Sperm surface protein Sp17

Overview
NameSperm surface protein Sp17
Smed IDSMED30007142
Length (bp)1792
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sperm surface protein Sp17 (SMED30007142) t-SNE clustered cells

Violin plots show distribution of expression levels for Sperm surface protein Sp17 (SMED30007142) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sperm surface protein Sp17 (SMED30007142) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sperm surface protein Sp17 (SMED30007142) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007142

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 47

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30007142SMESG000046919.1 Contig367newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007142SMESG000046919.1 Contig367uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007142SMESG000062750.1 Contig367newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007142SMESG000062750.1 Contig367uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30007142SMESG000046919.1 SmedASXL_015865SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30007142SMESG000046919.1 SmedASXL_015863SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30007142SMESG000046919.1 Contig26910uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007142SMESG000046919.1 Contig26910newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007142SMESG000046919.1 Contig3808uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007142SMESG000046919.1 Contig3808newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007142SMESG000046919.1 Contig9154uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007142SMESG000046919.1 Contig9154newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007142SMESG000004166.1 Contig3808uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007142SMESG000004166.1 Contig3808newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30007142SMESG000046919.1 dd_Smed_v4_2279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30007142SMESG000046919.1 dd_Smed_v4_2279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007142SMESG000046919.1 dd_Smed_v4_2279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007142SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30007142SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30007142SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007142SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30007142SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007142SMESG000046919.1 Contig10753newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007142SMESG000046919.1 Contig10753uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007142SMESG000046919.1 Contig36377uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007142SMESG000046919.1 Contig36377newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007142SMESG000046919.1 Contig31036uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007142SMESG000046919.1 Contig31036newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30007142SMESG000046919.1 dd_Smed_v6_2279_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30007142SMESG000046919.1 dd_Smed_v6_4783_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30007142SMESG000046919.1 Contig26910uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30007142SMESG000046919.1 Contig26910newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30007142SMESG000046919.1 dd_Smed_v4_2279_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30007142SMESG000046919.1 dd_Smed_v4_2279_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007142SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30007142SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007142SMESG000046919.1 dd_Smed_v4_2279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007142SMESG000046919.1 dd_Smed_v4_2279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30007142SMESG000046919.1 dd_Smed_v4_2279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30007142SMESG000046919.1 dd_Smed_v4_2279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30007142SMESG000046919.1 dd_Smed_v4_2279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30007142SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30007142SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007142SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007142SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30007142SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30007142SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sperm surface protein Sp17 vs. Ensembl Human
Match: SPA17 (sperm autoantigenic protein 17 [Source:HGNC Symbol;Acc:HGNC:11210])

HSP 1 Score: 97.4413 bits (241), Expect = 3.252e-23
Identity = 63/136 (46.32%), Postives = 88/136 (64.71%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXX---XXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQK 479
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  G+K+EDRFYNNH+F+       +   +E+   + K +          E D +KEE AA+ IQA+FRGH  R+  K
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDP-AEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAK 135          
BLAST of Sperm surface protein Sp17 vs. Ensembl Human
Match: SPA17 (sperm autoantigenic protein 17 [Source:HGNC Symbol;Acc:HGNC:11210])

HSP 1 Score: 97.4413 bits (241), Expect = 3.252e-23
Identity = 63/136 (46.32%), Postives = 88/136 (64.71%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXX---XXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQK 479
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  G+K+EDRFYNNH+F+       +   +E+   + K +          E D +KEE AA+ IQA+FRGH  R+  K
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDP-AEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAK 135          
BLAST of Sperm surface protein Sp17 vs. Ensembl Human
Match: CABYR (calcium binding tyrosine phosphorylation regulated [Source:HGNC Symbol;Acc:HGNC:15569])

HSP 1 Score: 51.6026 bits (122), Expect = 5.920e-8
Identity = 25/51 (49.02%), Postives = 31/51 (60.78%), Query Frame = 3
Query:   96 SNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYD 248
            S  RL VP G + +LEG++R VL+  P NI  FAA YF+EL   R  T  D
Sbjct:    4 SKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMD 54          
BLAST of Sperm surface protein Sp17 vs. Ensembl Human
Match: CABYR (calcium binding tyrosine phosphorylation regulated [Source:HGNC Symbol;Acc:HGNC:15569])

HSP 1 Score: 51.6026 bits (122), Expect = 5.920e-8
Identity = 25/51 (49.02%), Postives = 31/51 (60.78%), Query Frame = 3
Query:   96 SNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYD 248
            S  RL VP G + +LEG++R VL+  P NI  FAA YF+EL   R  T  D
Sbjct:    4 SKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMD 54          
BLAST of Sperm surface protein Sp17 vs. Ensembl Human
Match: CABYR (calcium binding tyrosine phosphorylation regulated [Source:HGNC Symbol;Acc:HGNC:15569])

HSP 1 Score: 51.6026 bits (122), Expect = 5.920e-8
Identity = 25/51 (49.02%), Postives = 31/51 (60.78%), Query Frame = 3
Query:   96 SNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYD 248
            S  RL VP G + +LEG++R VL+  P NI  FAA YF+EL   R  T  D
Sbjct:    4 SKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMD 54          
BLAST of Sperm surface protein Sp17 vs. Ensembl Fly
Match: igl (gene:FBgn0013467 transcript:FBtr0087362)

HSP 1 Score: 45.8246 bits (107), Expect = 9.649e-6
Identity = 19/28 (67.86%), Postives = 25/28 (89.29%), Query Frame = 3
Query:  759 IDIDLTDPDVEKAAVKIQSAFKGFKTRK 842
            +DIDLTDP++ KAA KIQ++F+G KTRK
Sbjct:   90 LDIDLTDPELNKAATKIQASFRGHKTRK 117          
BLAST of Sperm surface protein Sp17 vs. Ensembl Fly
Match: igl (gene:FBgn0013467 transcript:FBtr0332267)

HSP 1 Score: 45.8246 bits (107), Expect = 9.649e-6
Identity = 19/28 (67.86%), Postives = 25/28 (89.29%), Query Frame = 3
Query:  759 IDIDLTDPDVEKAAVKIQSAFKGFKTRK 842
            +DIDLTDP++ KAA KIQ++F+G KTRK
Sbjct:   90 LDIDLTDPELNKAATKIQASFRGHKTRK 117          
BLAST of Sperm surface protein Sp17 vs. Ensembl Zebrafish
Match: spa17 (sperm autoantigenic protein 17 [Source:ZFIN;Acc:ZDB-GENE-061027-337])

HSP 1 Score: 106.301 bits (264), Expect = 1.641e-23
Identity = 48/70 (68.57%), Postives = 57/70 (81.43%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFY 290
            MAVP+SNT LR+P+GF N+LEGL REVLR QPE+I +FAA YF ELL+ R+E+G  D A  GAKLEDRFY
Sbjct:    1 MAVPFSNTHLRIPRGFGNLLEGLTREVLREQPEDIATFAAVYFTELLKAREESGL-DPAEWGAKLEDRFY 69          
BLAST of Sperm surface protein Sp17 vs. Ensembl Xenopus
Match: mettl4 (methyltransferase like 4 [Source:Xenbase;Acc:XB-GENE-992320])

