SMED30007150

Overview
NameSMED30007150
Smed IDSMED30007150
Length (bp)6447
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30007150 (SMED30007150) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30007150 (SMED30007150) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30007150 (SMED30007150) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30007150 (SMED30007150) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007150

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30007150SMESG000013347.1 SmedASXL_011802SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30007150SMESG000013347.1 dd_Smed_v4_13323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007150SMESG000013347.1 dd_Smed_v4_13323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007150SMESG000013347.1 dd_Smed_v4_13323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30007150SMESG000013347.1 dd_Smed_v4_13323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30007150SMESG000013347.1 dd_Smed_v4_13323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30007150SMESG000013347.1 dd_Smed_v6_13323_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30007150SMESG000013347.1 dd_Smed_v4_13323_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30007150 vs. Ensembl Human
Match: RTL1 (retrotransposon Gag like 1 [Source:HGNC Symbol;Acc:HGNC:14665])

HSP 1 Score: 68.1662 bits (165), Expect = 2.246e-10
Identity = 48/193 (24.87%), Postives = 92/193 (47.67%), Query Frame = -3
Query: 3881 EKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKED-GTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNT 4456
            +K  F++  + F+G  V+ K ++ NK  ++ I     P S   LR+F+     YR F++ +S+I+ PL      + +   W  E ++ F  LK+   +AP+L +      F ++T  +  A+ A L QI +  G     A+ SRN+   E+ Y     ++L +         ++   R+++ T+   +  +NT
Sbjct:  766 DKSQFHRQTVEFLGFVVTPKGVKLNKNVMTIITGYPTPGSKLSLRNFIEFVFPYRHFVERFSIIAEPLVRQLLSSYQ-FYWGVEEQEAFECLKRAFRKAPLLHHPKPQNPFYLETGVTGTALHASLIQIDDQTGKRACCAFYSRNISPIEVEYSQAEMKILPIRA------AFMVWCRYLENTEEPIMILLNT 951          
BLAST of SMED30007150 vs. Ensembl Human
Match: RTL1 (retrotransposon Gag like 1 [Source:HGNC Symbol;Acc:HGNC:14665])

HSP 1 Score: 68.1662 bits (165), Expect = 2.246e-10
Identity = 48/193 (24.87%), Postives = 92/193 (47.67%), Query Frame = -3
Query: 3881 EKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKED-GTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNT 4456
            +K  F++  + F+G  V+ K ++ NK  ++ I     P S   LR+F+     YR F++ +S+I+ PL      + +   W  E ++ F  LK+   +AP+L +      F ++T  +  A+ A L QI +  G     A+ SRN+   E+ Y     ++L +         ++   R+++ T+   +  +NT
Sbjct:  766 DKSQFHRQTVEFLGFVVTPKGVKLNKNVMTIITGYPTPGSKLSLRNFIEFVFPYRHFVERFSIIAEPLVRQLLSSYQ-FYWGVEEQEAFECLKRAFRKAPLLHHPKPQNPFYLETGVTGTALHASLIQIDDQTGKRACCAFYSRNISPIEVEYSQAEMKILPIRA------AFMVWCRYLENTEEPIMILLNT 951          
BLAST of SMED30007150 vs. Ensembl Zebrafish
Match: FO704673.1 (pep chromosome:GRCz11:12:14545475:14551077:-1 gene:ENSDARG00000112601.1 transcript:ENSDART00000188717.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:FO704673.1)

HSP 1 Score: 133.265 bits (334), Expect = 3.159e-50
Identity = 78/222 (35.14%), Postives = 120/222 (54.05%), Query Frame = -3
Query: 3845 SIHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKED-GTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYL--YRRRFVDRTDHKALKFMNTTKKPISPQLQTW 4501
            ++ T L+ + L    EKC F+ S  +F+G+ +S   ++ N  K+  +     PK+  EL+ FLG  N+YRRFI+NYS+ISAPL +   G    + W  E  K F  LK     APILK+   +  F+++ DAS   +GA+LSQ   + G     AY SR L   E  Y V  KELL++   +  +R +L      F   TDHK L+++ + ++ ++P+   W
Sbjct:  675 TVLTRLQENQLYAKLEKCEFHMSKTSFLGYIISHHGVEMNNTKVQAVTGWPLPKTVKELQRFLGFANFYRRFIRNYSLISAPLTSLLKGKPSKLKWNPETVKSFEKLKTSFTTAPILKHPNPELPFVVEVDASDYGIGAVLSQRHGNPGKLHPCAYFSRKLTAAERNYDVGNKELLSMKAALEEWRHWLEGAVHPFQIITDHKNLEYIKSARR-LNPRQARW 895          

HSP 2 Score: 88.1965 bits (217), Expect = 3.159e-50
Identity = 52/164 (31.71%), Postives = 93/164 (56.71%), Query Frame = -1
Query: 4480 VEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVFTHTLE 4971
            +E  ++  L +G +    SP       + K DG +R C+D+R LN++T K+ +P+P +   L+ L +++I++ +DL  AY  + + E  + K AF T  G + +    +GL+ +PA F   ++++ + ++ K V+ Y+DDILIY+ N E H K +  V T   E
Sbjct:  519 METYIEEALSSGYIRPSTSPAAAGFFFIEKKDGGLRPCIDYRGLNNITVKYRYPLPLVPPALEQLREARIYTKLDLRSAYNLIRIREGDEWKTAFLTTRGHYEYLVMPYGLANSPAVFQSFINEVFRDLLNKCVIAYIDDILIYSPNLEQHIKDVRTVLTRLQE 682          
BLAST of SMED30007150 vs. Ensembl Zebrafish
Match: BX511082.1 (pep chromosome:GRCz11:9:14291932:14297132:1 gene:ENSDARG00000113678.1 transcript:ENSDART00000183119.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511082.1)

HSP 1 Score: 124.79 bits (312), Expect = 8.884e-49
Identity = 73/208 (35.10%), Postives = 109/208 (52.40%), Query Frame = -3
Query: 3872 LRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQ-IKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRR--RFVDRTDHKALKFMNTTKK 4486
            L  +GL V  EKC F+   + F+GH VS + ++ +  K+  + +   P S   L+ FLG  N+YRRFI+N+S ++APL A T+       W+   +  F  LK     APIL       QF+++ DAS   +GAILSQ    DG     AY S  L   E  Y +  +ELLA+   +  +R +L      F+  TDHK L+++ + K+
Sbjct:  701 LLENGLYVKAEKCVFHAQSVPFLGHIVSVEGMRMDPEKVQAVVDWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTALTSLKTPF-RWSNAAQVAFDRLKSCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSSSDGKMHPCAYFSHRLNNAEQNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEYIQSAKR 907          

HSP 2 Score: 92.0485 bits (227), Expect = 8.884e-49
Identity = 61/178 (34.27%), Postives = 98/178 (55.06%), Query Frame = -1
Query: 4480 LQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVFTHTLE 5013
            L  P R+ M      E+ + + L A ++    SP       V K DGS+R C+D+R LN++T K ++P+P M    + L  +  F+ +DL  AY+ V + E  + K AF+T  G F +    FGLS APA F  L++ +L+ ++ + + VYLDDILI++ + + H + +  V    LE
Sbjct:  532 LSVPEREAM------EKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNAITVKNTYPLPLMSSAFERLQGASFFTKLDLRNAYHLVRIREGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMLDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLE 703          
BLAST of SMED30007150 vs. Ensembl Zebrafish
Match: BX546500.1 (pep chromosome:GRCz11:23:12926092:12931693:-1 gene:ENSDARG00000086495.3 transcript:ENSDART00000122176.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX546500.1)

HSP 1 Score: 124.405 bits (311), Expect = 3.102e-48
Identity = 75/209 (35.89%), Postives = 110/209 (52.63%), Query Frame = -3
Query: 3872 LRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIV-WTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQ-IKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRR--RFVDRTDHKALKFMNTTKK 4486
            L  +GL V  EKC F+   + F+GH VS + ++ +  KI  + +   P S   L+ FLG  N+YRRFI+N+S ++APL + T+   KM   W+      F  LK     APIL       QF+++ DAS   +GAILSQ    DG     AY S  L   E  Y +  +ELLA+   +  +R +L      F+  TDHK L+++ + K+
Sbjct:  675 LLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVDWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTSLTS--SKMPFRWSSAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSSSDGKIHPCAYFSHRLSPAERNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEYIRSAKR 881          

HSP 2 Score: 90.1225 bits (222), Expect = 3.102e-48
Identity = 62/178 (34.83%), Postives = 97/178 (54.49%), Query Frame = -1
Query: 4480 LQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVFTHTLE 5013
            L  P R+ M      E+ + + L A ++    SP       V K DGS+R C+D+R LNS+T K ++P+P M    + L  +  F+ +DL  AY+ V +    + K AF+T  G F +    FGLS APA F  L++ +L+ +I + + VYLDDILI++ + + H + +  V    LE
Sbjct:  506 LSVPEREAM------EKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLE 677          
BLAST of SMED30007150 vs. Ensembl Zebrafish
Match: BX890543.1 (pep chromosome:GRCz11:14:42224893:42231293:-1 gene:ENSDARG00000114583.1 transcript:ENSDART00000185486.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX890543.1)

HSP 1 Score: 122.865 bits (307), Expect = 3.178e-48
Identity = 73/212 (34.43%), Postives = 111/212 (52.36%), Query Frame = -3
Query: 3845 LKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIK-EDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYL--YRRRFVDRTDHKALKFMNTTKKPISPQLQTW 4471
            L V  EKC F+   + F+G  +S  EIQ +  KI  +     P S   L+ FLG  N+YRRFI+N+  I+APL A T+       W  + ++ F  LK     AP+L     + QFI++ DAS   +GA+LSQ    DG     A+ S  L   E  Y V  +ELLA+   +  +R +L    + F+  TDHK L+++ + ++ ++P+   W
Sbjct:  695 LYVKAEKCVFHAQSIPFLGFIISAGEIQADPCKIRAVAEWPTPDSRKALQRFLGFANFYRRFIRNFGQIAAPLTALTSPK-VWFKWNSDAQEAFDELKSRFVSAPVLSIPDPEQQFIVEVDASDVGVGAVLSQRSCLDGKVHPCAFFSHRLNPSERNYDVGNRELLAVRLALGEWRHWLEGAAQPFLVWTDHKNLEYIRSARR-LTPRQARW 904          

HSP 2 Score: 91.6633 bits (226), Expect = 3.178e-48
Identity = 61/178 (34.27%), Postives = 97/178 (54.49%), Query Frame = -1
Query: 4480 LQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVFTHTLE 5013
            L  P R+ M      +  +   L+ G++    SP       V K DGS+R C+D+R LN +T K  +P+P M    + L  +K+F+ +DL  AY+ V + E  + K AF+T  G F +    FGL+ APA F  L++ +L+ ++ + V VYLDDILI++   + H + + +V    LE
Sbjct:  521 LSGPEREAM------DRYINESLKTGLIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNDITVKNRYPLPLMSSAFELLQGAKVFTKLDLRNAYHLVRIREGDEWKTAFNTPTGHFEYRVLPFGLTNAPAVFQALVNDVLRDMVNRFVFVYLDDILIFSPCLQIHIQHVRQVLQRLLE 692          
BLAST of SMED30007150 vs. Ensembl Zebrafish
Match: BX511224.1 (pep chromosome:GRCz11:2:18017000:18022765:1 gene:ENSDARG00000113243.1 transcript:ENSDART00000186877.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511224.1)

HSP 1 Score: 125.561 bits (314), Expect = 3.179e-48
Identity = 74/208 (35.58%), Postives = 107/208 (51.44%), Query Frame = -3
Query: 3872 LRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQ-IKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRR--RFVDRTDHKALKFMNTTKK 4486
            L  +GL V  EKC F+   + F+GH VS + ++ +  KI  + N   P S   L+ FLG  N+YRRFI N+S ++APL + T+       W+      F  LK     APIL       QF+++ DAS   +GAILSQ    DG     AY S  L   E  Y +  +ELLA+   +  +R +L      F+  TDHK L+++ + K+
Sbjct:  701 LLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFLGFANFYRRFIHNFSQLAAPLTSLTSSKTPF-RWSSAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSASDGKVHPCAYFSHRLSSAERNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEYIKSAKR 907          

HSP 2 Score: 89.3521 bits (220), Expect = 3.179e-48
Identity = 62/178 (34.83%), Postives = 97/178 (54.49%), Query Frame = -1
Query: 4480 LQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVFTHTLE 5013
            L  P R+ M      E+ + + L A ++    SP       V K DGS+R C+D+R LNS+T K ++P+P M    + L  +  F+ +DL  AY+ V +    + K AF+T  G F +    FGLS APA F  L++ +L+ +I + + VYLDDILI++ + + H + +  V    LE
Sbjct:  532 LSVPEREAM------EKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVCIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHIQHVRRVLQRLLE 703          
BLAST of SMED30007150 vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 140.584 bits (353), Expect = 2.012e-62
Identity = 74/237 (31.22%), Postives = 122/237 (51.48%), Query Frame = -3
Query: 3791 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATT-GNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLSNTILRYNI*IEKY 4498
            +   ++++GL + PEKC    + + ++GH V   +++ +  K+  I     PK+  ++ +FLG   YYR+FI NYS ++ PL   T+    + IVWT EC      LK+ L  +P+L       +FI+ TDAS   +GA+LSQ+   G E  +AY SR L   E  Y    KE LA+   +   + YLY R F   TDH  L ++              ++  +  +LR+++ +++Y
Sbjct:  509 VFAQIQDAGLTLKPEKCHLAMAEVQYLGHRVGGGQLRPDPAKVEAICQWPIPKTQKQVLAFLGTSGYYRKFIPNYSTVAKPLTDLTSRQRSRTIVWTPECESAMNALKQALASSPVLAAPDFSRRFILQTDASNFGLGAVLSQVNTYGEEHPVAYLSRKLLPREAAYATIEKECLAIVWALQKLQPYLYGREFTVVTDHNPLSWLQR------------VSGDNGKLLRWSLLLQQY 733          

HSP 2 Score: 122.094 bits (305), Expect = 2.012e-62
Identity = 72/243 (29.63%), Postives = 125/243 (51.44%), Query Frame = -1
Query: 4600 LELNVIIVGKIHLDFIGGVDSIKIFGMQLKEVNNIESSLVNKRFTDSDRLKIMFLTLKLDKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSDPPILQNPRRQPMH-----LEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQ 5313
            + +N++    I  D +  + S  + G     + N+     + R  D+  +      L L +  +L  ++  +S +F A   + G T    H++ T      Q P R P +     +  +++  +  +L  GV++   SPW +P+V+V K DGS R C+D+R LN VT   ++PMP +  LLD LG +K  +++DL + Y+Q+ L  ++Q K AF T  G + F    FG+  APATF +L+++
Sbjct:  244 VHINMMKPYHIREDIVSAICSAPVEGTDDPPIPNLIEEATSARGIDAVTISDH---LHLSQQDQLRKILRSYSPMFSA---NPGRTHWAEHKVDTG----TQLPIRSPAYRVAEAVRPEMKSQIDEMLAFGVITPSHSPWASPVVLVPKKDGSTRFCVDYRRLNDVTTTDAYPMPRVDELLDRLGNAKYLTTLDLSRGYWQIPLAPSAQEKSAFLTPFGLYQFTVMPFGMRNAPATFQRLVNR 476          
BLAST of SMED30007150 vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.887 bits (346), Expect = 9.116e-59
Identity = 85/244 (34.84%), Postives = 126/244 (51.64%), Query Frame = -3
Query: 3827 LRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPL------YAATTGNDKMIV-----------------WTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVH-FRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLSN 4486
            L   GLK++PEKC F +  +N++GH VS + I T+  KI  + +  +P++ TELRSFLG   YYRRF+K +S ++ PL           G+D+ I+                 WTEEC K F  LK  L  AP+L Y+ A   + +  DAS   +G IL Q + +     +A+ SR+L   E  Y   + E LAL   +V    +YLY   F  +TD+  L ++ TT K +      W+A L++
Sbjct:  503 LEKEGLKLSPEKCQFCQPSVNYVGHVVSAEGIATDPSKIEAVSSWPKPRTITELRSFLGFCGYYRRFVKGFSKVAQPLNQLLQSNTEVEGSDRDILAKRLRGQGWTRESIEDFWTEECDKAFDQLKYCLTHAPVLAYADATKPYTLHIDASREGLGGILYQ-EYNKELRPVAFISRSLSPSERNYPAHKLEFLALKWAVVDKLHEYLYGAEFEVQTDNNPLTYILTTAK-LDATGHRWLAALAH 744          

