKNTQIELLRNRLHQLEDENGKMAMNMNRLKSQTEKLDEEKQRMTDKLEDTSLRLKDEMDLYKKMMDKLRQNRQEFQRERDTMQELIEDLRRELEHLQ--LYKLEAERAGRGRRSSISLSEYSSRT-RESELEQEVRRLKQDNQKLREQNEDLNGQLLSLSLHEAKNLFATQTKAQSLAMEIDHASRDQLLEALKQQEEINLRLRQYMDKIILSILDHNPSILEI 500          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Xenopus
Match: nat10 (N-acetyltransferase 10 (GCN5-related) [Source:Xenbase;Acc:XB-GENE-5858432])

HSP 1 Score: 70.0922 bits (170), Expect = 8.117e-12
Identity = 84/298 (28.19%), Postives = 162/298 (54.36%), Query Frame = 1
Query:  751 EQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGE-------TADFSLEIRRYKDESDKQRAEKHALTEKLTE---SDMRLSS-LQEEFDRLRS---QGKSLVEKLKIEKESYERILIEL-------NAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINST--DNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            EQ+++    D     ++Q+ R+++EN  L+ R + LE+ LK+ E R+     EE ++ + +L + E +   +L +++ R+ + E E         D    ++R ++E  K + E   L  ++ E   S+ +LS  L +E    +S   + + ++E+L+ E E  + + +++       N+ ++Q+Y           N   R  ELE  + +LK E +AL  Q EE N +I    I+  +++ ++T  D+L+ E+ + S++ELM+ + K ++ N RL+DYI++IIV +M+ NPA+LEV
Sbjct:  702 EQRISELERDAATTSEQQN-RLRQENLQLLHRAHALEEQLKDQELRSDEVQSEEIRKHRDELRKMERDNGYQLSSLKARVQELENENSELRSQVPDIKATVQRLEEEKLKLQDEVEVLQGQVKEQCDSNQKLSGQLSKEKHNQQSHMERCQEVIEELRRELEQMQLVRLDMEHRLGLGNSAALQEY-----------NSRTREAELEHEVRRLKQEQRALKEQNEELNGQIINLSIQGAKNLFSTTFSDSLAAEISNVSRDELMEAIQKQEEINLRLQDYIDRIIVAIMETNPAILEV 987          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Xenopus
Match: nat10 (N-acetyltransferase 10 (GCN5-related) [Source:Xenbase;Acc:XB-GENE-5858432])

HSP 1 Score: 67.0106 bits (162), Expect = 1.602e-11
Identity = 85/299 (28.43%), Postives = 164/299 (54.85%), Query Frame = 1
Query:  748 LEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETA-------DFSLEIRRYKDESDKQRAEKHALTEKLTE---SDMRLSS-LQEEFDRLRS---QGKSLVEKLKIEKESYERILIEL-------NAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINST--DNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            LEQ+++    D     ++Q+ R+++EN  L+ R + LE+ LK+ E R+     EE ++ + +L + E +   +L +++ R+ + E E +       D    ++R ++E  K + E   L  ++ E   S+ +LS  L +E    +S   + + ++E+L+ E E  + + +++       N+ ++Q+Y           N   R  ELE  + +LK E +AL  Q EE N +I    I+  +++ ++T  D+L+ E+ + S++ELM+ + K ++ N RL+DYI++IIV +M+ NPA+LEV
Sbjct:   15 LEQRISELERDAATTSEQQN-RLRQENLQLLHRAHALEEQLKDQELRSDEVQSEEIRKHRDELRKMERDNGYQLSSLKARVQELENENSELRSQVPDIKATVQRLEEEKLKLQDEVEVLQGQVKEQCDSNQKLSGQLSKEKHNQQSHMERCQEVIEELRRELEQMQLVRLDMEHRLGLGNSAALQEY-----------NSRTREAELEHEVRRLKQEQRALKEQNEELNGQIINLSIQGAKNLFSTTFSDSLAAEISNVSRDELMEAIQKQEEINLRLQDYIDRIIVAIMETNPAILEV 301          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Mouse
Match: Rab11fip3 (RAB11 family interacting protein 3 (class II) [Source:MGI Symbol;Acc:MGI:2444431])

HSP 1 Score: 85.5001 bits (210), Expect = 3.048e-17
Identity = 88/299 (29.43%), Postives = 159/299 (53.18%), Query Frame = 1
Query:  748 LEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGE-------TADFSLEIRRYKDESDKQRAEKHALTEKLTESDM-------RLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAK-------SVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS--TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            LE++++    D     ++   R+++EN  L+ R N LE+ LKE E R Q ++LEE ++ ++ L + E EK  E+E +Q RL + + E       T      I R ++E  K   E   LT++L+E          RLS  + +F R +   + L+E L+ + E  + + +E+  +        +Q+Y           N   R  ELE  + +LK +N+ L  Q +E N +I    I+  + + ++  +++L+ E+   S++ELM+ + K ++ NFRL+DYI++IIV +++ NP++LEV
Sbjct:  157 LERRVSELEKDSAAAGEQHG-RLRQENLQLVHRANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQARLQQLDEENSELRSCTPCLKANIERLEEEKQKMLDEIEELTQRLSEEQENKRKMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLRLEVEQRRGRSSSLGLQEY-----------NSRARESELEQEVRRLKQDNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAILETNPSILEV 443          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Mouse
Match: Rab11fip3 (RAB11 family interacting protein 3 (class II) [Source:MGI Symbol;Acc:MGI:2444431])

HSP 1 Score: 85.5001 bits (210), Expect = 3.048e-17
Identity = 88/299 (29.43%), Postives = 159/299 (53.18%), Query Frame = 1
Query:  748 LEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGE-------TADFSLEIRRYKDESDKQRAEKHALTEKLTESDM-------RLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAK-------SVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS--TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            LE++++    D     ++   R+++EN  L+ R N LE+ LKE E R Q ++LEE ++ ++ L + E EK  E+E +Q RL + + E       T      I R ++E  K   E   LT++L+E          RLS  + +F R +   + L+E L+ + E  + + +E+  +        +Q+Y           N   R  ELE  + +LK +N+ L  Q +E N +I    I+  + + ++  +++L+ E+   S++ELM+ + K ++ NFRL+DYI++IIV +++ NP++LEV
Sbjct:  157 LERRVSELEKDSAAAGEQHG-RLRQENLQLVHRANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQARLQQLDEENSELRSCTPCLKANIERLEEEKQKMLDEIEELTQRLSEEQENKRKMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLRLEVEQRRGRSSSLGLQEY-----------NSRARESELEQEVRRLKQDNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAILETNPSILEV 443          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Mouse
Match: Rab11fip3 (RAB11 family interacting protein 3 (class II) [Source:MGI Symbol;Acc:MGI:2444431])

HSP 1 Score: 85.5001 bits (210), Expect = 9.241e-17
Identity = 86/282 (30.50%), Postives = 152/282 (53.90%), Query Frame = 1
Query:  799 KQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGE-------TADFSLEIRRYKDESDKQRAEKHALTEKLTES-------DMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAK-------SVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS--TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            +Q  R+++EN  L+ R N LE+ LKE E R Q ++LEE ++ ++ L + E EK  E+E +Q RL + + E       T      I R ++E  K   E   LT++L+E          RLS  + +F R +   + L+E L+ + E  + + +E+  +        +Q+Y           N   R  ELE  + +LK +N+ L  Q +E N +I    I+  + + ++  +++L+ E+   S++ELM+ + K ++ NFRL+DYI++IIV +++ NP++LEV
Sbjct:  821 EQHGRLRQENLQLVHRANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQARLQQLDEENSELRSCTPCLKANIERLEEEKQKMLDEIEELTQRLSEEQENKRKMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLRLEVEQRRGRSSSLGLQEY-----------NSRARESELEQEVRRLKQDNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAILETNPSILEV 1091          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Mouse
Match: Rab11fip3 (RAB11 family interacting protein 3 (class II) [Source:MGI Symbol;Acc:MGI:2444431])