HSP 1 Score: 95.9005 bits (237), Expect = 2.415e-20
Identity = 59/148 (39.86%), Postives = 85/148 (57.43%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEE--------QQSAAVKIQSEYRRFAAKK-------EVDTKKEEEAAIVIQASFRGHFERQNQK 479
            M++P+SNT  R+P+GF N+LEGL REVLR QP++I  F A YF +LL+ RQ+T +D  A  GA LEDRFYNN+ F++        E        ++S ++   S+    +          E D  ++ +AA  IQA+FRG+  R   K
Sbjct:    1 MSIPFSNTHYRIPRGFANLLEGLTREVLRHQPKDIPLFGAKYFSQLLQQRQDTDFDP-AQWGAALEDRFYNNYDFQHTELKKYTSEPSELKKSKRKSFSMLDNSDTYPLSPSTSLEQKEIETDDMRKMQAATTIQAAFRGYNVRHKVK 147          
BLAST of Sperm surface protein Sp17 vs. Ensembl Mouse
Match: Spa17 (sperm autoantigenic protein 17 [Source:MGI Symbol;Acc:MGI:1333778])

HSP 1 Score: 97.4413 bits (241), Expect = 2.670e-23
Identity = 66/151 (43.71%), Postives = 96/151 (63.58%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQS-AAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTN 530
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  GAK+EDRFYNNH+FK        E++ + ++ + ++    F    E + ++EE AA+ IQ+ FRGH  R        EE+ ++ SD   N
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKREKTSFDP-AEWGAKVEDRFYNNHAFKEQEQVEKCEQELAKSSGREETPVTPFEESTEEEREQEEAAALKIQSLFRGHVAR--------EEVKKMKSDKNEN 142          
BLAST of Sperm surface protein Sp17 vs. Ensembl Mouse
Match: Spa17 (sperm autoantigenic protein 17 [Source:MGI Symbol;Acc:MGI:1333778])

HSP 1 Score: 93.5893 bits (231), Expect = 3.069e-22
Identity = 61/131 (46.56%), Postives = 89/131 (67.94%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQS-AAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQ 470
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  GAK+EDRFYNNH+FK        E++ + ++ + ++    F    E + ++EE AA+ IQ+ FRGH  R+
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKREKTSFDP-AEWGAKVEDRFYNNHAFKEQEQVEKCEQELAKSSGREETPVTPFEESTEEEREQEEAAALKIQSLFRGHVARE 130          
BLAST of Sperm surface protein Sp17 vs. Ensembl Mouse
Match: Cabyr (calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2) [Source:MGI Symbol;Acc:MGI:1918382])

HSP 1 Score: 53.9138 bits (128), Expect = 6.361e-8
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 3
Query:   96 SNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDI 254
            S  RL VP G + +LEG++R +L+  P NI  FAA YF+EL+  R+     DI
Sbjct:    4 SKPRLVVPYGLKTLLEGVSRAILKTNPTNITQFAAVYFKELIVFREGNSSLDI 56          
BLAST of Sperm surface protein Sp17 vs. Ensembl Mouse
Match: Cabyr (calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2) [Source:MGI Symbol;Acc:MGI:1918382])

HSP 1 Score: 53.9138 bits (128), Expect = 1.123e-7
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 3
Query:   96 SNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDI 254
            S  RL VP G + +LEG++R +L+  P NI  FAA YF+EL+  R+     DI
Sbjct:    4 SKPRLVVPYGLKTLLEGVSRAILKTNPTNITQFAAVYFKELIVFREGNSSLDI 56          
BLAST of Sperm surface protein Sp17 vs. Ensembl Mouse
Match: Cabyr (calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2) [Source:MGI Symbol;Acc:MGI:1918382])

HSP 1 Score: 54.6842 bits (130), Expect = 2.359e-7
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 3
Query:   96 SNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDI 254
            S  RL VP G + +LEG++R +L+  P NI  FAA YF+EL+  R+     DI
Sbjct:    4 SKPRLVVPYGLKTLLEGVSRAILKTNPTNITQFAAVYFKELIVFREGNSSLDI 56          
BLAST of Sperm surface protein Sp17 vs. UniProt/SwissProt
Match: sp|P36425|SP17_RABIT (Sperm surface protein Sp17 OS=Oryctolagus cuniculus OX=9986 GN=SPA17 PE=1 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 4.200e-28
Identity = 65/133 (48.87%), Postives = 90/133 (67.67%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQK 479
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  GAK++DRFYNNH+F+   +     E++S +V  + E        E D  KEE AA+ IQA+FRGH  R++ K
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKREKTNFDP-AEWGAKVDDRFYNNHAFQEHESEKCEAEEKSQSV-TEEETPVLTIDSEDDKDKEEMAALKIQAAFRGHLAREDVK 131          
BLAST of Sperm surface protein Sp17 vs. UniProt/SwissProt
Match: sp|O19021|SP17_MACFA (Sperm surface protein Sp17 OS=Macaca fascicularis OX=9541 GN=SPA17 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 5.203e-23
Identity = 66/161 (40.99%), Postives = 95/161 (59.01%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQ----------SAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQ 533
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  G+K+EDRFYNNH+F+       ++ +Q           A+V I         K+EV       AA+ IQA+FRGH  R        EE+ ++ +D+  N+
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDP-AEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQIPGKEEEASVTILDSSEEDKEKEEV-------AAVKIQAAFRGHVAR--------EEVKKMKTDSLQNE 145          
BLAST of Sperm surface protein Sp17 vs. UniProt/SwissProt
Match: sp|Q95230|SP17_PAPHA (Sperm surface protein Sp17 OS=Papio hamadryas OX=9557 GN=SPA17 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 8.740e-23
Identity = 66/154 (42.86%), Postives = 96/154 (62.34%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXX---XXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQ 533
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  G+K+EDRFYNNH+F+       +   +E+   + K +          E D +KEE AA+ IQA+FRGH  R        EE+ ++ +D+  N+
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDP-AEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQVSGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHVAR--------EEVKKMKTDSLQNE 145          
BLAST of Sperm surface protein Sp17 vs. UniProt/SwissProt
Match: sp|Q15506|SP17_HUMAN (Sperm surface protein Sp17 OS=Homo sapiens OX=9606 GN=SPA17 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.562e-22
Identity = 63/136 (46.32%), Postives = 88/136 (64.71%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXX---XXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQK 479
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  G+K+EDRFYNNH+F+       +   +E+   + K +          E D +KEE AA+ IQA+FRGH  R+  K
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDP-AEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAK 135          
BLAST of Sperm surface protein Sp17 vs. UniProt/SwissProt
Match: sp|Q62252|SP17_MOUSE (Sperm surface protein Sp17 OS=Mus musculus OX=10090 GN=Spa17 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.867e-22
Identity = 66/151 (43.71%), Postives = 96/151 (63.58%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQS-AAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTN 530
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  GAK+EDRFYNNH+FK        E++ + ++ + ++    F    E + ++EE AA+ IQ+ FRGH  R        EE+ ++ SD   N
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKREKTSFDP-AEWGAKVEDRFYNNHAFKEQEQVEKCEQELAKSSGREETPVTPFEESTEEEREQEEAAALKIQSLFRGHVAR--------EEVKKMKSDKNEN 142          
BLAST of Sperm surface protein Sp17 vs. TrEMBL
Match: A0A210PVC9 (Sperm surface protein Sp17 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT22352 PE=4 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 7.012e-58
Identity = 164/382 (42.93%), Postives = 231/382 (60.47%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSNLKEN-DMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTR---KANEDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKATIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRKTIK 1214
            MAVP+SNT+LRVPKGFQN+LEGLAREVLR QPENIY F A YF++LLR+R ETG+D  A+ GA++EDRFYNN +F++P  ++ + +QQ AA+KIQ+EYRR +AKKEVD  +EE+AA  IQA  RGH +RQ        ++D I       +    DI        N+++PE+    E+  +    G    ++ Y          +++  +KE+ + + E  +  +E +DIDL DP+V KAA KIQ+ F+G KTR   K++ED P     ++ EN EP+++          IDL DPEV KA  KIQ+ FKG+++RK +      +  Q L       +K  +       +  DID NDPDV KAA KIQ+ +KG + RK I+
Sbjct:    1 MAVPFSNTKLRVPKGFQNILEGLAREVLRNQPENIYEFGAKYFDQLLRVRDETGHDP-AVHGARMEDRFYNNDAFRSPGVDSGDPQQQDAALKIQTEYRRHSAKKEVDDMREEDAATTIQAGVRGHQDRQ--------KVDEIKEGEARLKSAEVDI--------NLEDPEV----EAAAVKIQAG----FKGY----------KARKEVKESKEAQEESPEEKKEEVDIDLEDPEVAKAATKIQAGFRGHKTRKELKSSEDAP----KSETENAEPEKID---------IDLNDPEVAKAATKIQAGFKGYKTRKEM------NGKQPLS------DKDSRTSGLDKCDTDDIDFNDPDVAKAATKIQANFKGHQVRKEIR 322          