HSP 2 Score: 112.464 bits (280), Expect = 9.116e-59
Identity = 75/213 (35.21%), Postives = 122/213 (57.28%), Query Frame = -1
Query: 4495 SKLGTLIYQFSNIFMASRFDLGHTKVITHEIK-TSDPPILQNPRR-QPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVF 5127
            S+L   + + S +F  +  D+G +    H+I+   D P  +  RR  P  LE  + + ++ L  AG++ + +SP+ +P+V+V K +GSIRMC+D+R LN  T    +  P ++  L+ L  SK FS +DL   YYQ+ ++   + K AF    G F FNR   GL  APATF +LM + +  + +  V+VYLDD++++    E H++ L +VF
Sbjct:  289 SRLRKHLNEHSALFSRNDLDMGCSTSTKHKIRLREDKPFRERSRRIAPGDLE-DLRKHLEELKAAGIIKESRSPYASPIVVVRKKNGSIRMCVDYRTLNQRTIPDQYTTPRIEDALNCLVGSKWFSVLDLRSGYYQLPMHPEDKEKTAFICPLGFFEFNRMPQGLCGAPATFQRLMERTVGDMHLLEVLVYLDDLIVFGRTLEEHEQRLLKVF 500          
BLAST of SMED30007150 vs. Ensembl Xenopus
Match: ENSXETT00000035398.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:9869556:9871940:-1 gene:ENSXETG00000011182.1 transcript:ENSXETT00000035398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 5.520e-43
Identity = 65/210 (30.95%), Postives = 102/210 (48.57%), Query Frame = -3
Query: 3872 THLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQ-IKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYL--YRRRFVDRTDHKALKFMNTTKK 4492
            + LR + L    EKC F    ++F+G+ +S +  + +  K+S I+    P+ST  ++ F+G  NYYR+FIK +S   AP+ +      +   W     + F +LK     A +L++      F I+ DAS    GAILSQ    DG     AY S+     E  Y +  +ELLA+   +  +R  L          TDHK L+F+ + K+
Sbjct:  177 SRLRENSLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKGFSSRIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDASDVGAGAILSQRHSADGKLHPCAYFSKKFSSAEQNYDIGNRELLAVKLALEEWRHLLEGASHPVTIYTDHKNLEFLQSLKR 386          

HSP 2 Score: 91.6633 bits (226), Expect = 5.520e-43
Identity = 61/166 (36.75%), Postives = 94/166 (56.63%), Query Frame = -1
Query: 4480 AKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVFTHTLE 4977
            A ++E +   L+ G +    SP       V K DG +R C+D+R LN +T K  +P+P +  L D L  +KIFS +DL  AY  + + E  + K AF+T++G + +    FGL  APA F + ++ I + ++ K VVVYLDDILI++ + ETH   + E  +   E
Sbjct:   16 AAMKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRE 181          
BLAST of SMED30007150 vs. Ensembl Xenopus
Match: ENSXETT00000034712.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:33567219:33572531:-1 gene:ENSXETG00000011772.1 transcript:ENSXETT00000034712.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 1.338e-42
Identity = 65/210 (30.95%), Postives = 103/210 (49.05%), Query Frame = -3
Query: 3872 THLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQI-KEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYL--YRRRFVDRTDHKALKFMNTTKK 4492
            + LR + L    EKC F    ++F+G+ +S +  + +  K+S I+    P+ST  ++ F+G  NYYR+FIK++S   AP+ +      +   W     + F +LK     A +L++      F I+ DAS    GAILSQ    DG     AY S+     E  Y +  +ELLA+   +  +R  L          TDHK L+F+ + K+
Sbjct:  695 SRLRENFLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKDFSSRIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDASDVGAGAILSQRHSADGKLHPCAYFSKKFSSAEQNYDIGNRELLAVKLALEEWRHLLEGASHPVTIYTDHKNLEFLQSLKR 904          

HSP 2 Score: 91.2781 bits (225), Expect = 1.338e-42
Identity = 61/166 (36.75%), Postives = 94/166 (56.63%), Query Frame = -1
Query: 4480 AKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVFTHTLE 4977
            A ++E +   L+ G +    SP       V K DG +R C+D+R LN +T K  +P+P +  L D L  +KIFS +DL  AY  + + E  + K AF+T++G + +    FGL  APA F + ++ I + ++ K VVVYLDDILI++ + ETH   + E  +   E
Sbjct:  534 AAMKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRE 699          
BLAST of SMED30007150 vs. Ensembl Xenopus
Match: ENSXETT00000042189.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460667.1:82848:87648:1 gene:ENSXETG00000017765.1 transcript:ENSXETT00000042189.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 1.466e-42
Identity = 65/210 (30.95%), Postives = 103/210 (49.05%), Query Frame = -3
Query: 3872 THLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQ-IKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYL--YRRRFVDRTDHKALKFMNTTKK 4492
            + LR + L    EKC F    ++F+G+ +S +  + +  K+S I+    P+ST  ++ F+G  NYYR+FIK++S   AP+ +      +   W     + F +LK     A +L++      F I+ DAS    GAILSQ    DG     AY S+     E  Y +  +ELLA+   +  +R  L          TDHK L+F+ + K+
Sbjct:  695 SRLRENFLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKDFSSHIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFIEVDASDVGAGAILSQRHSADGKLHPCAYFSKKFSSAEQNYDIGNRELLAVKLALEEWRHLLEGASHPVTIYTDHKNLEFLQSLKR 904          

HSP 2 Score: 91.2781 bits (225), Expect = 1.466e-42
Identity = 61/166 (36.75%), Postives = 94/166 (56.63%), Query Frame = -1
Query: 4480 AKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVFTHTLE 4977
            A ++E +   L+ G +    SP       V K DG +R C+D+R LN +T K  +P+P +  L D L  +KIFS +DL  AY  + + E  + K AF+T++G + +    FGL  APA F + ++ I + ++ K VVVYLDDILI++ + ETH   + E  +   E
Sbjct:  534 AAMKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRE 699          
BLAST of SMED30007150 vs. Ensembl Mouse
Match: Rtl1 (retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:MGI:2656842])

HSP 1 Score: 63.929 bits (154), Expect = 3.319e-9
Identity = 47/193 (24.35%), Postives = 91/193 (47.15%), Query Frame = -3
Query: 3881 EKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQI-KEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNT 4456
            +K  F++     +G  +S K ++ NK  ++ I     P S   L+S + L   YR F++N+++I+APL      ++    W EE ++   +LK+   ++P+L +      F ++TD +   + A L Q   E G +   A+ SR L   E+ Y      +L +         ++   R+++ T+   +  +NT
Sbjct: 1027 DKTQFHRQTAEILGFNISPKGVKLNKNLMNLIVGCPVPGSRRCLQSVIDLVYPYRHFVENFAVIAAPLVRQLLSSEP-YYWGEEEQEALESLKRAFRKSPVLYHPKPQNPFYLETDITGSFLSASLVQTDDETGKKSTCAFYSRPLSTMEVEYPRVEMRILPIR------AAFMVWCRYLENTEEPIMILLNT 1212          
BLAST of SMED30007150 vs. Ensembl Mouse
Match: Rtl1 (retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:MGI:2656842])

HSP 1 Score: 63.929 bits (154), Expect = 3.319e-9
Identity = 47/193 (24.35%), Postives = 91/193 (47.15%), Query Frame = -3
Query: 3881 EKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQI-KEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNT 4456
            +K  F++     +G  +S K ++ NK  ++ I     P S   L+S + L   YR F++N+++I+APL      ++    W EE ++   +LK+   ++P+L +      F ++TD +   + A L Q   E G +   A+ SR L   E+ Y      +L +         ++   R+++ T+   +  +NT
Sbjct: 1027 DKTQFHRQTAEILGFNISPKGVKLNKNLMNLIVGCPVPGSRRCLQSVIDLVYPYRHFVENFAVIAAPLVRQLLSSEP-YYWGEEEQEALESLKRAFRKSPVLYHPKPQNPFYLETDITGSFLSASLVQTDDETGKKSTCAFYSRPLSTMEVEYPRVEMRILPIR------AAFMVWCRYLENTEEPIMILLNT 1212          
BLAST of SMED30007150 vs. UniProt/SwissProt
Match: sp|P20825|POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 9.299e-58
Identity = 80/223 (35.87%), Postives = 122/223 (54.71%), Query Frame = -3
Query: 3830 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLS 4498
            + T L ++ LK+  +KC F K   NF+GH V+   I+ N  K+  I +   P    E+R+FLGL  YYR+FI NY+ I+ P+ +      K+     E  + F  LK L+   PIL+    + +F++ TDAS  A+GA+LSQ         I++ SR L  HE+ Y    KELLA+      FR YL  R+F+  +DH+ L++++  K+P   +L+ W   LS
Sbjct:  384 VFTKLADANLKLQLDKCEFLKKEANFLGHIVTPDGIKPNPIKVKAIVSYPIPTKDKEIRAFLGLTGYYRKFIPNYADIAKPMTSCLKKRTKIDTQKLEYIEAFEKLKALIIRDPILQLPDFEKKFVLTTDASNLALGAVLSQ-----NGHPISFISRTLNDHELNYSAIEKELLAIVWATKTFRHYLLGRQFLIASDHQPLRWLHNLKEP-GAKLERWRVRLS 600          

HSP 2 Score: 114.775 bits (286), Expect = 9.299e-58
Identity = 69/182 (37.91%), Postives = 103/182 (56.59%), Query Frame = -1
Query: 4603 KLGTLIYQFSNIFMASRFDLGHTKVITHEIKTS-DPPIL--QNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTP-LVIVGKPDGS----IRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMH 5124
            KL  L+ +F N+       L  T  I H + T+ + PI   Q P  Q   +E  VE  VQ +L  G++ +  SP+N+P  V+  KPD S     R+ +D+R LN +T    +P+P M  +L  LGK + F++IDL + ++Q+E++E S  K AFSTK G + + R  FGL  APATF + M+
Sbjct:  170 KLKGLLNKFRNLEYKEGEKLTFTNTIKHVLNTTHNSPIYSKQYPLAQTHEIE--VENQVQEMLNQGLIRESNSPYNSPTWVVPKKPDASGANKYRVVIDYRKLNEITIPDRYPIPNMDEILGKLGKCQYFTTIDLAKGFHQIEMDEESISKTAFSTKSGHYEYLRMPFGLRNAPATFQRCMN 349          
BLAST of SMED30007150 vs. UniProt/SwissProt
Match: sp|P04323|POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 5.404e-54
Identity = 82/219 (37.44%), Postives = 114/219 (52.05%), Query Frame = -3
Query: 3830 LRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLS 4486
            L  + LK+  +KC F K    F+GH ++   I+ N  KI  I+    P    E+++FLGL  YYR+FI N++ I+ P+      N K+     E    F  LK L+ E PILK      +F + TDAS  A+GA+LSQ   DG    ++Y SR L +HE+ Y    KELLA+      FR YL  R F   +DH+ L ++   K P S +L  W   LS
Sbjct:  389 LAKANLKLQLDKCEFLKQETTFLGHVLTPDGIKPNPEKIEAIQKYPIPTKPKEIKAFLGLTGYYRKFIPNFADIAKPMTKCLKKNMKIDTTNPEYDSAFKKLKYLISEDPILKVPDFTKKFTLTTDASDVALGAVLSQ---DG--HPLSYISRTLNEHEINYSTIEKELLAIVWATKTFRHYLLGRHFEISSDHQPLSWLYRMKDPNS-KLTRWRVKLS 601          

HSP 2 Score: 107.071 bits (266), Expect = 5.404e-54
Identity = 60/183 (32.79%), Postives = 97/183 (53.01%), Query Frame = -1
Query: 4603 DKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSDPPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIV-GKPDGS----IRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMH 5136
            ++  +L  L+ ++ +I       L  T    H I T     L +    P   E +VE  +Q++L  G++    SP+N+P+ +V  K D S     R+ +D+R LN +T     P+P M  +L  LG+   F++IDL + ++Q+E++  S  K AFSTK G + + R  FGL  APATF + M+
Sbjct:  168 EEKQRLCALLQKYHDIQYHEGDKLTFTNQTKHTINTKHNLPLYSKYSYPQAYEQEVESQIQDMLNQGIIRTSNSPYNSPIWVVPKKQDASGKQKFRIVIDYRKLNEITVGDRHPIPNMDEILGKLGRCNYFTTIDLAKGFHQIEMDPESVSKTAFSTKHGHYEYLRMPFGLKNAPATFQRCMN 350          
BLAST of SMED30007150 vs. UniProt/SwissProt
Match: sp|P10394|POL4_DROME (Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster OX=7227 GN=POL PE=4 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 1.002e-53
Identity = 78/207 (37.68%), Postives = 114/207 (55.07%), Query Frame = -3
Query: 3863 RNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPIS 4483
            R   LK++PEKC+F    + F+GH  ++K I  + +K   I+N   P      R F+   NYYRRFIKN++  S  +      N     WT+EC+K FI+LK  L    +L+Y     +F I TDAS +A GA+L+Q   +G +  +AY SR   K E     T +EL A+H  I+HFR Y+Y + F  +TDH+ L ++ +   P S
Sbjct:  498 REYNLKLHPEKCSFFMHEVTFLGHKCTDKGILPDDKKYDVIQNYPVPHDADSARRFVAFCNYYRRFIKNFADYSRHITRLCKKNVPF-EWTDECQKAFIHLKSQLINPTLLQYPDFSKEFCITTDASKQACGAVLTQ-NHNGHQLPVAYASRAFTKGESNKSTTEQELAAIHWAIIHFRPYIYGKHFTVKTDHRPLTYLFSMVNPSS 702          

HSP 2 Score: 92.0485 bits (227), Expect = 1.002e-53
Identity = 49/146 (33.56%), Postives = 81/146 (55.48%), Query Frame = -1
Query: 4606 DPPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGK---PDGS---IRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLM 5025
            D P+     R P     +++  VQ L++  +V    S +N+PL++V K   P+      R+ +D+R +N       FP+P +  +LD LG++K FS +DL   ++Q+EL+E S+   +FST  G + F R  FGL  AP +F ++M
Sbjct:  312 DEPVYTKNYRSPHSQVEEIQAQVQKLIKDKIVEPSVSQYNSPLLLVPKKSSPNSDKKKWRLVIDYRQINKKLLADKFPLPRIDDILDQLGRAKYFSCLDLMSGFHQIELDEGSRDITSFSTSNGSYRFTRLPFGLKIAPNSFQRMM 457          