HSP 1 Score: 85.5001 bits (210), Expect = 9.464e-17
Identity = 86/282 (30.50%), Postives = 152/282 (53.90%), Query Frame = 1
Query:  799 KQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGE-------TADFSLEIRRYKDESDKQRAEKHALTEKLTES-------DMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAK-------SVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS--TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            +Q  R+++EN  L+ R N LE+ LKE E R Q ++LEE ++ ++ L + E EK  E+E +Q RL + + E       T      I R ++E  K   E   LT++L+E          RLS  + +F R +   + L+E L+ + E  + + +E+  +        +Q+Y           N   R  ELE  + +LK +N+ L  Q +E N +I    I+  + + ++  +++L+ E+   S++ELM+ + K ++ NFRL+DYI++IIV +++ NP++LEV
Sbjct:  776 EQHGRLRQENLQLVHRANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQARLQQLDEENSELRSCTPCLKANIERLEEEKQKMLDEIEELTQRLSEEQENKRKMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLRLEVEQRRGRSSSLGLQEY-----------NSRARESELEQEVRRLKQDNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAILETNPSILEV 1046          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Mouse
Match: Rab11fip4 (RAB11 family interacting protein 4 (class II) [Source:MGI Symbol;Acc:MGI:2442920])

HSP 1 Score: 76.6406 bits (187), Expect = 3.784e-14
Identity = 78/290 (26.90%), Postives = 160/290 (55.17%), Query Frame = 1
Query:  748 LEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELN--AKSVQQY----EKPQIRIHAMNNLSQ-----RHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS---TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            LE+K+    +D       +S ++K+EN  L+ R++ LE+ +K+ E   +  L EE +  ++   + E EK  ELE +  R+ + E E  D    + R K +++K   E+  ++++L ++ +RL    + + R+  + +    + + E+E+ + ++ +L    + +Q Y    E+P  R  + + L +     R  ELE  +++LK EN  L +Q ++ N +I    + E +++  +     +L+ E++  S++ELM+ L + ++ NFRLR Y++KII+ ++D NP++LE+
Sbjct:  346 LEKKVTELENDSLTSGGLKS-KLKQENMQLVHRVHELEEMVKDQETTAEQALEEEARRHREVYCKLEREKSTELELLNTRVQQLEEENTDLRTTVARLKSQTEKLDEERQRMSDRLEDTSLRLKDEMDLYKRMMDKLRQNRLEFQKEREATQELIEDLRRELEHLQMYKLDCERPG-RGRSSSGLGEFNARAREVELEHEVKRLKQENHKLRDQNDDLNGQILSLSLYEAKNLFATQTKAQSLAAEIDTASRDELMEALKEQEEINFRLRQYMDKIILAILDHNPSILEI 633          
BLAST of Rab11 family-interacting protein 4 vs. UniProt/SwissProt
Match: sp|Q3LGD4|RFP4A_DANRE (Rab11 family-interacting protein 4A OS=Danio rerio OX=7955 GN=rab11fip4a PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 4.996e-16
Identity = 81/276 (29.35%), Postives = 147/276 (53.26%), Query Frame = 1
Query:  811 RIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQE--------------EFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMN----NLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS---TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            ++K+EN  L+ R++ LE+ +K+ E R +  L EE K  ++   + E +K  E+E + NR+ + E E A+  + + R K +++K   EK  +T+KL ++ +RL    +              EF + R   + L+E L+ E E  +   +E         EKP     A      N   R  ELE  +++LK EN  L +Q ++ N +I    + E +++        +L+ E+++ S++EL+D L + ++ NFRLR Y++KII+ ++D NP++LE+
Sbjct:  352 KLKQENTQLVHRVHELEEQIKDQETRAEQCLEEELKRHREAYSKMERDKSTEIELLSNRVQQLEEENAEMKVNVCRLKSQTEKLDQEKQRMTDKLEDTSLRLKDEMDLYRKMMDKLWQNRHEFQKEREAMQELIEDLRRELEHLQLFKLET--------EKPGRGRTAAGLSEYNAKTREIELEHEVKRLKQENHKLRDQNDDLNGQILSLSLYEAKNLFACHTKAQSLAAEIDNASRDELVDALKEQEEINFRLRQYMDKIILAILDHNPSILEI 619          
BLAST of Rab11 family-interacting protein 4 vs. UniProt/SwissProt
Match: sp|Q8CHD8|RFIP3_MOUSE (Rab11 family-interacting protein 3 OS=Mus musculus OX=10090 GN=Rab11fip3 PE=1 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 6.620e-16
Identity = 86/282 (30.50%), Postives = 152/282 (53.90%), Query Frame = 1
Query:  799 KQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGE-------TADFSLEIRRYKDESDKQRAEKHALTEKLTES-------DMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAK-------SVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS--TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            +Q  R+++EN  L+ R N LE+ LKE E R Q ++LEE ++ ++ L + E EK  E+E +Q RL + + E       T      I R ++E  K   E   LT++L+E          RLS  + +F R +   + L+E L+ + E  + + +E+  +        +Q+Y           N   R  ELE  + +LK +N+ L  Q +E N +I    I+  + + ++  +++L+ E+   S++ELM+ + K ++ NFRL+DYI++IIV +++ NP++LEV
Sbjct:  776 EQHGRLRQENLQLVHRANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQARLQQLDEENSELRSCTPCLKANIERLEEEKQKMLDEIEELTQRLSEEQENKRKMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLRLEVEQRRGRSSSLGLQEY-----------NSRARESELEQEVRRLKQDNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAILETNPSILEV 1046          
BLAST of Rab11 family-interacting protein 4 vs. UniProt/SwissProt
Match: sp|B3DGU2|RFP4B_DANRE (Rab11 family-interacting protein 4B OS=Danio rerio OX=7955 GN=rab11fip4b PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.292e-15
Identity = 76/272 (27.94%), Postives = 154/272 (56.62%), Query Frame = 1
Query:  811 RIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSL--------------QEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS---TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            ++K+EN  L+ R++ LE+ LK+ E R +  + +E +  +   IR E++K  ++E ++NRL++ E E    ++ + R K +++K   EK  +T+KL ++ +RL                 ++EF R R   + L+E L+ E E  +  L +L A+   +  +  I +   ++ + R  ELE  + +LK +N+ L  Q E+ N ++    + E +++  +     +L+ E++H S+++L++ L + ++ N RLR Y++KII+ ++D NP++LE+
Sbjct:  232 KLKQENIQLVHRIHELEEQLKDQETRAEKIMEDELRRHRDAYIRLEKDKNTQIELLRNRLHQLEDENGKMAMNMNRLKSQTEKLDEEKQRMTDKLEDTSLRLKDEMDLYKKMMDKLRQNRQEFQRERDTMQELIEDLRRELEHLQ--LYKLEAERAGRGRRSSISLSEYSSRT-RESELEQEVRRLKQDNQKLREQNEDLNGQLLSLSLHEAKNLFATQTKAQSLAMEIDHASRDQLLEALKQQEEINLRLRQYMDKIILSILDHNPSILEI 500          
BLAST of Rab11 family-interacting protein 4 vs. UniProt/SwissProt
Match: sp|O75154|RFIP3_HUMAN (Rab11 family-interacting protein 3 OS=Homo sapiens OX=9606 GN=RAB11FIP3 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 9.692e-15
Identity = 87/282 (30.85%), Postives = 150/282 (53.19%), Query Frame = 1
Query:  799 KQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGE-------TADFSLEIRRYKDESDKQRAEKHALTEKLTES-------DMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIEL-------NAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS--TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            +Q  R+++EN  L+ R N LE+ LKE E R    +LEE +  ++ L + E EK  E+E +Q RL + + E       T      I R ++E  K   E  +LT +L+E          RLS  + +F R +   + L+E L+ + E  + + +E        ++  +Q+Y       H+      R  ELE  + +LK +N+ L  Q EE N +I    I+  + + ++  +++L+ E+   S++ELM+ + K ++ NFRL+DYI++IIV +M+ NP++LEV
Sbjct:  485 EQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEY-------HSR----ARESELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEV 755          
BLAST of Rab11 family-interacting protein 4 vs. UniProt/SwissProt
Match: sp|Q8BQP8|RFIP4_MOUSE (Rab11 family-interacting protein 4 OS=Mus musculus OX=10090 GN=Rab11fip4 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.647e-13
Identity = 78/290 (26.90%), Postives = 160/290 (55.17%), Query Frame = 1
Query:  748 LEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELN--AKSVQQY----EKPQIRIHAMNNLSQ-----RHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS---TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            LE+K+    +D       +S ++K+EN  L+ R++ LE+ +K+ E   +  L EE +  ++   + E EK  ELE +  R+ + E E  D    + R K +++K   E+  ++++L ++ +RL    + + R+  + +    + + E+E+ + ++ +L    + +Q Y    E+P  R  + + L +     R  ELE  +++LK EN  L +Q ++ N +I    + E +++  +     +L+ E++  S++ELM+ L + ++ NFRLR Y++KII+ ++D NP++LE+
Sbjct:  346 LEKKVTELENDSLTSGGLKS-KLKQENMQLVHRVHELEEMVKDQETTAEQALEEEARRHREVYCKLEREKSTELELLNTRVQQLEEENTDLRTTVARLKSQTEKLDEERQRMSDRLEDTSLRLKDEMDLYKRMMDKLRQNRLEFQKEREATQELIEDLRRELEHLQMYKLDCERPG-RGRSSSGLGEFNARAREVELEHEVKRLKQENHKLRDQNDDLNGQILSLSLYEAKNLFATQTKAQSLAAEIDTASRDELMEALKEQEEINFRLRQYMDKIILAILDHNPSILEI 633          
BLAST of Rab11 family-interacting protein 4 vs. TrEMBL
Match: A0A504Z391 (Rab11 family-interacting protein 3 OS=Fasciola gigantica OX=46835 GN=FGIG_02992 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 7.119e-33
Identity = 132/521 (25.34%), Postives = 256/521 (49.14%), Query Frame = 1
Query:   79 IFKVLDNENRGYITVDRFIASFHEFYXXXXXXXXXKTTQENTLKTLISKMKPDENGRIQLQNFLSVFQQVQSEENNYLKAKRYSQYSIKRFLSAESFEEPSEIELSSLNENPQIDFEIDEKNYKNDANSHQSDSRLTNIKN---------HNSKFPEFDNVESHHKWSDRRLRVTSSCKNLLENHTL---LPSAASRA---RDLFSAGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQ---RHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMIN-STDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVGAS 1584