HSP 2 Score: 97.4413 bits (241), Expect = 3.469e-17
Identity = 112/318 (35.22%), Postives = 158/318 (49.69%), Query Frame = 3
Query:  348 AAVKIQSEYRRFAAKKEVDTKKE--------------------------EEAAIVIQASFRGHFERQNQKPN-SNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSNLKENDMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRKANEDTPIAPVTNDEENPE----PKRLQXXXXXXXX-XXXXXXXXVEKATIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRK 1205
            AA KIQ+ ++ +  +KE++ K+                            +AA  IQA+F+GH  R+  + N S  E DR  +D   +   +   ++N  +  ++ +PE+           A      Y+          + E KS         E +   EEIIDIDLTDP+VEKAAVKIQS+FKG + RK+   T  A  T+ E  P     P  L    E +   DIDL DPEVEKA +KIQ+TFKG +SR+     +    + +L  ++      DKV     EE IDIDLNDP+V KAA+KIQS +KG ++RK
Sbjct:  253 AATKIQAGFKGYKTRKEMNGKQPLSDKDSRTSGLDKCDTDDIDFNDPDVAKAATKIQANFKGHQVRKEIRKNQSAPETDRGHTDIHCSDDKHVMDDDNNEIDIDLSDPEVEKA--------ATKIQAGYKGLKTRRELKSIQEPKSTSIPVRDSMENVPTEEEIIDIDLTDPEVEKAAVKIQSSFKGLRARKSK--TASAASTSVESEPSNTTPPCPLSVKTEQQEEIDIDLNDPEVEKAAVKIQATFKGLKSRRF--GAKKSSPTNNLNNMKPVTPPVDKVPV---EEEIDIDLNDPEVAKAALKIQSTFKGLKSRK 555          

HSP 3 Score: 92.4337 bits (228), Expect = 1.295e-15
Identity = 74/155 (47.74%), Postives = 91/155 (58.71%), Query Frame = 3
Query:  759 IDIDLTDPDVEKAAVKIQSAFKGFKTRKANEDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKATIKIQSTFKGFRSR-----KTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRKT 1208
            IDIDL DP+VEKAAVKIQ+ FKG K+RK         + N    P P     I  +E IDIDL DPEVEKA +KIQ+TFKG +SR     K +  ++    S H++     +E+ D            IDL DPDVEKAAVKIQ+ +KG R RKT
Sbjct:  702 IDIDLNDPEVEKAAVKIQATFKGLKSRKFGSKKSSPSLVNKIPTPPP--TVNIPSEEEIDIDLNDPEVEKAAVKIQATFKGLKSRKFGKSKPVAPLKQPPSSNHVDAKSSEVEEID------------IDLTDPDVEKAAVKIQASFKGLRARKT 842          

HSP 4 Score: 92.0485 bits (227), Expect = 1.711e-15
Identity = 69/159 (43.40%), Postives = 98/159 (61.64%), Query Frame = 3
Query:  747 SEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRKANEDTPIAPVTNDEENPEPKRLQXXXXXXXX-XXXXXXXXVEKATIKIQSTFKGFRSRKT--LEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRKTIK 1214
            SEE IDIDL DP+VEKAAVKIQ+ FKG K+RK  +  P+AP+   ++ P    +     +    DIDLTDP+VEKA +KIQ++FKG R+RKT   +E    +  +  E  EE ++               IDLNDP+  +AA+KIQ+ ++G++ RK +K
Sbjct:  754 SEEEIDIDLNDPEVEKAAVKIQATFKGLKSRKFGKSKPVAPL---KQPPSSNHVDAKSSEVEEIDIDLTDPDVEKAAVKIQASFKGLRARKTKNQQEAAPKEAEKKTEAQEEEID---------------IDLNDPETAQAALKIQAGFRGYKTRKEVK 894          