HSP 3 Score: 23.483 bits (49), Expect = 1.002e-53
Identity = 9/24 (37.50%), Postives = 17/24 (70.83%), Query Frame = -2
Query: 3759 QYNFALQYINREVHGNADDMSRLT 3830
            +YNF ++Y+  + +  AD +SR+T
Sbjct:  713 EYNFTVEYLKGKDNHVADALSRIT 736          
BLAST of SMED30007150 vs. UniProt/SwissProt
Match: sp|Q8I7P9|POL5_DROME (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.413e-50
Identity = 73/210 (34.76%), Postives = 111/210 (52.86%), Query Frame = -3
Query: 3890 LRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTG----------NDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVD-RTDHKALKF 4486
            L  + L+VN EK  F  + + F+G+ V+   I+ + +K+  I     P S  EL+ FLG+ +YYR+FI++Y+ ++ PL   T G          +   I   E   + F +LK +LC + IL +      F + TDAS  A+GA+LSQ  + G +  IAY SR+L K E  Y    KE+LA+   + + R YLY    +   TDH+ L F
Sbjct:  305 LSKANLQVNLEKSHFLDTQVEFLGYIVTADGIKADPKKVRAISEMPPPTSVKELKRFLGMTSYYRKFIQDYAKVAKPLTNLTRGLYANIKSSQSSKVPITLDETALQSFNDLKSILCSSEILAFPCFTKPFHLTTDASNWAIGAVLSQ-DDQGRDRPIAYISRSLNKTEENYATIEKEMLAIIWSLDNLRAYLYGAGTIKVYTDHQPLTF 513          

HSP 2 Score: 109.383 bits (272), Expect = 1.413e-50
Identity = 72/211 (34.12%), Postives = 120/211 (56.87%), Query Frame = -1
Query: 4507 LGTLIYQFSNIFMASRFDLGHTKVITHEIKT-SDPPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGK---PDGS--IRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFL 5121
            L +L+ +F  IF      +     +  EI+T +  PI       P+++  +VE  +  LL+ G++    SP+N+P+ IV K   P+G    RM +DF+ LN+VT   ++P+P +   L  LG +K F+++DL   ++Q+ + E+   K AFST  G++ F R  FGL  APA F +++  IL+  I K   VY+DDI++++ + +TH K L
Sbjct:   88 LNSLLGEFPRIFEPPLSGMSVETAVKAEIRTNTQDPIYAKSYPYPVNMRGEVERQIDELLQDGIIRPSNSPYNSPIWIVPKKPKPNGEKQYRMVVDFKRLNTVTIPDTYPIPDINATLASLGNAKYFTTLDLTSGFHQIHMKESDIPKTAFSTLNGKYEFLRLPFGLKNAPAIFQRMIDDILREHIGKVCYVYIDDIIVFSEDYDTHWKNL 298          
BLAST of SMED30007150 vs. UniProt/SwissProt
Match: sp|Q99315|YG31B_YEAST (Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3)

HSP 1 Score: 108.997 bits (271), Expect = 2.573e-48
Identity = 53/152 (34.87%), Postives = 90/152 (59.21%), Query Frame = -1
Query: 4606 ITHEIKTSDPPILQNPRRQPMHL----EAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLM 5049
            + H+I+    P  + PR QP H+    E ++ ++VQ LL+   +   +SP ++P+V+V K DG+ R+C+D+R LN  T    FP+P +  LL  +G ++IF+++DL   Y+Q+ +    + K AF T  G++ +    FGL  AP+TF + M
Sbjct:  584 VKHDIEIK--PGARLPRLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYM 733          

HSP 2 Score: 108.997 bits (271), Expect = 2.573e-48
Identity = 67/220 (30.45%), Postives = 114/220 (51.82%), Query Frame = -3
Query: 3830 LRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIK-EDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLS 4486
            L+N  L V  +KC F      F+G+++  ++I   + K + I +   PK+  + + FLG+ NYYRRFI N S I+ P+        +   WTE+  K    LK  LC +P+L        + + TDAS   +GA+L ++  ++    V+ Y S++L+  +  Y     ELL + + + HFR  L+ + F  RTDH +L  +    +P   ++Q W+ +L+
Sbjct:  771 LKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPIQLFICDKSQ---WTEKQDKAIDKLKDALCNSPVLVPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPAR-RVQRWLDDLA 986          
BLAST of SMED30007150 vs. TrEMBL
Match: W4XDF9 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.086e-87
Identity = 99/223 (44.39%), Postives = 141/223 (63.23%), Query Frame = -3
Query: 3830 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLS 4498
            +   L+N+GLK+ PEKC   +  + F+GH VS + + T+  K+  I     P+S  E+RSFLGL +YYRR+I+ ++ I+ PL+  T    +   W E C   F  LK+ L  +PIL Y     +FI+DTDAS   +GA+LSQ++E GTE V+ Y SR+L K E  YCVTR+ELLA+  FI +FRQYLY R+F  RTDH AL+++ + K+P   Q+  W+  L 
Sbjct:  457 VFEQLKNAGLKLKPEKCHLFQQSVAFLGHVVSPEGVATDPAKVKSIREWPTPQSVREVRSFLGLASYYRRYIQGFANIAKPLHKLTE-KKRQYHWDESCESAFSMLKEKLTSSPILAYPTDGDEFILDTDASDVGIGAVLSQVQE-GTERVVGYASRSLSKPERNYCVTRRELLAVVHFIKYFRQYLYGRKFTVRTDHGALRWLLSFKEPEG-QVARWLQVLG 676          

HSP 2 Score: 155.606 bits (392), Expect = 1.086e-87
Identity = 90/241 (37.34%), Postives = 136/241 (56.43%), Query Frame = -1
Query: 4603 KIFLELNVIIVGKIHLDFIGGVDSIKIFGMQLKEVNNIESSLVNKRFTDSDRLKIMFLTLKLDKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSDP-PILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMH 5322
            KI+    V ++  I ++  G    I+   ++ K  + ++   V +   D  +     L  K +K   L  L+ +F + F  S  DLG T +I H I T D  PI Q PRR P   +A+ +E V+ +L+ GVV    SPW++P+V+V K DGS R C+D+R LN VT K ++P+P +   +  L  +K FS++DL   Y+QVEL+E ++ K AFST+ G F +N   FGL  AP+TF +LM 
Sbjct:  185 KIYKGTRVGMMKPIQMNCGGIERGIRNLSLEQKREDYVDEQ-VPEYLKDLAQRSCEHLDGKQEK--ALIALLREFKDTFAKSDSDLGRTGLIKHHIPTKDAAPIRQPPRRLPKWQQAEADEQVRKMLDRGVVEPSCSPWSSPVVLVKKKDGSTRFCVDYRRLNDVTIKDAYPIPRIDDTIQSLAGAKWFSTLDLASGYWQVELDEEAKGKSAFSTRMGLFQWNVMPFGLCNAPSTFERLME 422          

HSP 3 Score: 26.5646 bits (57), Expect = 1.086e-87
Identity = 14/40 (35.00%), Postives = 20/40 (50.00%), Query Frame = -2
Query: 3711 QYNFALQYINREVHGNADDMSRLTNTICSYCQMGHKDAKE 3830
            +YNF + +     H NAD +SR+    C  C  G  D +E
Sbjct:  677 EYNFVIVHRAGRSHANADGLSRIP---CRQC--GRTDGEE 711          
BLAST of SMED30007150 vs. TrEMBL
Match: A0A087SUZ9 (Retrovirus-related Pol polyprotein from transposon 412 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_16630 PE=4 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 3.940e-85
Identity = 98/218 (44.95%), Postives = 140/218 (64.22%), Query Frame = -3
Query: 3833 LRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANL 4486
            L+ + LK++P KC   +  + ++GH +S + ++T+  K+S +++   P++  +LRSFLGL  YYRRF+K++S I+ PL+  T    K  VWT+EC   F NLK+ L  APIL Y   D  FI+DTDAS  ++GA+LSQ  E G E V+AY S+ L K E  YCVTRKELLA+ + + HF  YLY R+F+ RTDH +L ++   K P   Q+  WI  L
Sbjct:  847 LKEANLKLSPAKCKLFRQEVTYLGHVISAEGVRTDPEKVSAVKDWRRPENVHQLRSFLGLCTYYRRFVKDFSSIARPLHKLTESKQKF-VWTKECENAFKNLKEALTSAPILTYPQLDRPFILDTDASNESVGAVLSQEIE-GQERVVAYWSKCLSKPERNYCVTRKELLAIVKAVEHFHHYLYGRKFLLRTDHASLAWLLNFKNP-EGQIARWIQRL 1061          

HSP 2 Score: 154.066 bits (388), Expect = 3.940e-85
Identity = 73/171 (42.69%), Postives = 109/171 (63.74%), Query Frame = -1
Query: 4603 LIYQFSNIFMASRFDLGHTKVITHEIKTSD-PPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMH 5112
            +I    ++F  S  D+G T +  H I T D PPI Q+PRR P+  + +V  L++++ E+ V+    SPW +P+V+V K DGS R C+D+R LN VT+K S+P+P +  +LD L  SK FS++DL   Y+QVE++ + + K AF+T +G + F    FGL  APATF +LM 
Sbjct:  638 VIKDLQDVFSRSSSDVGRTSLTQHRIDTGDHPPIKQHPRRLPIAKQEEVRALLKDMQESNVIEPSASPWASPIVLVRKKDGSTRFCVDYRRLNEVTKKDSYPLPRIDDILDTLSGSKWFSTLDLKSGYWQVEIHPDDREKTAFTTGQGLWQFKVMPFGLCNAPATFERLME 808          

HSP 3 Score: 24.6386 bits (52), Expect = 3.940e-85
Identity = 11/32 (34.38%), Postives = 18/32 (56.25%), Query Frame = -2
Query: 3738 QYNFALQYINREVHGNADDMSRL-TNTICSYC 3830
            +Y+  +++   + HGNAD +SR      C YC
Sbjct: 1063 EYDITIRHRKGQSHGNADALSRRPCPENCRYC 1094          
BLAST of SMED30007150 vs. TrEMBL
Match: A0A4Y2LHW1 (Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ventricosus OX=182803 GN=TY3B-I_185 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 5.730e-85
Identity = 100/223 (44.84%), Postives = 142/223 (63.68%), Query Frame = -3
Query: 3833 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEE-VIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANL 4498
            +   L+ + LK++P+KC F +  + ++GH +S + ++T+  KI  + +   P++  ++RSFLGL  YYRRF+KN+S I+ PL+  T        WTEEC K F +LK+ L  +PIL Y   D  FI+DTDAS   MGA+LSQ    G EE VIAY S++L K E  YCVTRKELLA+ + I HF  YLY R+F+ RTDH +L+++   K+P   Q+  WI  L
Sbjct:  699 VFQRLQKANLKLSPKKCRFFQKEVTYLGHVISAEGVKTDPGKIKAVVDWPRPETVHDVRSFLGLCTYYRRFVKNFSTIARPLHKLTEAKSN-FNWTEECEKSFNSLKQALTSSPILTYPRTDKDFILDTDASNEGMGAVLSQ--NTGNEERVIAYFSKSLGKPERNYCVTRKELLAIVKSIEHFHHYLYGRKFLLRTDHASLRWLLNFKEP-EGQIARWIQRL 917          

HSP 2 Score: 150.599 bits (379), Expect = 5.730e-85
Identity = 85/236 (36.02%), Postives = 141/236 (59.75%), Query Frame = -1
Query: 4495 KRFTDSDRLKIMFLTLKL---DKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSD-PPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVF 5190
            + F+++  L  +  +L++    +  ++  L+ +F N+F     D+GH  +  H I T D PPI Q PRR P+  + + + LV+++++ G++ +   PW TP+V+V K DGS R C+D+R LN +T+K S+P+P +   LD L  S+ F+++DL   Y+QVE+    + K AF+T +G + F    FG+   PATF +LM  +L+G+  +  +VYLDDI+I     E H   L +VF
Sbjct:  465 QEFSEAQHLSSILESLEMLNEKQRREVRKLLKEFQNLFSTCDADVGHCNMTQHRINTGDHPPIKQYPRRLPLSRKEEADHLVKDMVDNGIIEESSGPWATPIVLVKKKDGSTRFCVDYRKLNEITKKDSYPLPRIDDALDALNGSQWFTTLDLKSGYWQVEIRPEDREKTAFTTGQGLWQFKVMPFGMPFTPATFERLMETVLRGLTSEACLVYLDDIIIVGRTFEEHLNNLRKVF 700          

HSP 3 Score: 30.0314 bits (66), Expect = 5.730e-85
Identity = 19/54 (35.19%), Postives = 30/54 (55.56%), Query Frame = -2
Query: 3672 QYNFALQYINREVHGNADDMSRLTNT-ICSYCQMGHKDAKETKCRTSNIEVQIL 3830
            +Y+F +Q+     HGNAD +SR   T  C +C    K+AK+      +I V++L
Sbjct:  919 EYDFEIQHRKGTSHGNADALSRRPCTQSCKHC----KNAKKKFGMEIDISVKVL 968          
BLAST of SMED30007150 vs. TrEMBL
Match: A0A4Y2V331 (Retrovirus-related Pol polyprotein from transposon 297 OS=Araneus ventricosus OX=182803 GN=pol_3780 PE=4 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 8.525e-85
Identity = 99/223 (44.39%), Postives = 142/223 (63.68%), Query Frame = -3
Query: 3833 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEE-VIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANL 4498
            +   L+N+ LK++P+KC F +  + ++GH +S + ++T+  K   + +   P++  +LRSFLGL  YYRRF+KN+S I+ PL+  T        WTEEC K F +LK+ L  +PIL Y   D  FI+DTDAS   +GA+LSQ    G EE VIAY S++L K E  YCVTRKELLA+ + I HF  YLY ++F+ RTDH +L+++   K+P   Q+  WI  L
Sbjct:  849 VFQRLQNANLKLSPKKCRFFQKEVTYLGHVISAEGVKTDPGKTKAVVDWPRPETIHDLRSFLGLCTYYRRFVKNFSTIARPLHKLTETKSNF-NWTEECEKSFNSLKQALTSSPILTYPRTDKDFILDTDASNEGIGAVLSQ--NIGNEERVIAYFSKSLGKPERNYCVTRKELLAIVKSIEHFHHYLYGQKFLLRTDHASLRWLLNFKEP-EGQIARWIQRL 1067          

HSP 2 Score: 152.525 bits (384), Expect = 8.525e-85
Identity = 85/218 (38.99%), Postives = 132/218 (60.55%), Query Frame = -1
Query: 4495 LKLDKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSD-PPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVF 5145
            LK ++ + +  L+ +F ++F     D+G   +  H I T D PPI Q PRR P+  + + E LVQ +++ G++ +   PW +P+V+V K DGS R C+D+R LN +T+K S+P+P +   LD L  S+ F+++DL   Y+QVE+    + K AF+T +G + F    FGL  APATF +LM  +L+G+  +  +VYLDDI+I     E H   L +VF
Sbjct:  633 LKEEQRTAVKKLLNEFQDLFSTCDADVGRCNMTQHRINTGDHPPIKQYPRRLPLARKEEAEHLVQEMVDNGIIEESSGPWASPIVLVKKKDGSTRFCVDYRKLNEITKKDSYPLPRIDDTLDALNGSQWFTTLDLKSGYWQVEVRPEDREKTAFTTGQGLWQFKVMPFGLCNAPATFERLMETVLRGLSSEACLVYLDDIIIVGRTFEEHLSNLRKVF 850          