            +F  LD EN+G+ITVD+F+++F EFY+         +T  + ++ L+  + P+ +G I  ++F   FQ                                S IELS   ++P I   +D   +   + +++S      ++N         H     + DN        D  L V     + L+   +    P     A    DL  + AS   SDI    L  ++ +N ++++ Q++R+E+++   HS   +  + +  R++EEN  +  ++  LE+ LKE E R Q  +  E+   Q  + R   E   E+E+++ R+   E E +D  +E  R K +S     +    TE L ++  +L +LQ+E + +  + +  +E L+ +++   ++L ELN  S ++  +       M+  S+   R++E ++++ +L  ENK L  Q+E++  E+    ++E R + N S    SKE+++C+KEE++++  + K +N +LR+YI+ +I ++++++P+LLEV A+
Sbjct:   11 VFGALDTENKGFITVDQFVSTFREFYDGPAQHGRKVSTSRSAIENLVHVLDPENDGIIHFEDFKKAFQ--------------------------------SPIELSGDPDDPNI-THVDGNMFSPSSATNRSTCFSDGLENKTDDSGVHTHEPSIYDCDN--------DSALSVDGVQSSRLQRDDIRRSWPKHRGPAFMNADLPESPASASRSDI----LMDDMETNLELMRDQIQRMEERVEGIHSTHQNEKESRIDRLREENARITAQVTVLEERLKEAEARAQRSVEAERNHLQGIISRNSREHATEVESLRARISSLETECSDLRVESARVKADSQSVVLDLKRNTEALADAQDQLRALQQEKESVEKKHQRDIEILRKDRDHAVQVLEELNGSSERRRSRLGSTCTPMSGGSEALARYQESQEIVRRLIQENKELRKQLEDARDEMFAMSLEEGRTLANISEKAWSKEIDNCTKEEVVEMWTREKHANEQLRNYIDSLITRIIERHPSLLEVAAA 486          
BLAST of Rab11 family-interacting protein 4 vs. TrEMBL
Match: A0A4Z2CPH5 (Rab11 family-interacting protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_008637 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 7.662e-32
Identity = 139/521 (26.68%), Postives = 279/521 (53.55%), Query Frame = 1
Query:   79 IFKVLDNENRGYITVDRFIASFHEFYXXXXXXXXXKTT-QENTLKTLISKMKPDENGRIQLQNFLSVFQQ--VQSEENNYLKAKRYSQYSIKRFLSAESFEEPSEIELSSLNENPQIDFEIDEKNYKNDANSHQSDSRLTNIKNHNSKFPEFDNVESHHKWSDRRLRVTSSCKNLLENHTLLP-SAASRARDLFSAGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNN---------------LSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINSTD-NLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVGA 1581
            +FK LD EN+GYITV++F+++F EFYNN+  D + +++   N +  ++  + P+ +G I  ++F   F+   V  E+NN     ++S  ++ R L  ++    S +  S L++  +        N  +D+  H  D  L +I   ++      + +  H  S R  R     ++    H+  P S+     D   + AS   SDI    L  ++ SNF++++ QM+R+E+++     ++ +  + +  R++EEN  L  ++  LE+ LKE + R+   L  E++  Q  L R+  E  +E ET++ R+   E E ++  ++  R K ++     +     E+LTES  ++ SLQEE   L ++    +E L+ +++    +L ELN        K + R+ + ++               +  R++E+++++ +L AENK L  Q+EE+  E+  + +++ R +I S++ + + E+++C+KEE++++L+K K +N +LR YI+ +I ++++++P+LLE+ +
Sbjct:    9 VFKALDTENKGYITVEQFVSTFREFYNNSGGDGERRSSLSTNDITKVVQTLDPENDGIIHFEDFKKAFEGNIVLDEDNN----SKHSN-ALSRNLDGQN----SSVRSSFLSDGLE--------NKTDDSGVHMHDPTLFDIDTDSAL-----SADGPHNCSTRLQR--GVIRSSWPKHSANPLSSLHHGPD---SPASASQSDI----LLGDMESNFELIRDQMRRMEERVEGLKINRNNESETRLDRLREENARLTAQVTVLEERLKEADARSNRALEAERQHMQSILSRSSREHTQESETLRTRISSLESECSELRVQSARIKADNQACIIDLRRTNEQLTESQEQVRSLQEELKSLSTKHTKEMEVLRKDRDHAVHVLEELNGS---MGGKRRSRVGSGSSTITAAAAAAASGSTEVLARYQEVQEIVRRLTAENKTLRQQVEEAQEELLTQSLQQGRSLIRSSEKSWASEIDNCTKEEVVELLSKEKYANEQLRKYIDDLITRIIERHPSLLEIAS 495          
BLAST of Rab11 family-interacting protein 4 vs. TrEMBL
Match: A0A4Z2CP84 (Rab11 family-interacting protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_008637 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 5.437e-31
Identity = 138/520 (26.54%), Postives = 276/520 (53.08%), Query Frame = 1
Query:   79 IFKVLDNENRGYITVDRFIASFHEFYXXXXXXXXXKTT-QENTLKTLISKMKPDENGRIQLQNFLSVFQQ--VQSEENNYLKAKRYSQYSIKRFLSAESFEEPSEIELSSLNENPQIDFEIDEKNYKNDANSHQSDSRLTNIKNHNSKFPEFDNVESHHKWSDRRLRVTSSCKNLLENHTLLPSAASRARDLFSAGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNN---------------LSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINSTD-NLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVGA 1581
            +FK LD EN+GYITV++F+++F EFYNN+  D + +++   N +  ++  + P+ +G I  ++F   F+   V  E+NN     ++S  ++ R L  ++    S +  S L++  +        N  +D+  H  D  L +I   ++      + +  H +S       SS   L   H    S AS ++           SDI    L  ++ SNF++++ QM+R+E+++     ++ +  + +  R++EEN  L  ++  LE+ LKE + R+   L  E++  Q  L R+  E  +E ET++ R+   E E ++  ++  R K ++     +     E+LTES  ++ SLQEE   L ++    +E L+ +++    +L ELN        K + R+ + ++               +  R++E+++++ +L AENK L  Q+EE+  E+  + +++ R +I S++ + + E+++C+KEE++++L+K K +N +LR YI+ +I ++++++P+LLE+ +
Sbjct:    9 VFKALDTENKGYITVEQFVSTFREFYNNSGGDGERRSSLSTNDITKVVQTLDPENDGIIHFEDFKKAFEGNIVLDEDNN----SKHSN-ALSRNLDGQN----SSVRSSFLSDGLE--------NKTDDSGVHMHDPTLFDIDTDSAL-----SADGPHNFS-------SSANPLSSLHHGPDSPASASQ-----------SDI----LLGDMESNFELIRDQMRRMEERVEGLKINRNNESETRLDRLREENARLTAQVTVLEERLKEADARSNRALEAERQHMQSILSRSSREHTQESETLRTRISSLESECSELRVQSARIKADNQACIIDLRRTNEQLTESQEQVRSLQEELKSLSTKHTKEMEVLRKDRDHAVHVLEELNGS---MGGKRRSRVGSGSSTITAAAAAAASGSTEVLARYQEVQEIVRRLTAENKTLRQQVEEAQEELLTQSLQQGRSLIRSSEKSWASEIDNCTKEEVVELLSKEKYANEQLRKYIDDLITRIIERHPSLLEIAS 481          
BLAST of Rab11 family-interacting protein 4 vs. TrEMBL
Match: A0A5K4EAI3 (Putative rab OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 2.517e-29
Identity = 129/517 (24.95%), Postives = 266/517 (51.45%), Query Frame = 1
Query:   79 IFKVLDNENRGYITVDRFIASFHEFYXXXXXXXXXKTT-QENTLKTLISKMKPDENGRIQLQNFLSVFQQ-VQSEENNYLKAKRYSQYSIKRFLSAESFEEPSEIELSSLNENPQIDFEIDEKNYKNDANSHQSDSRLTNIKNHNSKFPEFDNVESHHKWSDRRLRVTSSCKNLLENHTLLPSAASRARDLFSA---GASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNA------KSVQQYEKPQIRIHAMNNLS----QRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINSTD-NLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVGA 1581
            +FK LD EN+GYITV++F+++F EFYN++  D + +++   N +  ++  + P+ +G I  ++F   F+  +  +E+N  K       S+ R L  ++    + +  S L++  +        N  +D+  H  D  L +I   ++   +  N                +C   L+   +  S    + +  S+   G     S     +L  ++ SNF++++ QM+R+E+++     ++    + +  R++EEN  L  ++  LE+ LKE + R+   L  E++  Q  L R+  E  +E ET++ R+   E E ++  ++  R K ++     +     E+LTES  +  S QEE   L  +    +E L+ +++    +L ELN       +S        +   A +  S     R++E+++++ +L AENK L  Q+EE+  E+  + +++ + +I S++ + + E+++C+KEE++++L+K K +N +LR YI+ +I ++++++P+LLE+ +
Sbjct:   11 VFKALDTENKGYITVEQFVSTFKEFYNSSGADGERRSSLSSNDIMKVVQTLDPENDGIIHYEDFKKAFEGNINFDEDNTSKHSN----SLSRNLDGQN----ASVRSSFLSDGLE--------NKTDDSGVHMHDPTLFDIDTDSALSADGPN----------------NCSTRLQRGEIRSSWPKHSANPLSSLHHGPDSPASASQSDILLGDMESNFELIRDQMRRMEERVEGLKINRNSESETRLDRLREENARLTAQITVLEERLKEADARSSRALEAERQHMQSILSRSSREHTQESETLRARIISLESECSELRVQSARIKADNQAYIIDLRRTNEQLTESQEQARSFQEELKSLTIKHTREIEVLRKDRDHAVHVLEELNGSMGGKRRSRVGSGSGTLTAAAASTGSTEVLARYQEVQEIVRRLTAENKILRQQVEEAQEELLTQSLQQGQSLIRSSEKSWASEIDNCTKEEVVELLSKEKYANEQLRKYIDDLITRIIERHPSLLEIAS 495          
BLAST of Rab11 family-interacting protein 4 vs. TrEMBL
Match: A0A3Q0KCU2 (Putative rab OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 6.864e-29
Identity = 134/522 (25.67%), Postives = 267/522 (51.15%), Query Frame = 1
Query:   79 IFKVLDNENRGYITVDRFIASFHEFYXXXXXXXXXKTT-QENTLKTLISKMKPDENGRIQLQNFLSVFQQ-VQSEENNYLKAKRYSQYSIKRFLSAESFEEPSEIELSSLNENPQIDFEIDEKNYKNDANSHQSDSRLTNIKNHNSKFPEFDN--------VESHHKWSDRRLRVTSSCKNLLENHTLLPSAASRARDLFSAGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNA------KSVQQYEKPQIRIHAMNNLS----QRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINSTD-NLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVGA 1581
            +FK LD EN+GYITV++F+++F EFYN++  D + +++   N +  ++  + P+ +G I  ++F   F+  +  +E+N  K       S+ R L  ++    + +  S L++  +        N  +D+  H  D  L +I   ++   +  N         E    W   R  +      L   H    S AS ++           SDI    L  ++ SNF++++ QM+R+E+++     ++    + +  R++EEN  L  ++  LE+ LKE + R+   L  E++  Q  L R+  E  +E ET++ R+   E E ++  ++  R K ++     +     E+LTES  +  S QEE   L  +    +E L+ +++    +L ELN       +S        +   A +  S     R++E+++++ +L AENK L  Q+EE+  E+  + +++ + +I S++ + + E+++C+KEE++++L+K K +N +LR YI+ +I ++++++P+LLE+ +
Sbjct:   11 VFKALDTENKGYITVEQFVSTFKEFYNSSGADGERRSSLSSNDIMKVVQTLDPENDGIIHYEDFKKAFEGNINFDEDNTSKHSN----SLSRNLDGQN----ASVRSSFLSDGLE--------NKTDDSGVHMHDPTLFDIDTDSALSADGPNNCSTRLQRGEIRSSWPKHRYSLGYLANPLSSLHHGPDSPASASQ-----------SDI----LLGDMESNFELIRDQMRRMEERVEGLKINRNSESETRLDRLREENARLTAQITVLEERLKEADARSSRALEAERQHMQSILSRSSREHTQESETLRARIISLESECSELRVQSARIKADNQAYIIDLRRTNEQLTESQEQARSFQEELKSLTIKHTREIEVLRKDRDHAVHVLEELNGSMGGKRRSRVGSGSGTLTAAAASTGSTEVLARYQEVQEIVRRLTAENKILRQQVEEAQEELLTQSLQQGQSLIRSSEKSWASEIDNCTKEEVVELLSKEKYANEQLRKYIDDLITRIIERHPSLLEIAS 501          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Cavefish
Match: rab11fip4a (rab11 family-interacting protein 4A [Source:NCBI gene;Acc:103025004])