HSP 5 Score: 85.8853 bits (211), Expect = 1.564e-13
Identity = 98/338 (28.99%), Postives = 162/338 (47.93%), Query Frame = 3
Query:  336 EQQSAAVKIQSEY-----RRFAAKKEVDTKKE----------------------------EEAAIVIQASFRGHFERQ-NQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSNLKENDMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRKANEDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVE--KATIKIQSTFKGFRSRKTLEEM--QTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXX------LNDPDVEKAAVKIQSVYKGFRNRKTIKG 1217
            E + AA+KIQS +     R+F AKK   T  E                            E+AA+ IQA+F+G   R+   K +S   +++IP+   T      +I     +  ++++PE+    ++     A  +    +++        L +  S+    D K  E+    E IDIDLTDPDVEKAAVKIQ++FKG + RK          T +++   PK  ++  E +  +ID+   + E  +A +KIQ+ F+G+++RK ++E     GD+++  +  EE     +       +     +      LNDP+V KAA KIQ+ +KG++ RK +KG
Sbjct:  652 EVEKAALKIQSTFKGLKSRKFGAKKSSPTNIENVSPPVPPPPVTPPVKEEIDIDLNDPEVEKAAVKIQATFKGLKSRKFGSKKSSPSLVNKIPTPPPT-----VNIPSEEEIDIDLNDPEV---EKAAVKIQATFKGLKSRKFGKSKPVAPLKQPPSS-NHVDAKSSEV----EEIDIDLTDPDVEKAAVKIQASFKGLRARK----------TKNQQEAAPKEAEKKTEAQEEEIDIDLNDPETAQAALKIQAGFRGYKTRKEVKENLESEGDKTEGEKPSEETKTTEEAKPEEEAKTEKTKEEPVDIDLNDPEVAKAATKIQAGFKGYKVRKDMKG 966          

HSP 6 Score: 83.9593 bits (206), Expect = 6.132e-13
Identity = 100/319 (31.35%), Postives = 150/319 (47.02%), Query Frame = 3
Query:  336 EQQSAAVKIQSEYRRFAAKKEVDTKKEEE----------------------AAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSNLKENDMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRKANEDTPIAPVTN----DEENPEPKRLQXXXXXXXXXXXXXXXXVEKATIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVE--ENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRKT 1208
            E ++AAVKIQ+ ++ + A+KEV   KE +                      AA  IQA FRGH  R+  K  S+E       DA  ++  N + E+   +  ++++PE+           A      ++ Y            K  L + D +   L   +   DID  DPDV KAA KIQ+ FKG + RK       AP T+    D    + K + +   +EI         VEKA  KIQ+ +KG ++R+ L+ +Q   +S  + + +  EN+   +++        IDIDL DP+VEKAAVKIQS +KG R RK+
Sbjct:  154 EVEAAAVKIQAGFKGYKARKEVKESKEAQEESPEEKKEEVDIDLEDPEVAKAATKIQAGFRGHKTRKELK--SSE-------DAPKSETENAEPEK---IDIDLNDPEVAKA--------ATKIQAGFKGYKTRKEMN----GKQPLSDKDSRTSGLDKCD-TDDIDFNDPDVAKAATKIQANFKGHQVRKEIRKNQSAPETDRGHTDIHCSDDKHVMDDDNNEIDIDLSDPE-VEKAATKIQAGYKGLKTRRELKSIQE-PKSTSIPVRDSMENVPTEEEI--------IDIDLTDPEVEKAAVKIQSSFKGLRARKS 437          

HSP 7 Score: 80.4925 bits (197), Expect = 8.609e-12
Identity = 77/160 (48.12%), Postives = 95/160 (59.38%), Query Frame = 3
Query:  762 DIDLTDPDVEKAAVKIQSAFKGFKTRK--ANEDTPIAPVTNDEENPEPKRLQXXXXXXXXX--XXXXXXXVEKATIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRKTIKG-PVA 1226
            DIDL DP+VEKAA+KIQS FKG K+RK  A + +P    TN E    P     +      +  IDL DPEVEKA +KIQ+TFKG +SRK       G +     +V +       V     EE IDIDLNDP+VEKAAVKIQ+ +KG ++RK  K  PVA
Sbjct:  645 DIDLNDPEVEKAALKIQSTFKGLKSRKFGAKKSSP----TNIENVSPPVPPPPVTPPVKEEIDIDLNDPEVEKAAVKIQATFKGLKSRK------FGSKKSSPSLVNKIPTPPPTVN-IPSEEEIDIDLNDPEVEKAAVKIQATFKGLKSRKFGKSKPVA 793          

HSP 8 Score: 77.7962 bits (190), Expect = 4.545e-11
Identity = 107/344 (31.10%), Postives = 154/344 (44.77%), Query Frame = 3
Query:  336 EQQSAAVKIQSEYRRFAAKKE------------------------VDTKKEEE------------AAIVIQASFRG----HFERQNQKPNSN--------EEIDRIPSDAQTN-QHNNTDIEENTL----VHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSNLKENDMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRK-ANEDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKATIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRK 1205
            E + AAVKIQS ++   A+K                         V T+++EE            AA+ IQA+F+G     F  +   P +N          +D++P + + +   N+ ++ +  L        +   +      S+  PP +  N                            P      E+ IDIDL DP+V KAAVKIQS FKG K+RK   + +  +P +N E +P       +  +E +DIDL DPEVEKA +KIQSTFKG +SRK         +S    I   +            +E IDIDLNDP+VEKAAVKIQ+ +KG ++RK
Sbjct:  417 EVEKAAVKIQSSFKGLRARKSKTASAASTSVESEPSNTTPPCPLSVKTEQQEEIDIDLNDPEVEKAAVKIQATFKGLKSRRFGAKKSSPTNNLNNMKPVTPPVDKVPVEEEIDIDLNDPEVAKAALKIQSTFKGLKSRKFGKNKTSQSSPPINNVNPTPS------------------------PPVTAPVEDEIDIDLNDPEVAKAAVKIQSTFKGLKSRKIKTKQSTQSPPSNIEPSPP--PPVPVPTEEEVDIDLNDPEVEKAALKIQSTFKGLKSRKF-----GAKKSSPTNIENVSPPVPPPPVTPPVKEEIDIDLNDPEVEKAAVKIQATFKGLKSRK 729          
BLAST of Sperm surface protein Sp17 vs. TrEMBL
Match: K1PZL4 (Sperm surface protein Sp17 OS=Crassostrea gigas OX=29159 GN=CGI_10005609 PE=4 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.488e-45
Identity = 136/387 (35.14%), Postives = 216/387 (55.81%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQ------------NQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSNLKENDMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRKANEDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKATIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRK 1205
            MAVP+SNT+LRVPKGFQN+LEGLARE LR QPENIY F A YF++L+++R++TG+D  A+ GA+LEDRFYNN SF++P+T+  + +QQ AA+KIQ+E+RR  A++EV+  KEE+AA+ IQ+ FRG  +RQ             QK  ++E + +  S       ++ DI        ++D+PE+ +         A      ++ Y    ++  + + K     +     +L + +E+ D          AA KIQ+ F+G KTR+  ++       +                  +  ++   E+E A + IQ+ F+G+++RK ++ +    +SQ  +  EE ++               IDLNDPDVE+AA+KIQ+ +KG++ RK
Sbjct:    1 MAVPFSNTKLRVPKGFQNILEGLARECLRSQPENIYEFGAKYFQQLIQVREQTGHDP-AVHGARLEDRFYNNDSFQSPSTDPGDPQQQEAALKIQTEFRRHHAEQEVEHMKEEDAAVKIQSGFRGFQDRQKVLEMKDPEAYAKQKEEADERLSKGGSS-----KDSVDI--------DLDDPEVAE--------AAVKIQAGFKGY---KARKEVKDKKEKASTDSKSDSQLPSEKEMAD----------AATKIQAGFRGHKTRQDMKEKKEKGKED------------------MLSEINKSELENAVVHIQAGFRGYQARKEMKHLM---DSQPAKQPEEEVD---------------IDLNDPDVEQAALKIQAGFKGYKTRK 316          