HSP 3 Score: 31.187 bits (69), Expect = 8.525e-85
Identity = 14/40 (35.00%), Postives = 21/40 (52.50%), Query Frame = -2
Query: 3723 KFIQYNFALQYINREVHGNADDMSRLT-NTICSYCQMGHK 3839
            +  +Y+F +Q+     HGNAD +SR     IC +C    K
Sbjct: 1066 RLQEYDFEIQHRKGSSHGNADALSRRPCGEICKHCSNAEK 1105          
BLAST of SMED30007150 vs. TrEMBL
Match: A0A4Y2G3Y0 (Retrovirus-related Pol polyprotein from transposon 297 OS=Araneus ventricosus OX=182803 GN=pol_4134 PE=4 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.598e-84
Identity = 99/223 (44.39%), Postives = 142/223 (63.68%), Query Frame = -3
Query: 3833 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEE-VIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANL 4498
            +   L+ + LK++P+KC F +  + ++GH +S + ++T+  KI  + +   P++  ++RSFLGL  YYRRF+KN+S I+ PL+  T        WTEEC K F +LK+ L  +PIL Y   D  FI+DTDAS   +GA+LSQ    G EE VIAY S++L K E  YCVTRKELLA+ + I HF  YLY R+F+ RTDH +L+++   K+P   Q+  WI  L
Sbjct:  311 VFQRLQKANLKLSPKKCRFFQKEVTYLGHVISAEGVKTDPGKIKAVVDWPRPETVHDVRSFLGLCTYYRRFVKNFSTIARPLHKLTEAKSNF-NWTEECEKSFNSLKQALTSSPILTYPRTDKDFILDTDASNEGIGAVLSQ--NIGNEERVIAYFSKSLGKPERNYCVTRKELLAIVKSIEHFHHYLYGRKFLLRTDHASLRWLLNFKEP-EGQIARWIQRL 529          

HSP 2 Score: 154.066 bits (388), Expect = 1.598e-84
Identity = 86/236 (36.44%), Postives = 142/236 (60.17%), Query Frame = -1
Query: 4495 KRFTDSDRLKIMFLTLKL---DKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSD-PPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVF 5190
            + F+++  L  +  +L++    +  ++  L+ +F N+F     D+GH  +  H I T D PPI Q PRR P+  + + + LV+++++ G++ +   PW +P+V+V K DGS R C+D+R LN +T+K S+P+P +   LD L  S+ F+++DL   Y+QVE+    + K AF+T +G + F    FGL  APATF +LM  +L+G+  +  +VYLDDI+I     E H   L +VF
Sbjct:   77 QEFSEAQHLSSILESLEMLNEKQRREVRKLLKEFQNLFSTCDADVGHCNMTQHRINTGDHPPIKQYPRRLPLSRKEEADHLVKDMVDNGIIEESSGPWASPIVLVKKKDGSTRFCVDYRKLNEITKKDSYPLPRIDDTLDALNGSQWFTTLDLKSGYWQVEIRPEDREKTAFTTGQGLWQFKEMPFGLCNAPATFERLMETVLRGLTSEACLVYLDDIIIVGRTFEEHLSNLRKVF 312          

HSP 3 Score: 27.7202 bits (60), Expect = 1.598e-84
Identity = 14/37 (37.84%), Postives = 20/37 (54.05%), Query Frame = -2
Query: 3723 QYNFALQYINREVHGNADDMSRLTNT-ICSYCQMGHK 3830
            +Y+F +Q+     HGNAD +SR   T  C +C    K
Sbjct:  531 EYDFEIQHRKGTSHGNADALSRRPCTESCKHCTNAEK 567          
BLAST of SMED30007150 vs. Ensembl Cavefish
Match: ENSAMXT00000048272.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000106.1:219951:223307:1 gene:ENSAMXG00000032559.1 transcript:ENSAMXT00000048272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.956 bits (463), Expect = 2.556e-80
Identity = 89/223 (39.91%), Postives = 135/223 (60.54%), Query Frame = -3
Query: 3830 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLS 4498
            +    R + LK+ P KC   +  ++++GH VS + I T+  K+ +++   +P   +E+R F+GL  YYRRF+++++ I+ PL+  T  + +   WT EC+  F  LK  L   P+L Y       I+DTDAS   +GA+LSQ+ +DG E V+AYGSR L   E  YC TR+ELLA+ EF  HFRQYL  R F+ R+DH +L+++   K+P   QL  W+  L+
Sbjct:  251 VFDRFRQANLKLKPTKCCLFRREVSYLGHIVSAQGIATDPEKVRKVQQWPQPTCVSEVRQFVGLAAYYRRFVQDFATIAKPLHELTKKHVR-FQWTPECQTAFEELKSSLTSTPVLGYPRDHGNLILDTDASNFGIGAVLSQV-QDGAERVLAYGSRRLSSTEQNYCTTRRELLAVVEFTRHFRQYLLGRPFIVRSDHSSLRWLVNMKEPEG-QLARWLEKLA 470          

HSP 2 Score: 135.961 bits (341), Expect = 2.556e-80
Identity = 64/174 (36.78%), Postives = 105/174 (60.34%), Query Frame = -1
Query: 4606 KLGTLIYQFSNIFMASRFDLGHTKVITHEIKT-SDPPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLM 5124
            +L  L+  + ++F     DLG T ++ H+I+    PP+ Q PRR     + + +  +Q  LE+G+ S   S W +P+V+V K D + R+C+D+R LN+ T K ++P+P +Q  L+ L  +K FS++DL   Y+QV L   ++  +AF +++G F +N   FGL  APATF +LM
Sbjct:   42 ELAQLLSTYGDVFSTGPTDLGRTSLVQHDIQLLPGPPVKQQPRRMAFEKQIESDAQIQQSLESGLASPSNSSWASPIVLVRKKDQTYRLCVDYRALNARTVKDAYPLPRIQDTLETLSTAKWFSTLDLASGYWQVALTPRARKAVAFCSRKGLFTWNVMPFGLCNAPATFQRLM 215          

HSP 3 Score: 24.2534 bits (51), Expect = 2.556e-80
Identity = 18/55 (32.73%), Postives = 26/55 (47.27%), Query Frame = -2
Query: 3678 KFIQYNFALQYINREVHGNADDMSRLT-NTICSYCQMGHKDAKETKCRTSNIEVQ 3839
            K  +Y+F + +     H NAD MSR    T C  C M   D  +  C+ ++  VQ
Sbjct:  468 KLAEYDFQVVHRPGHHHQNADVMSRRPCRTTCP-CNM--TDPADVACKVTHRGVQ 519          
BLAST of SMED30007150 vs. Ensembl Cavefish
Match: ENSAMXT00000034038.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:3120146:3124090:1 gene:ENSAMXG00000040885.1 transcript:ENSAMXT00000034038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.229 bits (404), Expect = 1.462e-74
Identity = 91/238 (38.24%), Postives = 129/238 (54.20%), Query Frame = -3
Query: 3830 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDK--------------MIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVH-FRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLS 4498
            +   LR  GLK+ P+KC   +  + ++GH VS   I+T+  KIS++     P++  EL  FLG   YYRRFI+ Y+ I+APLY  T+G+ +                +WTEEC   F  LK  L  AP+L Y+     F++ TDAS   +GA+L+Q+ +DG E VIAY SR L   E  Y   + E LAL   +   F  +LY  +F   TD+  LK++ TT K +    Q W+A LS
Sbjct:  411 VFDRLRKYGLKLKPQKCHLLRREVLYLGHVVSSDGIKTDPDKISKVAGWKVPENRHELLQFLGFAGYYRRFIEGYASIAAPLYRLTSGDPRKKKRGRKGPPAVGLPFIWTEECENAFQTLKTKLTTAPVLGYADYSQPFVLQTDASLAGLGAVLAQV-QDGRERVIAYASRGLNPAETRYPAHKLEFLALKWAVTDKFYDHLYGHKFSVLTDNNPLKYVMTTAK-LDATGQRWVAQLS 646          

HSP 2 Score: 142.51 bits (358), Expect = 1.462e-74
Identity = 71/170 (41.76%), Postives = 108/170 (63.53%), Query Frame = -1
Query: 4606 IYQFSNIFMASRFDLGHTKVITHEIKTSDPPILQNPRRQ--PMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLM 5109
            I + S++F     D GHT V+ HEI   DP   + P R+  P   +A V + +  + EAGV+   +SP+ +P+V+V K DGS+R+C+D+R LNS + + +FP+P ++  L+ LG++K FS++DL   Y+QVE+ E  + K AFST  G F  NR  FGL  +P+TF +LM
Sbjct:  207 ILKNSDVFSKHHLDYGHTTVVKHEIPLVDPRPFRLPYRKIPPSQYQA-VRKAITEMEEAGVIRPSKSPYASPIVVVTKKDGSLRICMDYRKLNSCSTRDAFPLPRVEEALEALGEAKYFSTLDLTSGYWQVEVAEADKHKTAFSTPMGLFEANRMPFGLQNSPSTFQRLM 375          
BLAST of SMED30007150 vs. Ensembl Cavefish
Match: ENSAMXT00000052546.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:13031363:13036570:1 gene:ENSAMXG00000033629.1 transcript:ENSAMXT00000052546.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.976 bits (367), Expect = 4.228e-71
Identity = 83/235 (35.32%), Postives = 126/235 (53.62%), Query Frame = -3
Query: 3830 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKM--------IVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLK---KHEMGYCVTRKELLALHEFIVH-FRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLS 4498
            +   LR+ GLK+ P KC   K  + F+GH +S K +Q +  K+  +E    PK+  ++R  LG  +YYRRF+  ++ ++ PL+A   G  KM        I W+ EC+  F  LK  L   P+L Y      FI+ TD S   +GA+LSQ K+ GTE VIAY SR L+   K++  Y   + ELLAL   +   FR +L   +F   TDH  L+++++    +    Q W+A ++
Sbjct:  895 VFNRLRHHGLKLKPSKCFLLKPEVKFLGHIISAKGVQVDAEKVRVLETWPIPKTVKDIRQVLGFMSYYRRFVPKFAQLAKPLHALVGG--KMNRGRATGPITWSGECQTAFDKLKGCLMSPPVLAYPDFTQPFILTTDGSLHGLGAVLSQ-KQGGTERVIAYASRGLRGSEKNDKNYSAFKLELLALKWAVTEKFRDFLMFAKFSVVTDHNPLRYLDSANLGVVE--QRWVAQMA 1124          

HSP 2 Score: 142.51 bits (358), Expect = 4.228e-71
Identity = 71/174 (40.80%), Postives = 110/174 (63.22%), Query Frame = -1
Query: 4606 KLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSD-PPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLM 5124
            +L  L+ +  +IF  S  D G+T  +TH I T D PP+ Q  RR P  +  + ++ VQ+L++ G++ +  SPW +P VIV K DG++R C D+R LN VT K ++P+P ++  LD LG ++ FS++DL   Y+QV + ++ + K A +T  G F ++R  FGL  APATF +LM
Sbjct:  686 ELMDLLEKHKDIFSKSDSDFGYTTAVTHSIPTGDAPPVKQRHRRVPPQVFQEFKKHVQSLVDRGILEESCSPWASPAVIVIKKDGTVRFCCDYRRLNQVTCKDAYPLPRVEESLDALGNAQWFSTLDLTAGYFQVAVKDSDREKTAVTTPFGLFQWSRMPFGLCNAPATFQRLM 859          

HSP 3 Score: 24.2534 bits (51), Expect = 4.228e-71
Identity = 10/27 (37.04%), Postives = 16/27 (59.26%), Query Frame = -2
Query: 3762 SKFIQYNFALQYINREVHGNADDMSRL 3842
            ++  +YNF + Y     + NAD +SRL
Sbjct: 1121 AQMAEYNFDISYKPGRQNANADVLSRL 1147          
BLAST of SMED30007150 vs. Ensembl Cavefish
Match: ENSAMXT00000048059.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001896.1:45492:48938:1 gene:ENSAMXG00000034382.1 transcript:ENSAMXT00000048059.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.836 bits (390), Expect = 1.369e-70
Identity = 89/238 (37.39%), Postives = 135/238 (56.72%), Query Frame = -3
Query: 3827 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGND------KMIV----WTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLK---KHEMGYCVTRKELLALHEFIVH-FRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLSN 4498
            + + L   GLK+ P+KC   +S + ++GH VS+  I  +  K+  ++    PKS TELR+FLGL  YYRRF+K +S I+APL+    G+       K +     W+ EC   F +LK+ L +AP+L ++     F++ TDAS R +GA+LSQ K+DG E+VIAY SR L+   +++  Y   + ELLAL   I   F +YL    F   TD+  L  + T +  +    Q W+A L++
Sbjct:  313 VFSRLSQQGLKLKPDKCKLLRSSVQYLGHVVSDAGIAPDPDKVMAVQQWRVPKSITELRAFLGLAGYYRRFVKGFSQIAAPLHRLLGGHPTKKSKAKALCPPWKWSNECETAFESLKQGLVQAPVLAFADFTLPFLLYTDASHRGLGAVLSQ-KQDGQEKVIAYASRGLQGAERNDANYSSFKLELLALKWAITEKFHEYLLGSDFTVYTDNNPLAHLATAR--LGAVEQRWVARLAS 547          

HSP 2 Score: 134.806 bits (338), Expect = 1.369e-70
Identity = 84/221 (38.01%), Postives = 137/221 (61.99%), Query Frame = -1
Query: 4492 LTLKLDKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSDP-PILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVFT 5151
            + L +++  KL TL+ +  ++F     D G T+ I HEI T D  PI Q  R+ P +L  +V+ L++ +L+A ++    SPW++P+V+V K DGSIR C+D+R LN VT K S+P+P ++  L  L K++ +S++DL   Y+QV++++    K AF+T  G F F R  FGL  APA+F +LM   L     + +++YLDD++++A +  +H   L  VF+
Sbjct:   95 VQLSVEQKEKLATLLTKHQSVFSQHEEDYGCTETILHEIPTGDAAPIRQRYRQIPPNLYGEVKTLIKQMLDADIIKPSSSPWSSPIVLVRKKDGSIRFCVDYRQLNQVTRKDSYPLPRVEEALASLKKARWYSTLDLASGYWQVKMHQKDMDKTAFTTPMGLFEFQRMPFGLCNAPASFQRLMESCLGDQNYQSLLIYLDDVIVFAADFNSHLDRLDFVFS 315          
BLAST of SMED30007150 vs. Ensembl Cavefish
Match: ENSAMXT00000038088.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:13869500:13874588:-1 gene:ENSAMXG00000037864.1 transcript:ENSAMXT00000038088.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.124 bits (357), Expect = 5.895e-68
Identity = 91/248 (36.69%), Postives = 146/248 (58.87%), Query Frame = -1
Query: 4495 EVNNIESSLVNKRFTDSDRLKIMFLTLKLD----KNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSDP-PILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVF 5223
            EV+ IE+  V    T     ++  LT   D    + + L  L++++S++F  S  D G T  I H I T D  P  +  R  P ++  ++  L+ ++L+ GV+S+  SPW  P+V+V K DGS R C+D+R LN+VT K +FP+P ++  L  L +++ F+++DL   Y+QV ++ + Q K AF+T  G + F R  FGL  APATF +LM   L+G + + + VYLDDI+I++ +   H + L +VF
Sbjct:  267 EVSVIETVPVG---TGGSTFEVSQLTTHTDLTTSQQAVLSQLLHKWSSVFSQSEEDFGCTDAIQHCIPTGDALPSRERFRPLPPNMYQEMRVLLADMLDKGVISESSSPWAAPVVMVRKKDGSWRFCVDYRKLNAVTHKDAFPLPRIEETLTTLTQAEWFTTLDLASGYWQVGVHPDDQPKTAFATPLGLYHFRRMPFGLCNAPATFQRLMQHCLRGQVAEFLFVYLDDIIIHSADFSLHVQHLEQVF 511          