HSP 1 Score: 83.9593 bits (206), Expect = 1.696e-16
Identity = 76/272 (27.94%), Postives = 145/272 (53.31%), Query Frame = 1
Query:  811 RIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQE--------------EFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS---TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            ++K+EN  L+ R++ LE+ +K+ E R +  L EE K  ++   + E +K  E+E + NR+ + E E A+  + + R K +++K   EK  +T+KL ++ +RL    +              EF + R   + L+E L+ E E  +   +E       +    +       N   R  ELE  +++L+ EN  L +Q ++ N +I    + E +++        +L+ E+++ S++EL+D L + ++ NFRLR Y++KII+ ++D NP++LE+
Sbjct:  347 KLKQENTQLVHRVHELEEQIKDQETRAEQSLEEELKRHREVYSKMERDKSTEIELLSNRVQQLEEENAEMKVNVCRLKSQTEKLDQEKQRMTDKLEDTSLRLKDEMDLYRKMMDKLWQNRHEFQKEREAMQELIEDLRRELEHLQLFKLETERPGRGRTSSAEF------NARTREIELEHEVKRLRQENHKLRDQNDDLNGQILSLSLYEAKNLFACHTKAQSLAAEIDNASRDELVDALKEQEEINFRLRQYMDKIILAILDHNPSILEI 612          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Cavefish
Match: rab11fip4b (RAB11 family interacting protein 4 (class II) b [Source:NCBI gene;Acc:100151129])

HSP 1 Score: 68.5514 bits (166), Expect = 7.312e-12
Identity = 99/376 (26.33%), Postives = 189/376 (50.27%), Query Frame = 1
Query:  511 KFPEFDNVESHHKWSDRRLRVTSSCKNLLENHTLLPSAASRARDLFSAGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERI------LIELNAKSVQQYEKPQIRIHAMN------------NLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS---TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            KF + + +E+       RLR   + + LL +H+ L S+     DLF        +DI                  ++ +LE+KL    ++       +S ++K+EN  L+ R+N LE+ LKE E R++  +  E +  ++   + E +K  ++E + NR+ + E E A+  L + R K +++K   EK  +T+KL ++ +RL   ++E D  R     +++KL+  +  Y+R       +IE   + ++  +  ++    M             +   R  ELE  +++LK EN+ L  Q EE N +I    + E + +  +     +L+ E+E+ S+++LM+ L + ++ N RLR Y++KII+ ++D NP++LE+
Sbjct:  132 KFTQLNELEN-------RLRNIKTHRQLL-HHSNLSSSNGSTEDLFRDSIDSSDTDISE----------------KVSQLEKKLCELENECLTNGDVKS-KLKQENTQLVHRVNELEELLKEQEARSELMMEAELRRHREAFNKLERDKNTQIELLTNRVQQLEAENAEMLLNVNRLKSQTEKLDEEKQRMTDKLEDTSLRL---KDEMDLYRK----MMDKLRQNRNDYQREKEAMQEVIEDLRRELEHLQVFKLESERMGRGRSSSISLSEISTRTRESELEQEVKRLKQENQKLREQNEELNGQILSLSLHEAKSLFATQTKAQSLAAEIENASRDQLMEALKEQEEINLRLRQYMDKIILSILDHNPSILEI 475          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Cavefish
Match: rab11fip3 (RAB11 family interacting protein 3 [Source:NCBI gene;Acc:103034926])