HSP 2 Score: 92.4337 bits (228), Expect = 6.718e-16
Identity = 100/316 (31.65%), Postives = 157/316 (49.68%), Query Frame = 3
Query:  336 EQQSAAVKIQSEYRRFAAKKEVD-------TKKEEE-------------AAIVIQASFRGHFERQ---NQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSNLKENDMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRKANEDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKATIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRKTIK 1214
            E ++A V IQ+ +R + A+KE+         K+ EE             AA+ IQA F+G+  R+   ++K  S+E I+     A  N+    DI        ++++P         D+  A  + Q      I+  ++  D +KS++ + +  P   Q SEE+IDIDL DP+VEKAA+KIQ+ FKGF  RKA + T        E  PE          E       D E E+A +KIQ+ F+G+++R+ ++E    +E +  E  E +++                 LNDPDVE+AA+KIQ+ +KG++ RK IK
Sbjct:  252 ELENAVVHIQAGFRGYQARKEMKHLMDSQPAKQPEEEVDIDLNDPDVEQAALKIQAGFKGYKTRKEFESKKMESSEVIN-----AGKNEEEEVDI--------DLNDP---------DVANAAVKIQAGFRAHIKAKKS--DTAKSSVTK-ESSPVAEQESEEVIDIDLNDPEVEKAALKIQAGFKGF--RKAKKATTQDQTDKTESKPE----------EETSSKAADKETEEAALKIQAGFRGYKTRQEVKEQMAKEEKKGEEQEEVDID-----------------LNDPDVEQAALKIQAGFKGYQARKEIK 513          
BLAST of Sperm surface protein Sp17 vs. TrEMBL
Match: A0A1I8IBG4 (RIIa domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 5.836e-42
Identity = 141/413 (34.14%), Postives = 205/413 (49.64%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEE--QQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSNLKENDM---KPEELQ------------------NSEEIIDIDLTDPDVEKAAVKIQSAFKGF----KTRKANEDTPIAPVTNDEE------NPEPKRLQXXXXXXXXXXXXXXXXVEKATIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRKTIKGP 1220
            M+ P SN+RLRVP GFQ +LEG  REVLR QP +IYSF A YFEE+LR R+ETG +D A L  +L+DR  N   F +     +  +  QQ A+V IQS++RR AA++E +  + + AA  IQA+ RGH ER+N              D+ T   ++ D  E   V  ++++PE+           A      ++ Y         D+ K +  E D+    PE  +                  N+ + +DIDLTDP+V  AA KIQ+ FKG+    + ++  ++    P   D E      +PE                     V  A  KIQ+ FKG+++RK +++ Q  DE Q  E       K+D+       E +DIDL DP+V  AA KIQ+ +KG++ RK +K P
Sbjct:    1 MSAPISNSRLRVPHGFQALLEGFTREVLRNQPSDIYSFGALYFEEMLRRREETGEEDPAQLALRLQDRLRNGAKFGDGRVIGDASDARQQQASVVIQSDFRRRAAQREAEQLRRDRAAGDIQAAVRGHQERRN-------------GDSAT--RDDQDAAEEDEVDIDLNDPEVA--------AAAEKIQAGFKGYKTRKQMKNQDKKKPDEDEVDIDLNDPEGYKTRKQMKQQQQQSSKPSGENATDEVDIDLTDPEVGAAAEKIQAGFKGYKTRKQMKQQKQEQQTKPAEADTEVDIDLTDPE---------------------VGAAAEKIQAGFKGYKTRKQMKQQQ--DEKQQSEA------KADE-------EEVDIDLTDPEVGAAAEKIQAGFKGYKTRKQMKQP 354          
BLAST of Sperm surface protein Sp17 vs. TrEMBL
Match: A0A1I8H9A3 (RIIa domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.482e-41
Identity = 137/402 (34.08%), Postives = 200/402 (49.75%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEE--QQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSNLKEN------------DMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGF----KTRKANEDTPIAPVTNDEE------NPEPKRLQXXXXXXXXXXXXXXXXVEKATIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRKTIK 1214
            M+ P SN+RLRVP GFQ +LEG  REVLR QP +IYSF A YFEE+LR R+ETG +D A L  +L+DR  N   F +     +  +  QQ A+V IQS++RR AA++E +  + + AA  IQA+ RGH ER+N              D+ T   ++ D  E   V  ++++PE+           A      ++ Y         D+ K +  E                    +N+ + +DIDLTDP+V  AA KIQ+ FKG+    + ++  ++    P   D E      +PE                     V  A  KIQ+ FKG+++RK +++ Q  DE Q  E       K+D+       E +DIDL DP+V  AA KIQ+ +KG++ RK +K
Sbjct:    1 MSAPISNSRLRVPHGFQALLEGFTREVLRNQPSDIYSFGALYFEEMLRRREETGEEDPAQLALRLQDRLRNGAKFGDGRVVGDASDARQQQASVVIQSDFRRRAAQREAEQLRRDRAAGDIQAAVRGHQERRN-------------GDSAT--RDDQDAAEEDEVDIDLNDPEVA--------AAAEKIQAGFKGYKTRKQMKNQDKKKPDEDEGYKTRKQMKQQQQQSSKPSGENATDEVDIDLTDPEVGAAAEKIQAGFKGYKTRKQMKQQKQEQQTKPAEADTEVDIDLTDPE---------------------VGAAAEKIQAGFKGYKTRKQMKQQQ--DEKQQSEA------KADE-------EEVDIDLTDPEVGAAAEKIQAGFKGYKTRKQMK 343          
BLAST of Sperm surface protein Sp17 vs. TrEMBL
Match: A0A1I8I308 (RIIa domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 3.338e-41
Identity = 140/411 (34.06%), Postives = 204/411 (49.64%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEE--QQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSNLKENDM---KPEELQ------------------NSEEIIDIDLTDPDVEKAAVKIQSAFKGF----KTRKANEDTPIAPVTNDEE------NPEPKRLQXXXXXXXXXXXXXXXXVEKATIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRKTIK 1214
            M+ P SN+RLRVP GFQ +LEG  REVLR QP +IYSF A YFEE+LR R+ETG +D A L  +L+DR  N   F +     +  +  QQ A+V IQS++RR AA++E +  + + AA  IQA+ RGH ER+N              D+ T   ++ D  E   V  ++++PE+           A      ++ Y         D+ K +  E D+    PE  +                  N+ + +DIDLTDP+V  AA KIQ+ FKG+    + ++  ++    P   D E      +PE                     V  A  KIQ+ FKG+++RK +++ Q  DE Q  E       K+D+       E +DIDL DP+V  AA KIQ+ +KG++ RK +K
Sbjct:    1 MSAPISNSRLRVPHGFQALLEGFTREVLRNQPSDIYSFGALYFEEMLRRREETGEEDPAQLALRLQDRLRNGAKFGDGRVIGDVSDARQQQASVVIQSDFRRRAAQREAEQLRRDRAAGDIQAAVRGHQERRN-------------GDSAT--RDDQDAAEEDEVDIDLNDPEVA--------AAAEKIQAGFKGYKTRKQMKNQDKKKPDEDEVDIDLNDPEGYKTRKQMKQQQQQSSKPSGENATDEVDIDLTDPEVGAAAEKIQAGFKGYKTRKQMKQQKQEQQTKPAEADTEVDIDLTDPE---------------------VGAAAEKIQAGFKGYKTRKQMKQQQ--DEKQQSEA------KADE-------EEVDIDLTDPEVGAAAEKIQAGFKGYKTRKQMK 352          
BLAST of Sperm surface protein Sp17 vs. Ensembl Cavefish
Match: ENSAMXT00000046795.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:22320681:22325023:1 gene:ENSAMXG00000038900.1 transcript:ENSAMXT00000046795.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.8265 bits (242), Expect = 3.507e-23
Identity = 46/70 (65.71%), Postives = 55/70 (78.57%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFY 290
            M+VP+SNT LRVP GF N+LEGLAREVLR QP++I +FAA YF  LL+ R E+G D  A  GA+LEDRFY
Sbjct:    1 MSVPFSNTNLRVPHGFGNILEGLAREVLREQPDDIPTFAAVYFTALLKQRDESGLDP-AEWGARLEDRFY 69          
BLAST of Sperm surface protein Sp17 vs. Ensembl Nematostella
Match: EDO46037 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR24])