HSP 2 Score: 138.272 bits (347), Expect = 5.895e-68
Identity = 77/215 (35.81%), Postives = 122/215 (56.74%), Query Frame = -3
Query: 3875 LRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTG-------NDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNL---KKHEMGYCVTRKELLALHEFIVH-FRQYLYRRRFVDRTDHKALKFMNTTK 4486
            L   GLK+  +KC   +  + F+GH V+++ +  +  K++ ++    P +  E+R+FLGL  YYRRFI  ++ ++ PL +   G       + + I WT EC+  F  LK  L +APIL Y+     FI+ TDAS + +GA+LSQ+ +DG E VIAY SR+L   +K++  Y   + ELLAL   +   FR YL   +F+  TD+  +  + + K
Sbjct:  514 LSRYGLKLRSDKCKLFRRQVKFLGHVVNKQGVHPDPEKVAAVQEWATPTTIREVRAFLGLAGYYRRFIDGFAKLARPLNSLLVGVPVNRKSSHRGINWTPECQNAFECLKSCLLQAPILAYADFSAPFIVYTDASSQGLGAVLSQM-QDGRERVIAYASRSLHPSEKNDANYSSFKLELLALKWAVTEKFRDYLMGSKFMVMTDNNPVAHLQSAK 727          
BLAST of SMED30007150 vs. Ensembl Medaka
Match: ENSORLT00000040305.1 (pep primary_assembly:ASM223467v1:1:25459511:25466649:-1 gene:ENSORLG00000028409.1 transcript:ENSORLT00000040305.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.045 bits (484), Expect = 1.146e-83
Identity = 95/223 (42.60%), Postives = 142/223 (63.68%), Query Frame = -3
Query: 3830 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLS 4498
            + T LR + LK+ P KC   +  + ++GH VS + I T+ +KI ++++   PK+ +E+R F+GL +YYRRF+ +++ I+ PL+  T    +   WT EC++ F  LK+ L  APIL Y +   + ++DTDAS   +GA+LSQ+ + G E V+AYGSR L   E  YC TR+ELLA+ EF  HFRQYL  R FV RTDH +L+++   K+P   QL  W+  L+
Sbjct: 1005 VFTRLRQANLKLKPSKCRLFQEQVAYLGHVVSAQGISTDPQKIQKVQDWPIPKNISEVRQFVGLASYYRRFVADFATIARPLHELTKKYARFD-WTTECQEAFEELKERLTSAPILGYPLDSGELLLDTDASDWGVGAVLSQV-QGGEERVLAYGSRRLTTTEQNYCTTRRELLAVVEFTSHFRQYLLGRSFVLRTDHSSLRWLTRLKEPEG-QLARWLEKLA 1224          

HSP 2 Score: 139.428 bits (350), Expect = 1.146e-83
Identity = 83/212 (39.15%), Postives = 125/212 (58.96%), Query Frame = -1
Query: 4492 KLGTLIYQFSNIFMASRFDLGHTKVITHEIKTS-DPPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVFT 5124
            +L  L+  +S++F A   DLG T V+ H+I T+    + Q PRR     +   ++ VQ  LEAG+     S W  P+V+V K D S R+C+D+R LN  T K ++P+P +Q  LD L  +K FS++DL   Y+QVE+   ++   AF T++G F +N   FGL  APATF +LM ++L G+  +  +VYLDDI++   N     + L +VFT
Sbjct:  796 RLAGLLRSYSDVFSAGSTDLGRTNVVQHDILTTPGSAVKQQPRRMSREKQEAADQQVQQSLEAGLARHSNSSWAAPIVMVKKKDQSPRLCVDYRPLNDRTIKDAYPLPRIQDTLDTLSTAKYFSTLDLTSGYWQVEMTPRARKAAAFCTRKGLFEWNVMPFGLCNAPATFQRLMDRVLAGLQWEACLVYLDDIIVLGCNSNQMMERLEQVFT 1007          

HSP 3 Score: 24.2534 bits (51), Expect = 1.146e-83
Identity = 10/25 (40.00%), Postives = 16/25 (64.00%), Query Frame = -2
Query: 3765 KFIQYNFALQYINREVHGNADDMSR 3839
            K  +Y+F + +   +VH NAD +SR
Sbjct: 1222 KLAEYDFQVLHRPGKVHQNADALSR 1246          
BLAST of SMED30007150 vs. Ensembl Medaka
Match: ENSORLT00000036827.1 (pep primary_assembly:ASM223467v1:16:28613823:28617539:1 gene:ENSORLG00000023550.1 transcript:ENSORLT00000036827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.57 bits (462), Expect = 3.003e-80
Identity = 95/217 (43.78%), Postives = 136/217 (62.67%), Query Frame = -3
Query: 3827 SGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLSN 4477
            +GLK++P+KC F +  L F+GH +  + I T + K+  + +   P +  +L+SFLGL +YYRRF++ +S I+APL+      D   VWT+EC + F +LKK L  +PIL        FI+DTDAS   MGA+LSQ+   G E V+AY S+ L K E  YCVTR+ELLA+ + I HFR YL    F  RTDH AL+++ T K+P   Q+  W+  L++
Sbjct:  453 AGLKLHPDKCCFMRRELEFLGHKIGGEGISTLEEKVQAVRDWPTPTTLRDLKSFLGLASYYRRFVRGFSCIAAPLFHLQR-KDCDFVWTQECEQAFSSLKKALTNSPILTPPDPKLPFILDTDASDVGMGAVLSQMGSAG-ERVVAYFSKTLSKAERRYCVTRRELLAVVKAIGHFRYYLCGLPFTVRTDHSALQWLMTFKEPEG-QIARWLEELAS 666          

HSP 2 Score: 133.65 bits (335), Expect = 3.003e-80
Identity = 77/207 (37.20%), Postives = 123/207 (59.42%), Query Frame = -1
Query: 4531 LKLDKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSDP-PILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDG-SIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGN 5145
            L+  +  +L  ++ ++ +IF  S  ++G T ++ HEI T D  PI   PRR P+  +   +  ++ +L  G++    SPW + +V+V K  G  +R C+D+R LN VT+K S+P+P +   LD +  S  FSS+DL   Y+QV L+  ++ K AF T  G + F   SFGL  APATF +LM ++L  +  +  +VYLDDIL++ G+
Sbjct:  229 LQPGQKDELWKVLLEYRDIFALSEDEVGLTHLVHHEIDTGDARPIKTRPRRLPLAHQVAADSAIEEMLRGGIIEPSDSPWASGVVMVKKKKGPKMRFCVDYRPLNGVTKKDSYPLPRIDESLDLVSGSSWFSSLDLRSGYWQVPLSPAARPKTAFCTGRGLWQFRVLSFGLCNAPATFERLMEKVLASIPRQECLVYLDDILVHGGS 435          

HSP 3 Score: 26.5646 bits (57), Expect = 3.003e-80
Identity = 13/46 (28.26%), Postives = 24/46 (52.17%), Query Frame = -2
Query: 3708 KFIQYNFALQYINREVHGNADDMSRLTNTI--CSYCQMGHKDAKET 3839
            +   ++F +++     H NAD MSR    +  C YC+   ++A+E 
Sbjct:  663 ELASFSFTVEHRPGSRHANADAMSRRPCALAGCQYCE--KREAREA 706          
BLAST of SMED30007150 vs. Ensembl Medaka
Match: ENSORLT00000045141.1 (pep primary_assembly:ASM223467v1:23:22495254:22500491:-1 gene:ENSORLG00000029628.1 transcript:ENSORLT00000045141.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 1.822e-72
Identity = 95/253 (37.55%), Postives = 147/253 (58.10%), Query Frame = -1
Query: 4495 GMQLKEVNNIESSLVNKRFTDSDRLKIMFLT----LKLDKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSD-PPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVF 5238
            G+ +K ++ IE   V +   +++RL +        L   +  +L +L+    ++F  +  D G+T  +TH I T D PPI Q  RR P  +  + ++ V  L+  G++ +  SPW +P VIV K DGS+R C D+R LN VT K ++P+P ++  LD LG + +FS++DL   Y+QV +NE  Q K A +T  G F + R  FGL  APATF +LM  +L  +    ++VYLDDIL+Y+ + E+H + L  VF
Sbjct:  644 GLVVKHLDGIE---VTQLENEAERLPVPVQANTEGLTESQYQQLVSLLATHQDVFSQNENDYGYTTSVTHCISTGDAPPIKQRHRRVPPQVFQEFKKHVHELVSQGILKESTSPWASPAVIVIKKDGSVRFCCDYRRLNQVTCKDAYPLPRVEEALDALGDAHLFSTLDLTAGYFQVAMNEEDQGKTAVTTPFGLFEWTRMPFGLCNAPATFQRLMGLVLGDLSFDILLVYLDDILVYSRDFESHCERLGLVF 893          

HSP 2 Score: 147.902 bits (372), Expect = 1.822e-72
Identity = 81/232 (34.91%), Postives = 125/232 (53.88%), Query Frame = -3
Query: 3830 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYA-----ATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLK---KHEMGYCVTRKELLALHEFIVH-FRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLS 4498
            +   LR  GLK+ P KC   +  + F+GH +S + I+ +  K+S + +   P+S  E+R  +G  +YYRRF+ N++ ++ PL+A          ++  VWT +C+     LK+ L   P+L Y      FI+ TD S   +GA+LSQ K+DG E V+AY SR L+   K++  Y   + ELLAL   I   FR YL   +F   TDH  L+++ T    +    Q W+A L+
Sbjct:  892 VFQRLRQHGLKLKPSKCFLLRPEVKFLGHLISAQGIKVDMEKVSALTSWPTPRSVKEVRQVVGFMSYYRRFVPNFAHMAKPLHALLGKRGKVNENQPFVWTADCQTALDELKQCLTSPPVLAYPDFQTPFILTTDGSSHGLGAVLSQ-KQDGVERVVAYASRGLRGSEKNDKYYSAFKLELLALKWAITEKFRDYLMFSKFTVVTDHNPLRYLGTAN--LGAVEQRWVAQLA 1120          
BLAST of SMED30007150 vs. Ensembl Medaka
Match: ENSORLT00000044989.1 (pep primary_assembly:ASM223467v1:1:17572028:17576089:-1 gene:ENSORLG00000028051.1 transcript:ENSORLT00000044989.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.443 bits (376), Expect = 1.990e-71
Identity = 90/239 (37.66%), Postives = 133/239 (55.65%), Query Frame = -3
Query: 3830 SIHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAAT-----------TGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLK---KHEMGYCVTRKELLALHEFIVH-FRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLS 4501
            ++   LR +GLKV  EKC F +S + F+GH +S   I T+  K++ ++    P S  ELRSFLG  +YYRRF++ +S ++ PL+ A            + N    VWT EC+  F  LK+ L  AP+L Y+     FI++TDAS   +GA+L QI +DG + VIAY SR L+   K++  Y   + ELLAL   +   FR YL   +F   TD+  L  +++ +  +    Q WIA L+
Sbjct:  444 TVFQRLRETGLKVKVEKCNFLQSSVRFLGHQISADGIGTDPDKVAAVKQWPVPASVKELRSFLGFCSYYRRFLQGFSQLAGPLHDAVNTCLNQSNMSRSKNLFKSVWTAECQDSFEELKERLTSAPLLGYANFSLPFILETDASSLGLGAVLYQI-QDGEKRVIAYASRRLRGAEKNDRNYSSMKLELLALKWAVSEKFRGYLLGAKFTVMTDNNPLCHLDSAR--LGAVEQRWIAQLA 679          

HSP 2 Score: 142.895 bits (359), Expect = 1.990e-71
Identity = 88/232 (37.93%), Postives = 135/232 (58.19%), Query Frame = -1
Query: 4480 DRLKIMFLTLKLDKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIK-TSDPPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVFTHTLE 5172
            D LKI   T   ++ ++L  LI Q++++F  S  DLG+   I HEI  T D P+ Q  RR P     +V++ +  LL  GV+ +  S + +P+V+V K D S+R+C+D+R LN+ T + +FP+P +    D L  +K FS+IDL   Y+QV ++EN + K AF T  G F + R  FG+   PATF +LM   +  ++ + ++VYLDDIL+Y+   + H   L  VF    E
Sbjct:  223 DHLKIGGTT---EQQTRLAKLISQYTDVFALSDEDLGYADRIQHEIHLTDDVPVTQPYRRVPPTQYKEVKDHIAQLLRKGVIQESTSAYASPIVLVRKADNSLRLCVDYRRLNAKTRRDAFPLPRIDECFDALHGAKFFSTIDLASGYHQVAVHENDRHKTAFITPFGLFEYTRLPFGVCNGPATFQRLMQATMSDLVFQIMLVYLDDILVYSPTFDGHLTRLQTVFQRLRE 451          
BLAST of SMED30007150 vs. Ensembl Medaka
Match: ENSORLT00000032005.1 (pep primary_assembly:ASM223467v1:7:31190450:31194463:1 gene:ENSORLG00000029990.1 transcript:ENSORLT00000032005.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 6.540e-68
Identity = 73/184 (39.67%), Postives = 109/184 (59.24%), Query Frame = -1
Query: 4600 TLKLDKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKT-SDPPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQ 5148
            TL  +   K   L+ +++N+F A   DLG T ++THEI    D P+ Q  RR P      V++ +  LL +GV+ +  SP+ +P+V+  K DGS+RMC+D+R LNS T + +FP+P +   LD L  ++ F+++DL   Y QV + E  + K AF T  G F +NR  FGL  AP TF +LM +
Sbjct:  269 TLPAEDRGKARALLQKYANVFAAHEGDLGCTTLMTHEIPLLDDAPVRQRHRRIPPSEYEAVKDHINQLLASGVIRESNSPYASPIVLARKKDGSLRMCVDYRQLNSKTRRDAFPLPPIDESLDALSGARWFTTLDLASGYNQVPVTEGDRAKTAFCTPFGLFEWNRMPFGLCNAPGTFQRLMQR 452          