HSP 1 Score: 66.2402 bits (160), Expect = 7.964e-11
Identity = 81/287 (28.22%), Postives = 145/287 (50.52%), Query Frame = 1
Query:  796 KKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFS-------LEIRRYKDESDKQRAEKHALTEKL---TESDMRLS---------------SLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINST--DNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            ++Q  R+++EN  L+ R N LE+ LKE E   +  L    +  +  L + + E+  E+E +Q RL++ + E ++           I R ++E  K + E   ++++L   TES  ++S               + QE  + LR Q    +E L++ K   E     L    +Q+Y           N   R  ELE  + +LK +N++L  Q +E N +I    I+  + +   +  ++L+ E+ + S+ ELM+ + K ++ NFRL+DYI++IIV +M+ NP++LEV
Sbjct: 1206 EEQHARLRQENLTLVHRANALEEQLKEQELHAEENLQTLARRHRDTLSKLQRERDLEIENLQARLHQLDEENSELRSCVPCLRANIERLEEEKRKLQDEVDDMSDRLNEETESRRKMSDKLSHERHSNNKEKENTQEVIEDLRKQ----LEHLQLFKLETEARRGRLPGAGLQEY-----------NTHMRENELEQEIRRLKQDNRSLKEQNDELNGQIINLSIQGAKSLFTESLSESLASEINNVSRAELMEAIQKQEEINFRLQDYIDRIIVAIMESNPSILEV 1477          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Cavefish
Match: rab11fip3 (RAB11 family interacting protein 3 [Source:NCBI gene;Acc:103034926])

HSP 1 Score: 65.855 bits (159), Expect = 9.759e-11
Identity = 81/287 (28.22%), Postives = 145/287 (50.52%), Query Frame = 1
Query:  796 KKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFS-------LEIRRYKDESDKQRAEKHALTEKL---TESDMRLS---------------SLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINST--DNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            ++Q  R+++EN  L+ R N LE+ LKE E   +  L    +  +  L + + E+  E+E +Q RL++ + E ++           I R ++E  K + E   ++++L   TES  ++S               + QE  + LR Q    +E L++ K   E     L    +Q+Y           N   R  ELE  + +LK +N++L  Q +E N +I    I+  + +   +  ++L+ E+ + S+ ELM+ + K ++ NFRL+DYI++IIV +M+ NP++LEV
Sbjct: 1251 EEQHARLRQENLTLVHRANALEEQLKEQELHAEENLQTLARRHRDTLSKLQRERDLEIENLQARLHQLDEENSELRSCVPCLRANIERLEEEKRKLQDEVDDMSDRLNEETESRRKMSDKLSHERHSNNKEKENTQEVIEDLRKQ----LEHLQLFKLETEARRGRLPGAGLQEY-----------NTHMRENELEQEIRRLKQDNRSLKEQNDELNGQIINLSIQGAKSLFTESLSESLASEINNVSRAELMEAIQKQEEINFRLQDYIDRIIVAIMESNPSILEV 1522          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Sea Lamprey
Match: rab11fip4a (RAB11 family interacting protein 4 (class II) a [Source:NCBI gene;Acc:436806])

HSP 1 Score: 76.2554 bits (186), Expect = 2.525e-15
Identity = 98/365 (26.85%), Postives = 174/365 (47.67%), Query Frame = 1
Query:  556 DRRLRVTSSCKNLLENHTLLPSAASRARDLFSAGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQE--------------EFDRLRSQGKSLVEKLKIEKESYERILIELN--------AKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS---TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            +RR+   +  + LL NH+ L SAA    DL++      G DI         G    +L+ ++  LE    +      DL  K    +K+EN +L   ++ LE+ LK+ E R + RL E+ +  +++  R   EK  ++ET+ NRL   E E   F   + R K + +K   EK  L E+L +  +R+    +              EF + R   + L+E L+ E E  +   +E+         +  +Q+Y           N   R  ELE  + ++K EN+ L    +E N +I    ++E +++ ++   + +L+ E++  S++ELM    + +D N  LR Y++KII+ ++D NP++LE+
Sbjct:    3 NRRISTNAFARQLL-NHSSLSSAAGSTEDLYTESLDLGGPDI---------GEKVSILEKKVLELENDTVA----NCDLQSK----LKQENLHL--GIHELEEQLKDTEVRGEERLEEDARRHREQTTRLAREKNAQMETLANRLLLVEEENEAFQTTVPRLKTQIEKLEEEKTRLEERLEDLVLRVKDEMDLSKKLSDKMKRDRHEFQKEREATQELIEDLRRELEHLQLFRLEMERGGRGRSASSGLQEY-----------NTRTREAELEQEVRRVKMENRKLKESNDELNGQIISLSLQEAKNLFSAATKSHSLAAEIDSASRDELMVAFKELEDINAHLRQYMDKIILAILDHNPSILEI 336          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Medaka
Match: rab11fip4b (RAB11 family interacting protein 4 [Source:NCBI gene;Acc:101158824])

HSP 1 Score: 88.1965 bits (217), Expect = 4.735e-18
Identity = 79/272 (29.04%), Postives = 153/272 (56.25%), Query Frame = 1
Query:  811 RIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELN-----AKSVQQY----EKPQIRIHAMNNLS-----QRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS---TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            R+K+EN  L+ R+N LE+ LK+ E R +  L EE +  ++  I+ E +K   +E + +R+ + E E  + SL + R K +++K   EK  +T KL ++ +RL    + + ++  + K   ++ + EKE+ + ++ +L       + +Q +    EKP     + + L+      R  ELE  +++L+ EN  L  Q +E N +I    + E +++  +     +L+ E+E+ S+++LMD L + ++ N RLR Y++KII+ ++D NP++LE+
Sbjct:  240 RLKQENTQLVHRVNELEELLKDQETRAEQTLQEETRRHREAYIKMERDKSTHIELLHSRVKQLEDENMEMSLNLCRLKSQTEKLDEEKQRMTNKLEDTSLRLKDEMDLYRKMMDKLKQNRQQFQTEKEAMQELIEKLQDLRRELEHLQLFKLEAEKPGRGRSSSSGLADLSCRTREVELEHEVKRLRQENHKLKEQNDELNGQILSLSLFEAKNLFATQTKAQSLAAEIENASRDQLMDALKQQEEINIRLRQYMDKIILSILDHNPSILEI 511          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Medaka
Match: rab11fip4a (rab11 family-interacting protein 4A [Source:NCBI gene;Acc:101171748])

HSP 1 Score: 88.5817 bits (218), Expect = 5.355e-18
Identity = 96/374 (25.67%), Postives = 180/374 (48.13%), Query Frame = 1
Query:  556 DRRLRVTSSCKNLLE-NHTLLPSA-ASRARDLFSAGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQY---DLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLS-------------------------SLQEEFDRLRSQGKSL-VEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS---TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            +R++  T+  + L + NH++  S+  S   DLF+    P   DI     T ++G            LE+K+    SD     DL  K    +K+EN +L+ R++ LE+ +K+ E +T   L EE K  ++   + E ++  E++ + NR+ + E E  + +L + R K +++K   EK  +++KL ++ +RL                          S QE  D LR +   L + K ++E     R L E +AK+++         H +  L Q + +L D              Q ++ N++I    + E R++ +       L+ E+++ S++EL+D L + ++ N RL+ Y++KII+ ++D NP++LE+
Sbjct:  251 NRKISSTAFGRQLFQANHSVFGSSQGSSTEDLFADSYDPCDLDI-----TEKVGF-----------LERKVTELESDSLANSDLKSK----LKQENTHLVHRVHELEEQVKDSETKTAESLKEEMKRHREAFSKMERDRNSEIDLLFNRVQQLEDENGEMTLNVCRLKSQTEKLDQEKQKISDKLEDTSLRLKDELDLYRKIMDKVWQNRRDFQKEKESTQELVDDLRRELDYLQIFKSEMEHPGKGRGLSEFSAKTMEME-------HEVRRLKQENFKLHD--------------QNDDLNAQILSLSLYEARNLFSCNTKAQCLAAEIDNASRDELVDALKEQEEINLRLKQYMDKIILAILDHNPSILEI 583          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Medaka
Match: rab11fip3 (RAB11 family interacting protein 3 [Source:NCBI gene;Acc:101164259])