HSP 1 Score: 102.449 bits (254), Expect = 1.177e-25
Identity = 62/138 (44.93%), Postives = 85/138 (61.59%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKK-----EEEAAIVIQASFRGHFERQNQK 479
            MAV Y+ T+LRVP GFQN+LEGLAREVLR QP++I  FAA YF+  L +R+ETG DD     AK  +        +  + + ++ E Q AA KIQ+ +R    ++++   K     EE AA+ IQ+SFRGH  R+  K
Sbjct:    1 MAVQYAPTKLRVPPGFQNLLEGLAREVLREQPDDIVQFAAQYFKNQLSIREETGKDD-----AKRGENLEKLMKGEEVDIDIDDPEVQKAATKIQASFRGHKTREQIKQDKQQKDEEEAAALKIQSSFRGHKAREEVK 133          

HSP 2 Score: 49.6766 bits (117), Expect = 2.773e-7
Identity = 35/100 (35.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  732 EELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRKANEDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKATIKIQSTFKGFRSRKTLEEM 1031
            E+L   EE+ DID+ DP+V+KAA KIQ++F+G KTR   E         DEE                         E A +KIQS+F+G ++R+ ++E+
Sbjct:   65 EKLMKGEEV-DIDIDDPEVQKAATKIQASFRGHKTR---EQIKQDKQQKDEE-------------------------EAAALKIQSSFRGHKAREEVKEL 135          
BLAST of Sperm surface protein Sp17 vs. Ensembl Nematostella
Match: EDO35043 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMM3])

HSP 1 Score: 71.633 bits (174), Expect = 6.507e-15
Identity = 35/62 (56.45%), Postives = 45/62 (72.58%), Query Frame = 3
Query:  105 RLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFY 290
            +L VP GF+N+LE L  E+LR +P+NI SFAAD+F E L  RQ  GYDD  LLG+++ D FY
Sbjct:    7 KLSVPSGFRNLLESLTVEILRVRPDNIPSFAADFFRERLAARQRNGYDD-CLLGSQI-DGFY 66          
BLAST of Sperm surface protein Sp17 vs. Ensembl Medaka
Match: ENSORLT00000038228.1 (sperm autoantigenic protein 17 [Source:NCBI gene;Acc:105355434])

HSP 1 Score: 83.9593 bits (206), Expect = 1.784e-16
Identity = 39/70 (55.71%), Postives = 49/70 (70.00%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFY 290
            M+  +    LRVP+G   V+EGLAREVLR QPENI  +AA+YF  LLR R+E+G  D A   AKLEDR++
Sbjct:    1 MSAHFFTAHLRVPRGLGAVIEGLAREVLRDQPENIPEYAANYFNGLLRQREESGV-DPAAWAAKLEDRYH 69          
BLAST of Sperm surface protein Sp17 vs. Ensembl Medaka
Match: ENSORLT00000038630.1 (sperm autoantigenic protein 17 [Source:NCBI gene;Acc:105355434])

HSP 1 Score: 83.9593 bits (206), Expect = 1.800e-16
Identity = 39/70 (55.71%), Postives = 49/70 (70.00%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFY 290
            M+  +    LRVP+G   V+EGLAREVLR QPENI  +AA+YF  LLR R+E+G  D A   AKLEDR++
Sbjct:    1 MSAHFFTAHLRVPRGLGAVIEGLAREVLRDQPENIPEYAANYFNGLLRQREESGV-DPAAWAAKLEDRYH 69          
BLAST of Sperm surface protein Sp17 vs. Planmine SMEST
Match: SMESG000046919.1 (SMESG000046919.1)

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 337/426 (79.11%), Postives = 338/426 (79.34%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSNLKENDMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRKANEDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKATIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRKTIKGPVAGGHGDYVETHEKVNEDLEFDHENQEVPTDEITNVTDNMINEAEQ 1358
            MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDS TMLDESKS+LKENDMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRKANEDTPIAPVTNDEENP                                           EEMQTGDESQHLEIVEENLE                                            GPVAGGHGDYVETHEKVNEDLEFDHENQEVPTDEITNVTDNMINEAEQ
Sbjct:    1 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSHTMLDESKSSLKENDMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRKANEDTPIAPVTNDEENP-------------------------------------------EEMQTGDESQHLEIVEENLE--------------------------------------------GPVAGGHGDYVETHEKVNEDLEFDHENQEVPTDEITNVTDNMINEAEQ 339          

HSP 2 Score: 59.6918 bits (143), Expect = 5.055e-9
Identity = 27/27 (100.00%), Postives = 27/27 (100.00%), Query Frame = 3
Query: 1359 THEDNPESGGPTNDTDEAATSRTEPDE 1439
            THEDNPESGGPTNDTDEAATSRTEPDE
Sbjct:  596 THEDNPESGGPTNDTDEAATSRTEPDE 622          
BLAST of Sperm surface protein Sp17 vs. Planmine SMEST
Match: SMESG000046919.1 (SMESG000046919.1)