HSP 2 Score: 134.806 bits (338), Expect = 6.540e-68
Identity = 79/234 (33.76%), Postives = 124/234 (52.99%), Query Frame = -3
Query: 3830 LRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIV-----------WTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHE---MGYCVTRKELLALHEFIVH-FRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLS 4486
            L+   L+V   KCAF +  + ++GH +S++ + T+  KI  +     P + +ELR+FLG  +YYRRF++ ++ ++APL+      D               WT EC++ F  LK+ L  AP+L Y+     FI++ DAS   +GA+LSQ ++ G+   IAY SR LK  E     Y   + E LAL   +   FR+YL     V  TD+  L +++T K  +    Q W+A L+
Sbjct:  488 LQQEKLRVKLPKCAFFQQEVRYLGHVISDQGVSTDPHKIEAVAGWQPPSTVSELRTFLGFASYYRRFVEGFARLAAPLHRLVGELDGTKSRRRKASSLQGHWTTECQQNFDALKQKLTSAPVLAYADFTLPFILEVDASHNGLGAVLSQ-EQGGSVRPIAYASRGLKATERNMQNYSSMKLEFLALKWAMTEKFREYLLGHHCVVFTDNNPLSYLSTAK--LGAMEQRWVAQLA 718          
BLAST of SMED30007150 vs. Planmine SMEST
Match: SMESG000081257.1 (SMESG000081257.1)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 303/358 (84.64%), Postives = 322/358 (89.94%), Query Frame = -1
Query: 4492 VEKNDVMFKKNDDRKWSMKKITFFHVEMLWDSGTSISVMSEKCWGLIGSSILMDSRIRVSEVFSKENEKLLESVKIVAK*NKIFLELNVIIVGKIHLDFIGGVDSIKIFGMQLKEVNNIESSLVNKRFTDSDRLKIMFLTLKLDKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSDPPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVFT 5565
            +  NDVMFKK+DDRKWS+ +I  FHVEMLW+SG SISVMSEKCW LIGS ILMDSRI +SEVFS E++K L SVKIVAK NK F ELNVIIV KIH +FIGGVD++KIFGM+LKEVNNIESSLVNKRFTDSDRLK   LTLKLDKNS+LGTLI QFSNIFMASRFDLGHTKVITHE+KTS PPILQNPR QPMHLEAKVEELVQNLLEAGVV KCQSPWNTPLVIVGKPDGS+R+CLDFRLLNSVTEKFSFPMP MQLLLD LGKSKIF SIDLGQAYY VELNENSQIK AFSTKEGQFCFNR  FGLSTAPATF KLMHQIL+G++ KGVVVYLDDILIY  NQETHDK LFEVFT
Sbjct:  270 ISSNDVMFKKDDDRKWSIMEINGFHVEMLWNSGASISVMSEKCWRLIGSPILMDSRILLSEVFSNEDKKPLGSVKIVAKWNKKFRELNVIIVRKIHPNFIGGVDTMKIFGMELKEVNNIESSLVNKRFTDSDRLKNTLLTLKLDKNSELGTLISQFSNIFMASRFDLGHTKVITHELKTSGPPILQNPRGQPMHLEAKVEELVQNLLEAGVVRKCQSPWNTPLVIVGKPDGSVRICLDFRLLNSVTEKFSFPMPDMQLLLDCLGKSKIFYSIDLGQAYYLVELNENSQIKTAFSTKEGQFCFNRLPFGLSTAPATFQKLMHQILEGLVFKGVVVYLDDILIYGENQETHDKLLFEVFT 627          

HSP 2 Score: 374.4 bits (960), Expect = 0.000e+0
Identity = 183/221 (82.81%), Postives = 197/221 (89.14%), Query Frame = -3
Query: 5627 NDGLKKNISTKVNITRE*I*NLTKVYEA*EVYDTKERFEEVQAVVKSTYTNVTQDKQKQWIQKSFNNRIYPNRQTEITYQNRNERNKRQFDKVKPVA*QYNEKTTTERRPPPLVSIKHIARKIYNRCCGLPEPVEERLKPGQCFCCG*IDHIRFECPLKDKCLICGKEGHSFRSCNLLVKSRSNTQRLERRVYCIHEENDDRSDELIERLIHNVETKKTKK 6289
            ND LK N+STK NITRE I NL KV+EA E Y+TKER EEVQ VVKS Y NVTQDKQKQWIQKSFNNRIYPNRQT+I+YQNRNERN+RQFDKVKPV  QYNE+TT ERRPPPL+S+KHI RKIYNR CGLPEPVEERLKPG+CFCCG  DH+RFECPLKDKCLICGKEGHSFR  NLLVKSRSNTQRLER VYCIH+ENDDRSDELIE LIHNVETKK ++
Sbjct:   44 NDRLKGNLSTKDNITREEIRNLAKVHEAREGYNTKERSEEVQVVVKSIYANVTQDKQKQWIQKSFNNRIYPNRQTDISYQNRNERNERQFDKVKPVTKQYNERTTMERRPPPLISMKHITRKIYNRFCGLPEPVEERLKPGKCFCCGQNDHMRFECPLKDKCLICGKEGHSFRCFNLLVKSRSNTQRLERSVYCIHKENDDRSDELIEPLIHNVETKKNQE 264          

HSP 3 Score: 353.214 bits (905), Expect = 0.000e+0
Identity = 174/223 (78.03%), Postives = 184/223 (82.51%), Query Frame = -3
Query: 3830 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLS 4498
            + T +R+SGLKVNPEKCAFNKSVLNFIGHTVSEK IQTNKRKISEIEN+TEPKSTTELRSFLGL  YYRRFIKNYSMI+APLYAATTG DKMIVWTEECRKRFINLKKLLCEAPIL+Y  AD  FIIDTD SF A+G                    +L KHE+GYCVTRKELL LHEFIVHFRQYLY RRFV RTDHKAL FMNTTKKPISPQ QTW+AN S
Sbjct:  625 VFTRIRDSGLKVNPEKCAFNKSVLNFIGHTVSEKGIQTNKRKISEIENATEPKSTTELRSFLGLTTYYRRFIKNYSMIAAPLYAATTGCDKMIVWTEECRKRFINLKKLLCEAPILEYPRADRLFIIDTDDSFEAIG--------------------HLTKHEIGYCVTRKELLVLHEFIVHFRQYLYGRRFVARTDHKALTFMNTTKKPISPQFQTWMANFS 827          

HSP 4 Score: 189.119 bits (479), Expect = 2.834e-60
Identity = 100/135 (74.07%), Postives = 112/135 (82.96%), Query Frame = -1
Query: 3283 SSNIMKIIKQKQNEDRVTSEIISHLNGNEAHISYETISSSIFKYLKILQIQDDLLMINTDEKLAVVVPDSYVKCLVNYFHLNYAIWVSRKPYFI*RTFSFGHP*IRLL-QCINKCKICASRKIDKGRTKEILLTR 3684
            SSNIMKIIKQKQNED+VTS+IISHLNGNEAHISY+TISSSIFKYLKILQIQD++LMINTD KLAVVVPDSYVK LVNYFH+        K  F  + F F     +++ +CINKCKICASRKID+GRTKEILL R
Sbjct:  881 SSNIMKIIKQKQNEDKVTSQIISHLNGNEAHISYKTISSSIFKYLKILQIQDNVLMINTDGKLAVVVPDSYVKSLVNYFHIELCHLGINKTLFYLKDFFFLPSMNQIITECINKCKICASRKIDQGRTKEILLPR 1015          

HSP 5 Score: 65.4698 bits (158), Expect = 2.834e-60
Identity = 33/61 (54.10%), Postives = 38/61 (62.30%), Query Frame = -2
Query: 3696 KKTNKPTTSDMDSKFIQYNFALQYINREVHGNADDMSRLTNTICSYCQMGHKDAKETKCRT 3878
            KK   P      + F +Y+FALQY     HGNA   SRL NTICS+ QM HKDAK+ KCRT
Sbjct:  812 KKPISPQFQTWMANFSEYDFALQYRKGNEHGNAGGWSRLNNTICSHYQMEHKDAKKAKCRT 872          

HSP 6 Score: 73.9442 bits (180), Expect = 1.441e-12
Identity = 33/43 (76.74%), Postives = 39/43 (90.70%), Query Frame = -1
Query: 6289 VRKNNDERFATFEIRVKKLIDEGYDCGISKENIVKLILYHRIR 6417
            +R+N+DERF TFEIRVKKL+DE YDCGISKENIVKL+L H +R
Sbjct:    1 MRQNHDERFVTFEIRVKKLVDEVYDCGISKENIVKLVLCHGVR 43          
BLAST of SMED30007150 vs. Planmine SMEST
Match: SMESG000065302.1 (SMESG000065302.1)

HSP 1 Score: 503.442 bits (1295), Expect = 0.000e+0
Identity = 284/391 (72.63%), Postives = 305/391 (78.01%), Query Frame = -1
Query: 4480 MLRQKKPRRPRCLYFISRVETVDEFKKRNVEKNDVMFKKNDDRKWSMKKITFFHVEMLWDSGTSISVMSEKCWGLIGSSILMDSRIRVSEVFSKENEKLLESVKIVAK*NKIFLELNVIIVGKIHLDFIGGVDSIKIFGMQLKEVNNIESSLVNKRFTDSDRLKIMFLTLKLDKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSDPPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVFTHTLE 5652
            M R+KKPRR  CL+F+S+V+TVDEF KRNV K + MFKK+DDRKWSM +I  FH+EMLWDSG SISVMSEKCW LIGS ILMDSRIR+S VFSKE EK   SVKIVAK NK   E NVIIV KIH DFIGGVD++KIF M+LKEVN IESSLVNKRFTDSDRLK   LTLKLDKNSKLGTLI QFSNIFMAS+FDLGH                                 ++NLL AGVV KCQS WNTPLVIVGKPDGS RMCLDFR LNSVTEK SFPMP MQLLLD LGKSKI SSIDL Q YYQVELNENSQIK AFSTKEGQFCFNR  FGLSTAPATF KLMHQIL+G++ K VVVYLDDIL YA NQETHDK LFEVFT  ++
Sbjct:    1 MSRRKKPRRTCCLHFVSKVKTVDEFNKRNVGKKNEMFKKDDDRKWSMMEINGFHLEMLWDSGASISVMSEKCWRLIGSPILMDSRIRLSGVFSKEYEKPFGSVKIVAKRNKKVREFNVIIVRKIHPDFIGGVDTMKIFCMKLKEVNIIESSLVNKRFTDSDRLKNTLLTLKLDKNSKLGTLISQFSNIFMASKFDLGH---------------------------------IKNLLVAGVVRKCQSSWNTPLVIVGKPDGSSRMCLDFRCLNSVTEKVSFPMPDMQLLLDCLGKSKILSSIDLRQVYYQVELNENSQIKTAFSTKEGQFCFNRLPFGLSTAPATFQKLMHQILEGLVFKRVVVYLDDILKYAENQETHDKLLFEVFTRIID 358          

HSP 2 Score: 230.335 bits (586), Expect = 0.000e+0
Identity = 120/187 (64.17%), Postives = 129/187 (68.98%), Query Frame = -3
Query: 3938 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYL 4498
            + T + +SGLKV+P KCAFNKS+LNFI HTVSEK IQTNK K SEI N  E KSTTELRSFLGL NYYRRFIKNYSMI+APLYAATTGNDKMIVWTEEC                                      A+LSQIKEDGTE VIAY SR+L  HEMGYCV RKELL L+E IVHFRQYL
Sbjct:  352 VFTRIIDSGLKVSPAKCAFNKSLLNFINHTVSEKGIQTNKGKFSEIVNPIETKSTTELRSFLGLTNYYRRFIKNYSMIAAPLYAATTGNDKMIVWTEEC--------------------------------------AVLSQIKEDGTEGVIAYVSRHLTNHEMGYCVIRKELLVLYELIVHFRQYL 500          

HSP 3 Score: 186.422 bits (472), Expect = 0.000e+0
Identity = 98/137 (71.53%), Postives = 110/137 (80.29%), Query Frame = -1
Query: 3283 YRSSNIMKIIKQKQNEDRVTSEIISHLNGNEAHISYETISSSIFKYLKILQIQDDLLMINTDEKLAVVVPDSYVKCLVNYFHLNYAIWVSRKPYFI*RTFSFGHP*IRLL-QCINKCKICASRKIDKGRTKEILLTR 3690
            + SSNIMKIIKQKQNEDRVTSEIISH  GNEAHISYETISSSIFKYLKILQIQDD+LMIN+D KLAVVVPDSYVK LVNYF++       +K  F  + F F     +++ +CINKCKICASRKID+GR KEIL  R
Sbjct:  572 HGSSNIMKIIKQKQNEDRVTSEIISHFIGNEAHISYETISSSIFKYLKILQIQDDVLMINSDGKLAVVVPDSYVKSLVNYFYIEQGYLGIKKTLFCLKGFFFWPSMNQIITECINKCKICASRKIDQGRRKEILFPR 708          

HSP 4 Score: 95.1301 bits (235), Expect = 0.000e+0
Identity = 47/79 (59.49%), Postives = 54/79 (68.35%), Query Frame = -2
Query: 3696 EKICRQNRSQGIEIYEYNKKTNKPTTSDMDSKFIQYNFALQYINREVHGNADDMSRLTNTICSYCQMGHKDAKETKCRT 3932
            +KIC QN SQGIEIYEYNK+TNKPT SD              I  E HGN+D +SRL NTICS+CQ+  KD+KE KCRT
Sbjct:  501 DKICSQNGSQGIEIYEYNKETNKPTISD--------------IKGEEHGNSDGISRLNNTICSHCQIEQKDSKEGKCRT 565          
BLAST of SMED30007150 vs. Planmine SMEST
Match: SMESG000038955.1 (SMESG000038955.1)

HSP 1 Score: 441.81 bits (1135), Expect = 0.000e+0
Identity = 250/339 (73.75%), Postives = 270/339 (79.65%), Query Frame = -1
Query: 4492 KITFFHVEMLWDSGTSISVMSEKCWGLIGSSILMDSRIRVSEVFSKENEKLLESVKIVAK*NKIFLELNVIIVGKIHLDFIGGVDSIKIFGMQLKEVNNIESSLVNKRFTDSDRLKIMFLTLKLDKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSDPPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVFT 5508
            +I  FHV+MLWDSG SISVMS+K W LIG  ILMDSRIR+S VFSKE+EK L SVKIVAK NK   +++     + H + + G           KEVNNIES LVNK+FTDSDRLKI   TLKLDKNSKLGTLI +FSNIFMASRFDLGHTKVITHEIK           ++PMHLE KVEELVQNLLEAGVV K  SPWNTPLVIVGK DGSIRMCLDFRLLNSVTEKFSF  P M+LLLD LG SKIFSSIDLGQAYYQVELNENSQIK AFSTKEGQFCFNR  FGLSTAPATF KLMHQIL+G++ KGVVVYLD+ILIY  NQE HDK LFEVFT
Sbjct:    2 EINGFHVDMLWDSGASISVMSDKYWRLIGRPILMDSRIRLSGVFSKEDEKPLGSVKIVAKWNK---KVSFHRRSRHHENILHGA----------KEVNNIESLLVNKKFTDSDRLKITLSTLKLDKNSKLGTLISKFSNIFMASRFDLGHTKVITHEIK-----------KKPMHLEGKVEELVQNLLEAGVVRKSISPWNTPLVIVGKLDGSIRMCLDFRLLNSVTEKFSFYSPDMKLLLDCLGNSKIFSSIDLGQAYYQVELNENSQIKTAFSTKEGQFCFNRLPFGLSTAPATFQKLMHQILEGLVFKGVVVYLDEILIYGENQEIHDKLLFEVFT 316          