HSP 1 Score: 76.2554 bits (186), Expect = 5.301e-14
Identity = 83/286 (29.02%), Postives = 149/286 (52.10%), Query Frame = 1
Query:  787 DLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETAD-------FSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQG-------KSLVEKLKIEKESYERILIELNAK-------SVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS--TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            D   +Q  R+++EN  L+ R N LE+ LKE E   + +L +E +  ++ + + E EK  ELE +Q RL + + E ++           I R ++E  K   E   ++++L E       + ++    R Q        + L+E L+ + E  +   +E  AK        +Q+Y   Q R         R  ELE  +++LK +N+ L  Q +E N +I    I+  ++++++  +D+L+ E+   S+ ELM+ + K ++ N+RL+DYI+KIIV +M+ NP++LEV
Sbjct:  825 DASGEQHTRLRQENLQLVHRANALEEQLKEQEVYAEEQLQQENRRHKEAISKLEREKGLELENLQARLQQLDEENSELRSCVPCLRANIERLEEEKRKLHDEAEVMSQRLEEETEARRKMADKLSHERHQNQKEKESTQELIEDLRKQLEHLQLYKLEAEAKRGRTPGAGLQEY---QTRT--------REAELEQEIKRLKQDNRTLKEQNDELNGQIINLSIQGAKNLMSASFSDSLAAEINSVSRVELMETVHKQEEINYRLQDYIDKIIVAIMECNPSILEV 1099          
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Medaka
Match: rab11fip3 (RAB11 family interacting protein 3 [Source:NCBI gene;Acc:101164259])

HSP 1 Score: 75.8702 bits (185), Expect = 6.870e-14
Identity = 83/286 (29.02%), Postives = 149/286 (52.10%), Query Frame = 1
Query:  787 DLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETAD-------FSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQG-------KSLVEKLKIEKESYERILIELNAK-------SVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS--TDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            D   +Q  R+++EN  L+ R N LE+ LKE E   + +L +E +  ++ + + E EK  ELE +Q RL + + E ++           I R ++E  K   E   ++++L E       + ++    R Q        + L+E L+ + E  +   +E  AK        +Q+Y   Q R         R  ELE  +++LK +N+ L  Q +E N +I    I+  ++++++  +D+L+ E+   S+ ELM+ + K ++ N+RL+DYI+KIIV +M+ NP++LEV
Sbjct:  779 DASGEQHTRLRQENLQLVHRANALEEQLKEQEVYAEEQLQQENRRHKEAISKLEREKGLELENLQARLQQLDEENSELRSCVPCLRANIERLEEEKRKLHDEAEVMSQRLEEETEARRKMADKLSHERHQNQKEKESTQELIEDLRKQLEHLQLYKLEAEAKRGRTPGAGLQEY---QTRT--------REAELEQEIKRLKQDNRTLKEQNDELNGQIINLSIQGAKNLMSASFSDSLAAEINSVSRVELMETVHKQEEINYRLQDYIDKIIVAIMECNPSILEV 1053          
BLAST of Rab11 family-interacting protein 4 vs. Planmine SMEST
Match: SMESG000059669.1 (SMESG000059669.1)

HSP 1 Score: 969.918 bits (2506), Expect = 0.000e+0
Identity = 512/513 (99.81%), Postives = 513/513 (100.00%), Query Frame = 1
Query:   52 MTTLSEAHNIFKVLDNENRGYITVDRFIASFHEFYXXXXXXXXXKTTQENTLKTLISKMKPDENGRIQLQNFLSVFQQVQSEENNYLKAKRYSQYSIKRFLSAESFEEPSEIELSSLNENPQIDFEIDEKNYKNDANSHQSDSRLTNIKNHNSKFPEFDNVESHHKWSDRRLRVTSSCKNLLENHTLLPSAASRARDLFSAGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINSTDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVGASKK 1590
            MTTLSEAHNIFKVLDNENRGYITVDRFIASFHEFYNNNDDDDDDKTTQENTLKTLISKMKPDENGRIQLQNFLSVFQQVQSEENNYLKAKRYSQYSIKRFLSAESFEEPSEIELSSLNENPQIDFEIDEKNYKNDANSHQSDSRLTNIKNHNSKFPEFDNVESHHKWSDRRLRVTSSCKNLLENHTLLPSAASRARDLFSAGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYER+LIELNAKSVQQYEKPQIRIHAMNNLSQRHKELEDLLEKLKAENKALLNQIEESNSEIRERKIKENRDMINSTDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVGASKK
Sbjct:    1 MTTLSEAHNIFKVLDNENRGYITVDRFIASFHEFYNNNDDDDDDKTTQENTLKTLISKMKPDENGRIQLQNFLSVFQQVQSEENNYLKAKRYSQYSIKRFLSAESFEEPSEIELSSLNENPQIDFEIDEKNYKNDANSHQSDSRLTNIKNHNSKFPEFDNVESHHKWSDRRLRVTSSCKNLLENHTLLPSAASRARDLFSAGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERVLIELNAKSVQQYEKPQIRIHAMNNLSQRHKELEDLLEKLKAENKALLNQIEESNSEIRERKIKENRDMINSTDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVGASKK 513          
BLAST of Rab11 family-interacting protein 4 vs. Planmine SMEST
Match: SMESG000059669.1 (SMESG000059669.1)

HSP 1 Score: 916.376 bits (2367), Expect = 0.000e+0
Identity = 493/513 (96.10%), Postives = 494/513 (96.30%), Query Frame = 1
Query:   52 MTTLSEAHNIFKVLDNENRGYITVDRFIASFHEFYXXXXXXXXXKTTQENTLKTLISKMKPDENGRIQLQNFLSVFQQVQSEENNYLKAKRYSQYSIKRFLSAESFEEPSEIELSSLNENPQIDFEIDEKNYKNDANSHQSDSRLTNIKNHNSKFPEFDNVESHHKWSDRRLRVTSSCKNLLENHTLLPSAASRARDLFSAGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINSTDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVGASKK 1590
            MTTLSEAHNIFKVLDNENRGYITVDRFIASFHEFYNNNDDDDDDKTTQENTLKTLISKMKPDENGRIQLQNFLSVFQQVQSEENNYLKAKRYSQYSIKRFLSAESFEEPSEIELSSLNENPQIDFEIDEKNYKNDANSHQSDSRLTNIKNHNSK                   VTSSCKNLLENHTLLPSAASRARDLFSAGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYER+LIELNAKSVQQYEKPQIRIHAMNNLSQRHKELEDLLEKLKAENKALLNQIEESNSEIRERKIKENRDMINSTDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVGASKK
Sbjct:    1 MTTLSEAHNIFKVLDNENRGYITVDRFIASFHEFYNNNDDDDDDKTTQENTLKTLISKMKPDENGRIQLQNFLSVFQQVQSEENNYLKAKRYSQYSIKRFLSAESFEEPSEIELSSLNENPQIDFEIDEKNYKNDANSHQSDSRLTNIKNHNSK-------------------VTSSCKNLLENHTLLPSAASRARDLFSAGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERVLIELNAKSVQQYEKPQIRIHAMNNLSQRHKELEDLLEKLKAENKALLNQIEESNSEIRERKIKENRDMINSTDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEVGASKK 494          
BLAST of Rab11 family-interacting protein 4 vs. Planmine SMEST
Match: SMESG000078337.1 (SMESG000078337.1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.995e-8
Identity = 73/306 (23.86%), Postives = 152/306 (49.67%), Query Frame = 1
Query:  682 HPGMLT----HEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIH-AMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS--TDN-LSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            H G +T    H+  S+   ++ ++++LEQ + +  +      K    R  +EN+NL  +++ L+D +K+ ++  + +L  E +  ++ L + E+ K  E++ +  RL   + E  +   E      E ++ + +K    +KL +   ++ +++E   RL+      +E L  E+ +       L       +E+    ++  M N+S +       L       K+ L   EE   E     I++ ++++ +  TDN    E++  +K E++D+L K KD+NF+LR+Y+  I+ +V+DK+P+LLE+
Sbjct:  242 HSGSVTDLYYHDSMSD---IKEKLEKLEQSMENLQTTATQ-SKTSKFRWMDENQNLKSKIHTLQDIVKDQKKHFEVKLNNEIETSRKYLNKFEKSKLEEIDILNQRLRAKDIELDNLRKEFTTALGECERLKYDKRKSEDKLEDLQQQMGNIEEAMSRLKDFHSRELEILSKERNNL------LATVKNSDFEQNSTNVNFPMKNVSSQLLSEISKLRLENQLLKSKLEVCEE---EFLLFSIQQGQNILQTIPTDNSWMMEIDGYTKAEIIDLLVKEKDANFKLREYVSNILTRVIDKDPSLLEI 534          
BLAST of Rab11 family-interacting protein 4 vs. Planmine SMEST
Match: SMESG000078337.1 (SMESG000078337.1)