HSP 1 Score: 512.301 bits (1318), Expect = 2.581e-176
Identity = 295/426 (69.25%), Postives = 296/426 (69.48%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSNLKENDMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRKANEDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKATIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRKTIKGPVAGGHGDYVETHEKVNEDLEFDHENQEVPTDEITNVTDNMINEAEQ 1358
            MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDS TMLDESKS+LKENDM                                          DTPIAPVTNDEENPE                                           EMQTGDESQHLEIVEENLE                                            GPVAGGHGDYVETHEKVNEDLEFDHENQEVPTDEITNVTDNMINEAEQ
Sbjct:    1 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSHTMLDESKSSLKENDM------------------------------------------DTPIAPVTNDEENPE-------------------------------------------EMQTGDESQHLEIVEENLE--------------------------------------------GPVAGGHGDYVETHEKVNEDLEFDHENQEVPTDEITNVTDNMINEAEQ 297          

HSP 2 Score: 59.3066 bits (142), Expect = 4.969e-9
Identity = 27/27 (100.00%), Postives = 27/27 (100.00%), Query Frame = 3
Query: 1359 THEDNPESGGPTNDTDEAATSRTEPDE 1439
            THEDNPESGGPTNDTDEAATSRTEPDE
Sbjct:  554 THEDNPESGGPTNDTDEAATSRTEPDE 580          
BLAST of Sperm surface protein Sp17 vs. Planmine SMEST
Match: SMESG000046919.1 (SMESG000046919.1)

HSP 1 Score: 509.605 bits (1311), Expect = 6.071e-175
Identity = 301/432 (69.68%), Postives = 307/432 (71.06%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSNLKENDMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRKANEDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKATIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLE------KSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRKTIKGPVAGGHGDYVETHEKVNEDLEFDHENQEVPTDEITNVTDNMINEAEQ 1358
            MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDS TMLDESKS+LKENDM                                          DTPIAPVTNDEENPE                                           EMQTGDESQHLEIVEENLE        D V+        +I L D   EKAAVKIQSVYKG+R RK                ++KVNEDLEFDHENQEVPTDEITNVTDNMINEAEQ
Sbjct:    1 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSHTMLDESKSSLKENDM------------------------------------------DTPIAPVTNDEENPE-------------------------------------------EMQTGDESQHLEIVEENLEGPVAGGHGDYVETH-----EEIHLYDETSEKAAVKIQSVYKGYRTRK----------------NKKVNEDLEFDHENQEVPTDEITNVTDNMINEAEQ 326          

HSP 2 Score: 60.077 bits (144), Expect = 3.382e-9
Identity = 27/27 (100.00%), Postives = 27/27 (100.00%), Query Frame = 3
Query: 1359 THEDNPESGGPTNDTDEAATSRTEPDE 1439
            THEDNPESGGPTNDTDEAATSRTEPDE
Sbjct:  583 THEDNPESGGPTNDTDEAATSRTEPDE 609          
BLAST of Sperm surface protein Sp17 vs. Planmine SMEST
Match: SMESG000046919.1 (SMESG000046919.1)

HSP 1 Score: 492.656 bits (1267), Expect = 5.378e-168
Identity = 295/469 (62.90%), Postives = 296/469 (63.11%), Query Frame = 3
Query:   81 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEID-------------------------------------------RIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSNLKENDMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRKANEDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKATIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRKTIKGPVAGGHGDYVETHEKVNEDLEFDHENQEVPTDEITNVTDNMINEAEQ 1358
            MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEID                                           RIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDS TMLDESKS+LKENDM                                          DTPIAPVTNDEENPE                                           EMQTGDESQHLEIVEENLE                                            GPVAGGHGDYVETHEKVNEDLEFDHENQEVPTDEITNVTDNMINEAEQ
Sbjct:    1 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRKTTERIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSHTMLDESKSSLKENDM------------------------------------------DTPIAPVTNDEENPE-------------------------------------------EMQTGDESQHLEIVEENLE--------------------------------------------GPVAGGHGDYVETHEKVNEDLEFDHENQEVPTDEITNVTDNMINEAEQ 340          