HSP 2 Score: 300.442 bits (768), Expect = 0.000e+0
Identity = 149/223 (66.82%), Postives = 162/223 (72.65%), Query Frame = -3
Query: 3830 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLS 4498
            + T +R+SGLKVNPEKCAFNKSVLNFIGHT                                           NYS+I+AP+Y ATTGNDKMIVWTEECR  FINLKKLLCEAPIL+Y  AD  F+IDTDASF A+GA+LSQIKED TE VIAYGSR+L KHEMG+CVT KELLALHEFIVHFRQYLY RRFV RTDHKAL FMNTTKKPISPQ QTW+ANLS
Sbjct:  314 VFTRIRDSGLKVNPEKCAFNKSVLNFIGHT-------------------------------------------NYSIIAAPMYVATTGNDKMIVWTEECRNSFINLKKLLCEAPILEYPRADRLFVIDTDASFGAIGAVLSQIKEDCTEVVIAYGSRHLTKHEMGHCVTIKELLALHEFIVHFRQYLYGRRFVARTDHKALTFMNTTKKPISPQFQTWMANLS 493          

HSP 3 Score: 121.324 bits (303), Expect = 1.860e-39
Identity = 64/70 (91.43%), Postives = 65/70 (92.86%), Query Frame = -1
Query: 3475 SSNIMKIIKQKQNEDRVTSEIISHLNGNEAHISYETISSSIFKYLKILQIQDDLLMINTDEKLAVVVPDS 3684
            SSNIMKIIK KQNEDRVTSE ISHLNGNEAHISYETISS IFKYLK LQIQDD+LMINTD KLAVVVPDS
Sbjct:  547 SSNIMKIIK-KQNEDRVTSENISHLNGNEAHISYETISSRIFKYLKRLQIQDDVLMINTDGKLAVVVPDS 615          

HSP 4 Score: 63.1586 bits (152), Expect = 1.860e-39
Identity = 33/64 (51.56%), Postives = 39/64 (60.94%), Query Frame = -2
Query: 3687 KKTNKPTTSDMDSKFIQYNFALQYINREVHGNADDMSRLTNTICSYCQMGHKDAKETKCRTSNI 3878
            KK   P      +   +++FALQY   E HGNAD  SRL NT CS+C M +KDAKE KCRT  I
Sbjct:  478 KKPISPQFQTWMANLSEHDFALQYRKGEEHGNADGKSRLNNTKCSHCLMENKDAKEAKCRTRYI 541          
BLAST of SMED30007150 vs. Planmine SMEST
Match: SMESG000029320.1 (SMESG000029320.1)

HSP 1 Score: 427.943 bits (1099), Expect = 0.000e+0
Identity = 218/266 (81.95%), Postives = 229/266 (86.09%), Query Frame = -1
Query: 4846 QKKPRRPRCLYFISRVETVDEFKKRNVEKNDVMFKKNDDRKWSMKKITFFHVEMLWDSGTSISVMSEKCWGLIGSSILMDSRIRVSEVFSKENEKLLESVKIVAK*NKIFLELNVIIVGKIHLDFIGGVDSIKIFGMQLKEVNNIESSLVNKRFTDSDRLKIMFLTLKLDKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSDPPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFR 5643
            +K PRRP CL+F+SRVETVDEFKKRNVEK DV+FKK+DDRKWSM +I  FHVEMLWDSG SI VMSEKCW LI      DSR R+S VFSKE+EK L SVKI AK NK F ELNVIIV KIH DFIGGV ++KIFGM+LKEVNNIESSLVNKR TDSDRLK   LTLK DKNSKLGTLI QFSNIFMASRFDLGHTKVITHEIKTS PPILQNPRRQPMHLE KVEELVQNLLE  VV KCQSPWNTPLVIVGKPDGSIRMCLDFR
Sbjct:  234 KKIPRRPFCLHFVSRVETVDEFKKRNVEKKDVIFKKDDDRKWSMMEINGFHVEMLWDSGASIRVMSEKCWRLI------DSRERLSGVFSKEDEKPLGSVKIFAKWNKKFRELNVIIVRKIHPDFIGGVYTMKIFGMELKEVNNIESSLVNKRVTDSDRLKNTLLTLKFDKNSKLGTLISQFSNIFMASRFDLGHTKVITHEIKTSGPPILQNPRRQPMHLEGKVEELVQNLLE-DVVRKCQSPWNTPLVIVGKPDGSIRMCLDFR 492          

HSP 2 Score: 308.531 bits (789), Expect = 0.000e+0
Identity = 161/224 (71.88%), Postives = 168/224 (75.00%), Query Frame = -3
Query: 5618 NDGLKKNISTKVNITRE*I*NLTKVYEA*EVYDTKERFEEVQAVVKSTYTNVTQDKQKQWIQKSFNNRIYPNRQTEITYQNRNERNKRQFDKVKPVA*QYNEKTTTERRPPPLVSIKHIARKIYNRCCGLPEPVEERLKPGQCFCCG*IDHIRFECPLKDKCLICGKEGHSFRSCNLLVKSRSNTQRLERRVYCIHEENDDRSDELIERLIHNVETKKTKKTPL 6289
            ND LK+NISTK NITRE I NL KVYEA E YDTK+R EEVQAV+KSTY NVTQDKQKQWIQKSFNNRIYPN QTEITYQNRNERN+RQFDKV                                      +PVEERLKPGQCFCCG  DH+RFEC LKDKCLICGKEGHSFRSCNLLVKSRSNTQRLERRVYCIHEENDDRSDELIE LIHNVETKK  + P 
Sbjct:   53 NDRLKENISTKANITREEIRNLAKVYEAREGYDTKKRSEEVQAVIKSTYVNVTQDKQKQWIQKSFNNRIYPNLQTEITYQNRNERNERQFDKVTTF-----------------------------------KPVEERLKPGQCFCCGQNDHLRFECTLKDKCLICGKEGHSFRSCNLLVKSRSNTQRLERRVYCIHEENDDRSDELIEPLIHNVETKKIPRRPF 241          

HSP 3 Score: 93.5893 bits (231), Expect = 0.000e+0
Identity = 44/52 (84.62%), Postives = 48/52 (92.31%), Query Frame = -1
Query: 6289 MDKICELSSVRKNNDERFATFEIRVKKLIDEGYDCGISKENIVKLILYHRIR 6444
            MDKICELSSVR+N DERF TFEIRVKKL+DE YDCGISKENIVKLIL HR++
Sbjct:    1 MDKICELSSVRQNPDERFVTFEIRVKKLVDEVYDCGISKENIVKLILCHRVQ 52          

HSP 4 Score: 186.422 bits (472), Expect = 8.789e-48
Identity = 88/103 (85.44%), Postives = 92/103 (89.32%), Query Frame = -3
Query: 3830 AD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQTWIANLS 4138
            AD  FIIDTDASF A+GA+LSQIKED TE VIAYGSR+L KHEMGYCVTRKELLA+HEFIVHFRQYLY RRFV RTDHKAL FMNT KKPISPQ QTWIANLS
Sbjct:  493 ADRLFIIDTDASFGAIGAVLSQIKEDSTEGVIAYGSRHLAKHEMGYCVTRKELLAIHEFIVHFRQYLYGRRFVARTDHKALTFMNTAKKPISPQFQTWIANLS 595          
BLAST of SMED30007150 vs. Planmine SMEST
Match: SMESG000035021.1 (SMESG000035021.1)

HSP 1 Score: 420.624 bits (1080), Expect = 0.000e+0
Identity = 243/348 (69.83%), Postives = 264/348 (75.86%), Query Frame = -1
Query: 4495 KNDDRKWSMKKITFFHVEMLWDSGTSISVMSEKCWGLIGSSILMDSRIRVSEVFSKENEKLLESVKIVAK*NKIFLELNVIIVGKIHLDFIGGVDSIKIFGMQLKEVNNIESSLVNKRFTDSDRLKIMFLTLKLDKNSKLGTLIYQFSNIFMASRFDLGHTKVITHEIKTSDPPILQNPRRQPMHLEAKVEELVQNLLEAGVVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLLDYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLSTAPATF*KLMHQXXXXXXXXXXXXXXXDILIYAGNQETHDKFLFEVF 5538
            KND RKWSM ++  FHVEMLWDSG SISV+SEKCW LIGS ILMDSRIR+S VF KE+EKLL S KIVAK NK F +LNVIIV KI+ DFIGGVD+IKIFGM+LKEVNNIES LVNKRFTDS+ LKI  LTLK DKN+KLGTLI+QFSNIFMASRFD GH KVI HEIKTSD PILQN RRQ MHLE KVEELVQNLLEAGV+ K QSPWNTPLVIVGKPD S                                      ++   QAYYQVELNENSQIK AFSTKEGQ CFNR   GLSTAPATF K ++Q LKG++ KG V+YLDDILIYA NQET+DK LFEVF
Sbjct:    2 KNDGRKWSMMRLNGFHVEMLWDSGASISVISEKCWRLIGSPILMDSRIRLSGVFPKEDEKLLGS-KIVAKWNKKFRKLNVIIVRKIYPDFIGGVDTIKIFGMELKEVNNIESLLVNKRFTDSELLKITLLTLKFDKNTKLGTLIFQFSNIFMASRFDFGHIKVIAHEIKTSDSPILQNSRRQLMHLEGKVEELVQNLLEAGVLRKSQSPWNTPLVIVGKPDDS-------------------------------------KNVSRFQAYYQVELNENSQIKTAFSTKEGQLCFNRLPIGLSTAPATFQKHINQTLKGLVFKGEVLYLDDILIYAENQETYDKLLFEVF 311          