HSP 1 Score: 56.9954 bits (136), Expect = 2.779e-8
Identity = 73/306 (23.86%), Postives = 152/306 (49.67%), Query Frame = 1
Query:  682 HPGMLT----HEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIH-AMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINS--TDN-LSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            H G +T    H+  S+   ++ ++++LEQ + +  +      K    R  +EN+NL  +++ L+D +K+ ++  + +L  E +  ++ L + E+ K  E++ +  RL   + E  +   E      E ++ + +K    +KL +   ++ +++E   RL+      +E L  E+ +       L       +E+    ++  M N+S +       L       K+ L   EE   E     I++ ++++ +  TDN    E++  +K E++D+L K KD+NF+LR+Y+  I+ +V+DK+P+LLE+
Sbjct:  237 HSGSVTDLYYHDSMSD---IKEKLEKLEQSMENLQTTATQ-SKTSKFRWMDENQNLKSKIHTLQDIVKDQKKHFEVKLNNEIETSRKYLNKFEKSKLEEIDILNQRLRAKDIELDNLRKEFTTALGECERLKYDKRKSEDKLEDLQQQMGNIEEAMSRLKDFHSRELEILSKERNNL------LATVKNSDFEQNSTNVNFPMKNVSSQLLSEISKLRLENQLLKSKLEVCEE---EFLLFSIQQGQNILQTIPTDNSWMMEIDGYTKAEIIDLLVKEKDANFKLREYVSNILTRVIDKDPSLLEI 529          
BLAST of Rab11 family-interacting protein 4 vs. Planmine SMEST
Match: SMESG000035847.1 (SMESG000035847.1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.079e-7
Identity = 83/328 (25.30%), Postives = 159/328 (48.48%), Query Frame = 1
Query:  625 ASRARDLFSAGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKKQSL--RIKEENKNLIQRLNNLE--------DSLKELEERTQNRLLEEKKEFQQKLIRAEEEKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTESDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEKPQIRIHAMNNLSQRHXXXXXXXXXXXXXXXXXXXQIEESNSEIRERKIKENRDMINSTDN-LSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMDKNPALLEV 1575
            AS+ R L S   SP    I   ++  ++  N + L+  +  L ++L   ++++ D   K +L  R+ +EN NL  ++ NLE        D+ ++LE+  QN   E K        R    K  E++  + ++   E E +   +     K+E DK   E   L EK+  +D + S L EEF RL+      ++    E +  ++ ++E+  K   Q    ++ I        +  EL+  ++K+  EN+ L   +EE   ++    ++E R +++  DN  + E    +K EL++ + K  + N++LR Y +K+I K+++ +P++LE+
Sbjct:   76 ASQIR-LDSQNNSPINGSIS-DIICRDVDMNINNLKDSLATLTKRLEDANAEKID---KTNLERRLFDENSNLQSKIKNLEHQINQTDLDAREDLEKMRQNNAAEMK--------RMISSKTEEIDECRLKVSLLESEISSLRVSCLARKNEMDKLHYETVRLREKIKINDQQYSILNEEFTRLKEINAKEIDIYTKEMDLVKKAVLEIQEKEDSQRNNSEMLIPIA---ESQLMELQQFIQKVSQENRNLRENLEELQGDLLTLSLEEGRSLLSIEDNSWASESNFYTKTELVNYIIKENEVNYKLRQYSDKLISKIIELDPSILEI 387          
The following BLAST results are available for this feature:
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB11FIP31.093e-1530.50RAB11 family interacting protein 3 [Source:HGNC Sy... [more]
RAB11FIP31.093e-1530.50RAB11 family interacting protein 3 [Source:HGNC Sy... [more]
RAB11FIP31.518e-1529.64RAB11 family interacting protein 3 [Source:HGNC Sy... [more]
RAB11FIP31.518e-1529.64RAB11 family interacting protein 3 [Source:HGNC Sy... [more]
RAB11FIP32.018e-1530.85RAB11 family interacting protein 3 [Source:HGNC Sy... [more]
back to top
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rfip-13.938e-824.18Rab-11 Family Interacting-Protein [Source:UniProt... [more]
rfip-14.163e-823.81Rab-11 Family Interacting-Protein [Source:UniProt... [more]
rfip-14.501e-823.81Rab-11 Family Interacting-Protein [Source:UniProt... [more]
rfip-14.501e-823.81Rab-11 Family Interacting-Protein [Source:UniProt... [more]
rfip-11.132e-723.81Rab-11 Family Interacting-Protein [Source:UniProt... [more]
back to top
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nuf9.255e-1228.57gene:FBgn0013718 transcript:FBtr0100044[more]
nuf9.255e-1228.57gene:FBgn0013718 transcript:FBtr0100043[more]
nuf4.018e-1027.43gene:FBgn0013718 transcript:FBtr0100040[more]
nuf4.018e-1027.43gene:FBgn0013718 transcript:FBtr0100039[more]
nuf4.079e-927.43gene:FBgn0013718 transcript:FBtr0100042[more]
back to top
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab11fip4a6.618e-1729.35RAB11 family interacting protein 4 (class II) a [S... [more]
rab11fip4b1.456e-1628.68RAB11 family interacting protein 4 (class II) b [S... [more]
rab11fip4b4.284e-1628.31RAB11 family interacting protein 4 (class II) b [S... [more]
rab11fip4b4.360e-1627.94RAB11 family interacting protein 4 (class II) b [S... [more]
rab11fip4b4.360e-1627.94RAB11 family interacting protein 4 (class II) b [S... [more]
back to top
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nat108.117e-1228.19N-acetyltransferase 10 (GCN5-related) [Source:Xenb... [more]
nat101.602e-1128.43N-acetyltransferase 10 (GCN5-related) [Source:Xenb... [more]
back to top
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab11fip33.048e-1729.43RAB11 family interacting protein 3 (class II) [Sou... [more]
Rab11fip33.048e-1729.43RAB11 family interacting protein 3 (class II) [Sou... [more]
Rab11fip39.241e-1730.50RAB11 family interacting protein 3 (class II) [Sou... [more]
Rab11fip39.464e-1730.50RAB11 family interacting protein 3 (class II) [Sou... [more]
Rab11fip43.784e-1426.90RAB11 family interacting protein 4 (class II) [Sou... [more]
back to top
BLAST of Rab11 family-interacting protein 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3LGD4|RFP4A_DANRE4.996e-1629.35Rab11 family-interacting protein 4A OS=Danio rerio... [more]
sp|Q8CHD8|RFIP3_MOUSE6.620e-1630.50Rab11 family-interacting protein 3 OS=Mus musculus... [more]
sp|B3DGU2|RFP4B_DANRE3.292e-1527.94Rab11 family-interacting protein 4B OS=Danio rerio... [more]
sp|O75154|RFIP3_HUMAN9.692e-1530.85Rab11 family-interacting protein 3 OS=Homo sapiens... [more]
sp|Q8BQP8|RFIP4_MOUSE2.647e-1326.90Rab11 family-interacting protein 4 OS=Mus musculus... [more]
back to top
BLAST of Rab11 family-interacting protein 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504Z3917.119e-3325.34Rab11 family-interacting protein 3 OS=Fasciola gig... [more]
A0A4Z2CPH57.662e-3226.68Rab11 family-interacting protein isoform 1 OS=Schi... [more]
A0A4Z2CP845.437e-3126.54Rab11 family-interacting protein isoform 2 OS=Schi... [more]
A0A5K4EAI32.517e-2924.95Putative rab OS=Schistosoma mansoni OX=6183 PE=4 S... [more]
A0A3Q0KCU26.864e-2925.67Putative rab OS=Schistosoma mansoni OX=6183 PE=4 S... [more]
back to top
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rab11fip4a1.696e-1627.94rab11 family-interacting protein 4A [Source:NCBI g... [more]
rab11fip4b7.312e-1226.33RAB11 family interacting protein 4 (class II) b [S... [more]
rab11fip37.964e-1128.22RAB11 family interacting protein 3 [Source:NCBI ge... [more]
rab11fip39.759e-1128.22RAB11 family interacting protein 3 [Source:NCBI ge... [more]
back to top
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rab11fip4a2.525e-1526.85RAB11 family interacting protein 4 (class II) a [S... [more]
back to top
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rab11 family-interacting protein 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rab11fip4b4.735e-1829.04RAB11 family interacting protein 4 [Source:NCBI ge... [more]
rab11fip4a5.355e-1825.67rab11 family-interacting protein 4A [Source:NCBI g... [more]
rab11fip35.301e-1429.02RAB11 family interacting protein 3 [Source:NCBI ge... [more]
rab11fip36.870e-1429.02RAB11 family interacting protein 3 [Source:NCBI ge... [more]
back to top
BLAST of Rab11 family-interacting protein 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059669.10.000e+099.81SMESG000059669.1[more]
SMESG000059669.10.000e+096.10SMESG000059669.1[more]
SMESG000078337.11.995e-823.86SMESG000078337.1[more]
SMESG000078337.12.779e-823.86SMESG000078337.1[more]
SMESG000035847.11.079e-725.30SMESG000035847.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007152 ID=SMED30007152|Name=Rab11 family-interacting protein 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1824bp
ACATAATCAATTTCAAATGAGGATTTTATTTTTAAATTAATTTTGCTGAC
TATGACAACTTTATCAGAAGCGCATAATATTTTTAAAGTGTTAGACAATG
AAAATAGAGGTTACATAACAGTTGATAGGTTTATTGCTTCATTTCATGAA
TTTTACAACAACAATGATGACGATGACGACGATAAAACCACTCAGGAAAA
TACTTTGAAAACACTGATCTCCAAAATGAAACCAGATGAGAATGGCAGGA
TTCAATTGCAAAATTTCCTGTCGGTTTTTCAACAAGTTCAATCGGAAGAA
AATAATTATTTGAAAGCAAAACGATATTCACAATATTCAATCAAGAGATT
TCTTTCCGCCGAAAGCTTTGAAGAGCCATCGGAAATTGAATTGAGCAGTT
TGAATGAAAATCCACAAATCGATTTCGAAATTGACGAAAAAAATTATAAA
AATGACGCTAATTCCCACCAATCAGACAGTCGATTGACGAATATTAAAAA
TCATAATTCCAAATTCCCAGAATTTGACAATGTCGAATCTCATCATAAAT
GGTCGGATCGGAGGCTGAGAGTTACTTCCAGTTGCAAAAATCTTCTTGAA
AATCATACGCTATTGCCATCTGCAGCCAGTCGAGCTAGAGATCTGTTCTC
TGCTGGAGCATCTCCCAGAGGAAGTGATATCCATCCAGGCATGTTAACTC
ATGAAATTGGAAGCAATTTTGATGTTTTGCAAATGCAGATGAAGCGCCTA
GAACAAAAGTTGAATAGTTTTCATTCCGACCAATATGATCTTGATAAAAA
GCAGTCATTAAGAATCAAAGAAGAAAATAAAAATTTGATCCAAAGACTCA
ATAATTTGGAAGATAGCCTCAAAGAACTGGAAGAAAGGACTCAAAATCGA
CTGCTAGAAGAGAAGAAAGAATTTCAACAAAAACTGATTAGAGCCGAAGA
AGAAAAACGTCGAGAACTAGAAACAGTTCAAAATCGTCTTTATAAATTTG
AAGGTGAAACTGCGGACTTTTCTTTGGAAATTCGTCGATATAAAGATGAA
AGTGATAAACAAAGAGCGGAAAAGCATGCGTTAACGGAAAAATTAACCGA
ATCTGACATGCGCCTCAGCAGTCTTCAGGAAGAATTCGACAGGTTAAGAT
CACAGGGTAAATCATTGGTGGAAAAATTGAAAATAGAAAAAGAAAGTTAC
GAAAGAATTTTAATAGAGTTGAATGCCAAAAGTGTCCAACAATATGAAAA
ACCACAAATCCGCATTCATGCTATGAATAATCTTAGTCAACGGCATAAAG
AATTAGAAGATTTGCTGGAGAAGTTAAAAGCCGAAAATAAGGCACTATTG
AATCAAATTGAAGAATCAAATTCTGAAATCAGAGAGAGAAAAATTAAAGA
AAACAGAGATATGATAAATTCAACAGATAATTTATCTAAGGAATTAGAAC
ACTGCAGCAAAGAAGAATTAATGGATATATTGGCCAAAGGAAAAGATTCC
AATTTTCGATTAAGAGATTATATCGAAAAGATTATTGTCAAAGTTATGGA
TAAAAATCCAGCTCTACTTGAAGTCGGCGCCTCGAAAAAATAACAGATTT
AGTAAAGACAGATTATAAAGTTACATATCAGTTGTGAATACCACAAAAAA
TTAAGCTGGACTTGATCCAATGTAAAGATCTTCGAACTTTTCTTGTGCTT
TAAGTTTTATATTTATTTTAAGAGCCTTAATTTATGTATATAATTTTATT
TATATTGCTTACTCAACATGAAATTTATTTTGTTTATGTCTTATAATGAG
ACAAAGATTTGCTATCGTTTTCAT
back to top