HSP 2 Score: 302.753 bits (774), Expect = 0.000e+0
Identity = 152/216 (70.37%), Postives = 166/216 (76.85%), Query Frame = -3
Query: 3851 IHTHLRNSGLKVNPEKCAFNKSVLNFIGHTVSEKEIQTNKRKISEIENSTEPKSTTELRSFLGLKNYYRRFIKNYSMISAPLYAATTGNDKMIVWTEECRKRFINLKKLLCEAPILKYSMAD*QFIIDTDASFRAMGAILSQIKEDGTEEVIAYGSRNLKKHEMGYCVTRKELLALHEFIVHFRQYLYRRRFVDRTDHKALKFMNTTKKPISPQLQ 4498
            +   +R+SGLK NPEKCAFNKSVLNFIGHTVSEK IQTNKRKISEIEN+TEPKSTTELRSFLGL N+Y+RFIKNYSMI+ PLY ATT                         APIL+Y  AD  FIIDTD SF A+GA+LSQIKEDGTE VIAYGSR+L +HEM YC+TRKEL ALHEFIVHFRQYLY +RFV R DHKAL FMNTTKKPIS Q  
Sbjct:  310 VFIRIRDSGLKANPEKCAFNKSVLNFIGHTVSEKGIQTNKRKISEIENATEPKSTTELRSFLGLTNFYQRFIKNYSMIAEPLYTATT-------------------------APILEYPRADRLFIIDTDDSFGAIGAVLSQIKEDGTEGVIAYGSRHLTEHEMEYCMTRKELFALHEFIVHFRQYLYGKRFVARMDHKALTFMNTTKKPISSQFH 500          
The following BLAST results are available for this feature:
BLAST of SMED30007150 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RTL12.246e-1024.87retrotransposon Gag like 1 [Source:HGNC Symbol;Acc... [more]
RTL12.246e-1024.87retrotransposon Gag like 1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of SMED30007150 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007150 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007150 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FO704673.13.159e-5035.14pep chromosome:GRCz11:12:14545475:14551077:-1 gene... [more]
BX511082.18.884e-4935.10pep chromosome:GRCz11:9:14291932:14297132:1 gene:E... [more]
BX546500.13.102e-4835.89pep chromosome:GRCz11:23:12926092:12931693:-1 gene... [more]
BX890543.13.178e-4834.43pep chromosome:GRCz11:14:42224893:42231293:-1 gene... [more]
BX511224.13.179e-4835.58pep chromosome:GRCz11:2:18017000:18022765:1 gene:E... [more]
back to top
BLAST of SMED30007150 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anxa62.012e-6231.22annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
ENSXETT00000006041.19.116e-5934.84pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
ENSXETT00000035398.15.520e-4330.95pep primary_assembly:Xenopus_tropicalis_v9.1:3:986... [more]
ENSXETT00000034712.11.338e-4230.95pep primary_assembly:Xenopus_tropicalis_v9.1:9:335... [more]
ENSXETT00000042189.11.466e-4230.95pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of SMED30007150 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rtl13.319e-924.35retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:M... [more]
Rtl13.319e-924.35retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of SMED30007150 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20825|POL2_DROME9.299e-5835.87Retrovirus-related Pol polyprotein from transposon... [more]
sp|P04323|POL3_DROME5.404e-5437.44Retrovirus-related Pol polyprotein from transposon... [more]
sp|P10394|POL4_DROME1.002e-5337.68Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q8I7P9|POL5_DROME1.413e-5034.76Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q99315|YG31B_YEAST2.573e-4834.87Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomy... [more]
back to top
BLAST of SMED30007150 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W4XDF91.086e-8744.39Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A087SUZ93.940e-8544.95Retrovirus-related Pol polyprotein from transposon... [more]
A0A4Y2LHW15.730e-8544.84Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ve... [more]
A0A4Y2V3318.525e-8544.39Retrovirus-related Pol polyprotein from transposon... [more]
A0A4Y2G3Y01.598e-8444.39Retrovirus-related Pol polyprotein from transposon... [more]
back to top
BLAST of SMED30007150 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048272.12.556e-8039.91pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000034038.11.462e-7438.24pep primary_assembly:Astyanax_mexicanus-2.0:14:312... [more]
ENSAMXT00000052546.14.228e-7135.32pep primary_assembly:Astyanax_mexicanus-2.0:2:1303... [more]
ENSAMXT00000048059.11.369e-7037.39pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000038088.15.895e-6836.69pep primary_assembly:Astyanax_mexicanus-2.0:23:138... [more]
back to top
BLAST of SMED30007150 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007150 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007150 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007150 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040305.11.146e-8342.60pep primary_assembly:ASM223467v1:1:25459511:254666... [more]
ENSORLT00000036827.13.003e-8043.78pep primary_assembly:ASM223467v1:16:28613823:28617... [more]
ENSORLT00000045141.11.822e-7237.55pep primary_assembly:ASM223467v1:23:22495254:22500... [more]
ENSORLT00000044989.11.990e-7137.66pep primary_assembly:ASM223467v1:1:17572028:175760... [more]
ENSORLT00000032005.16.540e-6839.67pep primary_assembly:ASM223467v1:7:31190450:311944... [more]
back to top
BLAST of SMED30007150 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081257.12.834e-6084.64SMESG000081257.1[more]
SMESG000065302.10.000e+072.63SMESG000065302.1[more]
SMESG000038955.11.860e-3973.75SMESG000038955.1[more]
SMESG000029320.18.789e-4881.95SMESG000029320.1[more]
SMESG000035021.10.000e+069.83SMESG000035021.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007150 ID=SMED30007150|Name=SMED30007150|organism=Schmidtea mediterranea sexual|type=transcript|length=6447bp
TTGGAAAAAAAACTGATGTAAAATGAAGTTTTATTTATTTCCATTGATGA
TTTTAATTATAATTGAATTGTCAATGTCCTGTTTTGAACCGAAAATCGCG
ATGAATTATTGCATAAAACTTAACAATTTTCCAGAATATGACTGGACGCT
GAAGGGCTACGATTTTGGATTCGGTTCGATTGAGGATTTGGAAAATATGT
GCAAAACAAAATGGCATATCGTAATTGTGAAATGCATGCAGAAAATATCA
CAGCAAAACTGCTCATATTCTGATGAAACAAAATTTCAAAAGGTTGTTTG
GGAATTCACACTGAGCAGCGACCGATATGAAAAAGCAGCTGAATATATCT
GCAAAGAATTCAATCTCAACATTTTTGAGCAATACAAAATTAATTGTTTC
CAAAAAAATGAAAAATCGGCGGAAATTTGTTCAATAAAGCGGAAAGAGGC
CTCTGATCAAGGAATTCAATTTTTAAGATTGAACAGCACAATCAATAAAA
ATCAACCTTATCATATCAACGTGCAGAATGTATTGATTATCTACGAATGC
TTGGGTCTCAAAAACAAGCTGAATTGTCTGCAAGAAGTATTGGCGAAGGA
TTGTGCTCCCAACGCCGTGGAGCTGTTGATCAACTATTTCCGTGAGACCT
TACCGAGCAATTGCAATTATAAAAAACTTGATTCAAAAATCATCCAGAAC
AAAAACCATCAATCAGACGCAGAAATTACAAATTCCCAACCCCAAATATC
CTCTATTAATGAATTTAAATTGAGTTCAACGACAATGATACATGATCCAC
TTATCCTTTTAATGGCCATTTCATTTTTATTACTTTTATCAGTATGGTCA
TATTATAAGTTTCTTAGATTTATTGTTGAGGTTTTTTTTAGTTAATATAG
TTTTTCGTAAAATTTTAGTTTACGCTCAGAATGGTCTTCTGCACAAATTT
TAAAACTAAGAGAAAATTTGGAATGGTGAGCCTGTGATGATTACATATTA
TTGAACAACATAAATAATCCATTACTTGTATTAAACATAATAACTGTAAT
AAACGACGCAAAATGTTTTTCAAAGATTGATATGCAAAAAGGTTTTATCT
CAATAAATGCGCAAATGGTCATCAAAACAGCATTAACAAAATAATATAAA
ACGAAATAAAAAAATACATGTGGACTAGCTGGAAATATTTCCTTTTTATC
TGCACAGTTTTTAATTGGTGCCTTTTTTGGTAGATACCTACAAAATGAAT
TTCGCAAGATTCTCAATAGTAAAGTATGTGCAAAAATTACTGCATTAACT
ATACCAGTTGGAATATTTGAATTCAACTTAATGCCTTTCAATTTGTGATA
CACAGCACCAACATTTCAATGATTTATCGAGTCTTACTCTTTAACCTCAG
TTTCTGCCTGTTTAATCTCCGAATTTTCTTTTTTAACATCTGATTCTTCT
TTTGGACTCGAAAGTTTTTCAATAATGTTGGGATTGTTTGGTGTAGTGCA
ACAGGAGATGAAGGTGCACAGAGAATTAATGATATCTTTAAAAAAATTCA
GTGAATTTTCAATGAGTGTACGAAAATTGAAAAAGTGGGTAGATAAAAAA
AGATTATATTCGAATATTTATAACTGATAAATAAATACAAAAAGTTATTC
AAAAATTGATAAAAATTAAAAAATCGATATATTGCGGGGGAAACAGTATA
CTATATATGATATATAGTATATATACTATGTATACTATATATGATATAGC
AAATGGGGAGATGAATGCAAATATATTAATATAAAATCAATGGGGTCACC
AGAAAGATATATTCAATAAATTCAAAAATTAATAAATTATTTATTAGGAA
TGTAGGAACCCCGAGCCATATCAGAAATTAGAGGCATGTGAAGAACCTGA
GGAAATAATTAGATCAATTTTCTCAAAAAATCAATAAACCGAAATTAGTT
TTCGGGTTATTAGAGAAGCGAGAAGTCGCCTACCCAATTAAGGTAGCTAA
AATCTAAATAGTTATTTGATTAAGAGTAGTTTATTGACTAAAAACAGGTA
TAAAAAGGATGAGAGTTGAAGTTTATCAGAGTCGAAATATACGGGATAGT
TGAAGTAAGAAAAAGTGTATCTATATCTGAATTACAGAAGTGAGTCTGAA
AATGATTGAAACCTAATATTAACCAATTTAAAGTAACTCGTGTCCAAAGA
ATAGTGATCTACTGTGGGTGGACCTAACCATATCGCAAATGGACAGATAA
AGAGTTATTTTATTGAAGAATGTGTTGTTTGTGGTAAATGCGAATAAAAT
TTCCTGGTGTAAATGAGGAAATTTCTGGCAAATGAGGATACGAGGAGTTA
GAGAGCAAACCGTCTTATAATTAAATAAACCCAGCAGTACTGATAACAAA
TAAAACTAATACAAATATGGTAATATAAAAAGTATGGAAATACAATATTC
AATAAATAAAAATTAATTAAAAAATTAATGAATAATCAAATTGAATCTAA
AAACTACTCAGTCAAATGCAAAACCCCTTGGCAATAATTAATTAGCCAAA
AGAAAGATCAATAAGTCCAGCTCAAAATAATTTACTTCAAAAATCAACCA
GCCCATCACCAAAGTTTAGAGTGAAATTTGAATCAAGAAAATCAACAAAT
AGTTCAAAAGATGAAGAAGAAATGCCAATTCAATGTAGTCATTGCCAAAG
AATGGGACATCACGTATATCGATGCTGGTTCAAGTGTAATTTTTAAAGAA
CCCCAAGCCAAATTCGGTGTAATCATTTTCAAAGAAAATGACACAGCAAT
AACCAGTGTTGGTCTAAAAATAATATGTAAAGAAACCCGAAGAGAATGTG
ACCAGATTGGCTCAAGGGTAATGGTGAAAAAGTTACAATAAAATGAACAC
CAATAGTAAGTCAAATAATAATAATGTCACTACAAAGATATAGATTAAAT
TTCAAGGTCAAATTTATAGCCACTCTTGCAGAGGTTATGGATGTATGGCA
AGATTTTAAATGATAAATCGCAATCAGGTAATGTAGCTTTTATACAACTA
GATGATTTTAATGAAAGAATCGAAAATGAGATGAAACAAATGAGTAGACG
TTTAGATGTGATGAAGAACTTGATAATCATATGATGTATGATACTCAGTT
AGAAGAGTCAGAGACAGAGTCAAATTCAAAGGTTCCTAAAGATGATTTGG
AATATGAAAAAGTAATAATGATTGTGTTGAGAATATAAGACCTAATGGAA
TCGAGAGCAATAGAGACATCTGAAATAAGATTTCTTGTCAATAAGATTTC
TTTTGTTCGTCCTTTATCTATCTTTCTACTAGCACAAATCTTACATTTAT
TAATACACTGTAATAATCTGATTCATGGATGGCCAAACGAAAAAGTCCTT
TAAATAAAATAAGGTTTTCTTGATACCCAGATAGCATAGTTCAAATGAAA
ATAATTTACTAAACATTTTACGTACGAGTCGGGTACAACCACTGCAAGCT
TTTCATCTGTATTAATCATCAATAAGTCATCTTGTATCTGTAATATCTTC
AAATACTTGAATATACTGCTACTGATTGTTTCATAAGATATGTGAGCCTC
ATTTCCATTAAGATGTGATATGATTTCTGAAGTAACTCTGTCTTCGTTTT
GCTTCTGTTTAATAATTTTCATAATATTTGAACTTCTATATTTGAAGTTC
TACATTTCGTCTCTTTGGCATCTTTGTGTCCCATCTGACAATAAGAGCAT
ATGGTATTAGTTAAACGAGACATATCATCAGCATTTCCATGTACTTCTCG
ATTTATATATTGTAACGCAAAATTGTATTGGATAAATTTGCTATCCATGT
CTGAAGTTGTGGGCTTATTGGTTTTTTTGTTGTATTCATAAATTTCAATG
CCTTGTGATCTGTTCTGTCTACAAATCTTCTCCTATATAAATATTGTCTA
AAATGTACAATAAATTCGTGAAGAGCTAACAACTCTTTTCTAGTCACACA
ATATCCCATTTCATGCTTTTTCAAATTTCTTGAACCATACGCTATCACTT
CTTCGGTGCCGTCTTCCTTAATCTGAGATAAAATTGCACCCATGGCTCTA
AAACTAGCATCCGTATCAATGATAAATTGTCAATCTGCCATTGAATATTT
TAATATTGGTGCTTCACATAAGAGTTTCTTTAAATTGATAAAACGTTTCC
TACATTCTTCAGTCCAAACAATCATTTTGTCATTACCTGTCGTTGCGGCG
TACAAAGGTGCTGATATCATTGAATAATTCTTGATAAATCGCCGATAATA
ATTTTTTAAACCTAGAAATGATCTCAATTCTGTAGTACTCTTTGGCTCAG
TTGAATTTTCAATTTCTGAAATCTTTCTTTTATTTGTTTGAATTTCCTTT
TCACTCACTGTATGACCAATAAAATTTAATACACTTTTATTGAACGCACA
TTTCTCTGGATTGACTTTCAATCCGGAATTTCTAAGGTGTGTGTGAATAC
TTCAAATAGGAATTTATCGTGAGTTTCCTGATTTCCAGCATATATTAAAA
TGTCATCAAGGTACACAACCACTCCTTTGACAATTACTCCTTTCAATATC
TGATGCATCAGTTTCTAAAAAGTGGCAGGAGCTGTTGACAAACCAAATGA
GAACCTATTGAAACAGAACTGTCCTTCTTTTGTACTAAATGCCATCTTGA
TTTGCGAATTTTCATTCAACTCTACTTGATAATAGGCCTGCCCTAAGTCA
ATGGATGAAAATATCTTTGACTTACCTAAGTAATCCAATAATAATTGCAT
GCCTGGCATAGGAAATGAAAACTTTTCTGTAACCGAATTTAATAACCTGA
AATCTAGACACATTCTTATAGAGCCATCTGGTTTTCCAACTATCACTAAT
GGTGTGTTCCACGGACTTTGACATTTACTCACAACTCCAGCTTCTAATAA
ATTCTGTACTAACTCTTCAACTTTGGCTTCTAAATGCATGGGTTGTCTTC
TGGGGTTTTGTAAAATTGGAGGATCTGAAGTCTTTATTTCATGTGTTATT
ACTTTTGTATGACCTAAGTCAAATCTAGATGCCATAAAAATGTTGCTAAA
CTGATATATTAAAGTACCCAACTTCGAATTCTTATCCAACTTGAGTGTCA
AAAACATAATCTTTAACCGATCGGAATCTGTAAATCTCTTGTTAACTAAC
GAAGATTCAATATTATTGACTTCCTTGAGCTGCATGCCAAATATTTTTAT
GCTGTCTACTCCTCCTATGAAATCTAGATGAATTTTCCCAACAATAATAA
CATTCAATTCAAGAAATATTTTGTTTCATTTTGCAACGATTTTAACGCTT
TCGAGAAGTTTTTCATTTTCTTTTGAAAATACTTCACTCACCCGTATTCT
ACTGTCCATCAATATTGAACTGCCAATCAATCCCCAACATTTCTCACTCA
TCACACTGATTGAAGTTCCTGAATCCCATAGCATCTCTACATGAAAAAAA
GTTATTTTCTTCATACTCCACTTTCTGTCATCATTCTTCTTAAACATCAC
ATCATTCTTTTCAACATTTCGTTTTTTAAACTCATCTACTGTCTCGACCC
TACTGATGAAATATAAGCAACGGGGTCTTCTTGGTTTTTTTTGTCTCAAC
ATTATGAATGAGTCGTTCTATCAATTCATCTGATCTATCATCGTTTTCTT
CATGTATACAATAAACTCTTCGTTCTAATCTTTGTGTATTACTTCGTGAT
TTCACTAACAAATTGCAACTTCTAAATGAATGGCCTTCCTTACCGCATAT
TAAGCACTTGTCCTTCAAAGGGCATTCAAATCGTATATGGTCAATTTAAC
CACAACAAAAGCATTGACCAGGTTTTAATCTTTCTTCTACTGGTTCTGGT
AAACCACAACATCTATTATAAATCTTCCGTGCGATATGTTTTATTGAAAC
TAAAGGTGGTGGTCTACGCTCCGTAGTTGTCTTCTCATTATATTGTTATG
CCACGGGTTTCACTTTATCAAATTGTCTTTTGTTTCTTTCATTTCTATTT
TGGTAAGTTATTTCTGTTTGACGATTTGGGTATATTCTGTTATTAAAAGA
TTTTTGAATCCATTGCTTCTGTTTATCTTGAGTAACGTTTGTATAAGTCG
ATTTAACTACTGCTTGAACTTCTTCAAATCGTTCTTTCGTATCATAAACT
TCTCATGCTTCATATACCTTTGTTAAATTTCAAATTTATTCTCTTGTAAT
ATTAACCTTCGTCGATATATTTTTTTTCAAACCGTCGTTCGAATTCTGTG
GTATAAAATCAGTTTGACGATGTTTTCTTTTGAAATGCCACAGTCATAAC
CTTCGTCAATGAGTTTCTTTACTCGAATTTCAAATGTAGCGAATCTTTCA
TCGTTATTTTTTCTCACTGATGATAATTCACAAATTTTATCCATAAT
back to top

protein sequence of SMED30007150-orf-1

>SMED30007150-orf-1 ID=SMED30007150-orf-1|Name=SMED30007150-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=207bp
MQLKEVNNIESSLVNKRFTDSDRLKIMFLTLKLDKNSKLGTLIYQFSNIF
MASRFDLGHTKVITHEIKTSDPPILQNPRRQPMHLEAKVEELVQNLLEAG
VVSKCQSPWNTPLVIVGKPDGSIRMCLDFRLLNSVTEKFSFPMPGMQLLL
DYLGKSKIFSSIDLGQAYYQVELNENSQIKMAFSTKEGQFCFNRFSFGLS
TAPATF*
back to top

protein sequence of SMED30007150-orf-2

>SMED30007150-orf-2 ID=SMED30007150-orf-2|Name=SMED30007150-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=291bp
MKFYLFPLMILIIIELSMSCFEPKIAMNYCIKLNNFPEYDWTLKGYDFGF
GSIEDLENMCKTKWHIVIVKCMQKISQQNCSYSDETKFQKVVWEFTLSSD
RYEKAAEYICKEFNLNIFEQYKINCFQKNEKSAEICSIKRKEASDQGIQF
LRLNSTINKNQPYHINVQNVLIIYECLGLKNKLNCLQEVLAKDCAPNAVE
LLINYFRETLPSNCNYKKLDSKIIQNKNHQSDAEITNSQPQISSINEFKL
SSTTMIHDPLILLMAISFLLLLSVWSYYKFLRFIVEVFFS*
back to top

protein sequence of SMED30007150-orf-3

>SMED30007150-orf-3 ID=SMED30007150-orf-3|Name=SMED30007150-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MLRQKKPRRPRCLYFISRVETVDEFKKRNVEKNDVMFKKNDDRKWSMKKI
TFFHVEMLWDSGTSISVMSEKCWGLIGSSILMDSRIRVSEVFSKENEKLL
ESVKIVAK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001878Znf_CCHC
IPR000477RT_dom
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.778