protein sequence of SMED30007152-orf-1

>SMED30007152-orf-1 ID=SMED30007152-orf-1|Name=SMED30007152-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=514bp
MTTLSEAHNIFKVLDNENRGYITVDRFIASFHEFYNNNDDDDDDKTTQEN
TLKTLISKMKPDENGRIQLQNFLSVFQQVQSEENNYLKAKRYSQYSIKRF
LSAESFEEPSEIELSSLNENPQIDFEIDEKNYKNDANSHQSDSRLTNIKN
HNSKFPEFDNVESHHKWSDRRLRVTSSCKNLLENHTLLPSAASRARDLFS
AGASPRGSDIHPGMLTHEIGSNFDVLQMQMKRLEQKLNSFHSDQYDLDKK
QSLRIKEENKNLIQRLNNLEDSLKELEERTQNRLLEEKKEFQQKLIRAEE
EKRRELETVQNRLYKFEGETADFSLEIRRYKDESDKQRAEKHALTEKLTE
SDMRLSSLQEEFDRLRSQGKSLVEKLKIEKESYERILIELNAKSVQQYEK
PQIRIHAMNNLSQRHKELEDLLEKLKAENKALLNQIEESNSEIRERKIKE
NRDMINSTDNLSKELEHCSKEELMDILAKGKDSNFRLRDYIEKIIVKVMD
KNPALLEVGASKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005768endosome
GO:0016020membrane
GO:0030139endocytic vesicle
GO:0030496midbody
GO:0031410cytoplasmic vesicle
GO:0032154cleavage furrow
GO:0055038recycling endosome membrane
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0032465regulation of cytokinesis
GO:0051301cell division
Vocabulary: molecular function
TermDefinition
GO:0017137Rab GTPase binding
GO:0030306ADP-ribosylation factor binding
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
GO:0005509calcium ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR037245FIP-RBD_C_sf
IPR011992EF-hand-dom_pair
IPR019018Rab-bd_FIP-RBD
IPR002048EF_hand_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 252..312
NoneNo IPR availableCOILSCoilCoilcoord: 223..243
NoneNo IPR availableCOILSCoilCoilcoord: 327..393
NoneNo IPR availableCOILSCoilCoilcoord: 408..453
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 3..82
e-value: 5.7E-8
score: 34.8
NoneNo IPR availablePANTHERPTHR15726RAB11-FAMILY INTERACTING PROTEINcoord: 34..511
NoneNo IPR availablePANTHERPTHR15726:SF7NUCLEAR FALLOUT, ISOFORM Jcoord: 34..511
IPR019018Rab-binding domain FIP-RBDPFAMPF09457RBD-FIPcoord: 469..508
e-value: 3.5E-15
score: 55.6
IPR019018Rab-binding domain FIP-RBDPROSITEPS51511FIP_RBDcoord: 447..509
score: 12.578
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 2..37
score: 8.349
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 47..82
score: 6.48
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 4..81
IPR037245FIP-RBD, C-terminal domain superfamilySUPERFAMILYSSF144270Eferin C-derminal domain-likecoord: 458..508