HSP 2 Score: 59.6918 bits (143), Expect = 4.406e-9
Identity = 27/27 (100.00%), Postives = 27/27 (100.00%), Query Frame = 3
Query: 1359 THEDNPESGGPTNDTDEAATSRTEPDE 1439
            THEDNPESGGPTNDTDEAATSRTEPDE
Sbjct:  597 THEDNPESGGPTNDTDEAATSRTEPDE 623          
BLAST of Sperm surface protein Sp17 vs. Planmine SMEST
Match: SMESG000038137.1 (SMESG000038137.1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.744e-7
Identity = 80/314 (25.48%), Postives = 148/314 (47.13%), Query Frame = 3
Query:  348 AAVKIQSEYRRFAAKKEVDTKKE------EEAAIVIQASFRG----HFERQNQKPNSN-----EEIDRIPSDAQTNQHNNTDIEENTL--VHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSNLKENDMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRK--ANEDTPI---APVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKATIKIQSTFKGFRSRKTLEE---MQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRKTIK 1214
            AA KIQ+ +R F  +KE++  KE      ++  + I  S +     H E Q++ P  N     +E   I +  Q  Q+ + ++E  T    ++N ++    DK          G         ++ ++  + +SK +      +PE L  SE+  D ++ D    KAA KIQ+ F+G+ TR+   ++ +P    AP   +E+  EPKR+           D  +  +E A + IQ++F+G+++R TL+     +T +E +      +N E +++ K             D ++EKA + IQ+ ++G+R R ++K
Sbjct:  131 AATKIQAAFRGFQTRKEIEKAKENNKPVSKKHTVYIPKSIKPKNTEHHE-QDKNPKINYSKVKKEEKEIQAKPQKTQNKSRNVESKTTNPKNTNPNKTNADDKRNKAATKIQAGFRGYQTRQRLKFNKPEIKQSKISQNPKKSQPESL-TSEKESDYNIKD----KAAAKIQAGFRGYHTRQILKSQVSPKPYKAPEKKNEKKQEPKRV-------NETNDNNNKAMETAAVIIQASFRGYQTRHTLQNKVPRKTNNEPEKQN--GKNQEPTNENK-------------DKEIEKAVITIQAGFRGYRIRNSLK 416          
The following BLAST results are available for this feature:
BLAST of Sperm surface protein Sp17 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPA173.252e-2346.32sperm autoantigenic protein 17 [Source:HGNC Symbol... [more]
SPA173.252e-2346.32sperm autoantigenic protein 17 [Source:HGNC Symbol... [more]
CABYR5.920e-849.02calcium binding tyrosine phosphorylation regulated... [more]
CABYR5.920e-849.02calcium binding tyrosine phosphorylation regulated... [more]
CABYR5.920e-849.02calcium binding tyrosine phosphorylation regulated... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
igl9.649e-667.86gene:FBgn0013467 transcript:FBtr0087362[more]
igl9.649e-667.86gene:FBgn0013467 transcript:FBtr0332267[more]
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spa171.641e-2368.57sperm autoantigenic protein 17 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mettl42.415e-2039.86methyltransferase like 4 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spa172.670e-2343.71sperm autoantigenic protein 17 [Source:MGI Symbol;... [more]
Spa173.069e-2246.56sperm autoantigenic protein 17 [Source:MGI Symbol;... [more]
Cabyr6.361e-845.28calcium-binding tyrosine-(Y)-phosphorylation regul... [more]
Cabyr1.123e-745.28calcium-binding tyrosine-(Y)-phosphorylation regul... [more]
Cabyr2.359e-745.28calcium-binding tyrosine-(Y)-phosphorylation regul... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P36425|SP17_RABIT4.200e-2848.87Sperm surface protein Sp17 OS=Oryctolagus cuniculu... [more]
sp|O19021|SP17_MACFA5.203e-2340.99Sperm surface protein Sp17 OS=Macaca fascicularis ... [more]
sp|Q95230|SP17_PAPHA8.740e-2342.86Sperm surface protein Sp17 OS=Papio hamadryas OX=9... [more]
sp|Q15506|SP17_HUMAN1.562e-2246.32Sperm surface protein Sp17 OS=Homo sapiens OX=9606... [more]
sp|Q62252|SP17_MOUSE1.867e-2243.71Sperm surface protein Sp17 OS=Mus musculus OX=1009... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PVC97.012e-5842.93Sperm surface protein Sp17 OS=Mizuhopecten yessoen... [more]
K1PZL41.488e-4535.14Sperm surface protein Sp17 OS=Crassostrea gigas OX... [more]
A0A1I8IBG45.836e-4234.14RIIa domain-containing protein OS=Macrostomum lign... [more]
A0A1I8H9A31.482e-4134.08RIIa domain-containing protein OS=Macrostomum lign... [more]
A0A1I8I3083.338e-4134.06RIIa domain-containing protein OS=Macrostomum lign... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000046795.13.507e-2365.71pep primary_assembly:Astyanax_mexicanus-2.0:2:2232... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO460371.177e-2544.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350436.507e-1556.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000038228.11.784e-1655.71sperm autoantigenic protein 17 [Source:NCBI gene;A... [more]
ENSORLT00000038630.11.800e-1655.71sperm autoantigenic protein 17 [Source:NCBI gene;A... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046919.15.055e-979.11SMESG000046919.1[more]
SMESG000046919.12.581e-17669.25SMESG000046919.1[more]
SMESG000046919.16.071e-17569.68SMESG000046919.1[more]
SMESG000046919.15.378e-16862.90SMESG000046919.1[more]
SMESG000038137.11.744e-725.48SMESG000038137.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007142 ID=SMED30007142|Name=Sperm surface protein Sp17|organism=Schmidtea mediterranea sexual|type=transcript|length=1792bp
GTTGCTTAGTTACAAATAGTAACGTAAATTAATATCGAAAAATTTGTTGA
TTACTTATTAAAAGATTTTTATAATTAAATATGGCAGTTCCATATTCAAA
CACAAGATTAAGAGTGCCAAAAGGTTTTCAAAATGTGTTAGAAGGTCTTG
CACGTGAAGTCTTAAGATGCCAACCAGAAAATATTTATAGTTTTGCTGCT
GATTATTTTGAAGAGTTATTAAGAATGCGTCAAGAAACTGGTTATGACGA
TATAGCACTGTTAGGAGCGAAATTAGAAGACAGATTTTATAATAATCATA
GTTTTAAAAATCCTAATACAAATACAAATAATGAAGAACAACAATCGGCT
GCTGTTAAAATTCAATCGGAATACCGTCGATTTGCCGCGAAAAAAGAAGT
CGATACGAAGAAAGAAGAAGAGGCTGCAATCGTTATACAAGCTTCATTCA
GAGGGCATTTTGAAAGGCAGAACCAAAAACCAAATTCAAATGAAGAAATT
GATAGAATTCCTTCCGATGCTCAAACTAATCAGCACAATAATACAGATAT
AGAAGAAAATACATTGGTACATTCAAACATTGATGAGCCAGAAATTATGG
ATAAACATGAATCTGAAGATCTTCCTCCGGCACATGGTGAAAATCAAAAT
TATCAAGAATATGATATAGAAGACTCTCAAACTATGCTCGATGAATCTAA
ATCAAATCTCAAAGAAAACGACATGAAGCCTGAGGAGCTTCAAAATTCTG
AAGAAATTATTGACATAGATCTTACTGATCCCGATGTTGAAAAAGCTGCG
GTAAAAATCCAATCTGCCTTCAAAGGATTCAAAACTCGCAAAGCAAATGA
GGATACTCCAATAGCTCCGGTAACTAACGATGAAGAAAATCCTGAGCCTA
AAAGACTTCAAGAAATAAAAGAAGATGAAATAATTGATATAGATTTAACC
GATCCAGAGGTTGAGAAGGCAACAATAAAAATACAGTCGACATTTAAAGG
TTTTCGAAGTCGAAAGACATTAGAGGAAATGCAAACTGGAGATGAATCTC
AACATCTTGAAATAGTCGAGGAAAATCTTGAAAAAAGTGATAAAGTTAAA
GCATTCATCGATGAAGAGATCATTGATATAGATCTGAACGATCCTGACGT
AGAGAAAGCAGCTGTCAAAATACAATCGGTTTATAAAGGTTTTCGAAATC
GTAAAACTATTAAGGGACCAGTAGCTGGCGGCCATGGAGATTATGTTGAA
ACGCACGAAAAAGTTAATGAAGATTTAGAATTCGATCACGAAAATCAAGA
AGTTCCAACAGATGAGATTACCAATGTTACAGATAACATGATAAATGAAG
CAGAACAGACTCACGAAGACAATCCGGAATCAGGAGGCCCCACAAACGAC
ACAGATGAGGCTGCGACAAGTCGTACGGAACCAGATGAATAATGATGGAC
ATTTTTTATGAGTTTTCAATTATTTAAGACAGTATTGTTAAGAAAGTGGT
CACTTGTTATTTTAATAATATTGACAATAAATGAGATTATTGGATACGAG
GGAGGCTGACATGATATTTAGATTTTTTTTAGTTAGAAATTTTACTCGCA
TTTAGTTAGTAATATTTTTTACGAGTTTTCCTTTCGAGAAATATTGCAAA
TCCTTAATGACAGTGAATACCTTTTCACATATTACTTTGCCGGTTTCCTT
TTCGCTCTGGTTTCCTTATTTTAGAATTTACTCATACAACTATTTCATGT
CTAAACATTTTGTGTACAACTATAAATTTGCTAAGAATAGAC
back to top

protein sequence of SMED30007142-orf-1

>SMED30007142-orf-1 ID=SMED30007142-orf-1|Name=SMED30007142-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=454bp
MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMR
QETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRR
FAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDRIPSDAQTN
QHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQ
TMLDESKSNLKENDMKPEELQNSEEIIDIDLTDPDVEKAAVKIQSAFKGF
KTRKANEDTPIAPVTNDEENPEPKRLQEIKEDEIIDIDLTDPEVEKATIK
IQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFIDEEIIDI
DLNDPDVEKAAVKIQSVYKGFRNRKTIKGPVAGGHGDYVETHEKVNEDLE
FDHENQEVPTDEITNVTDNMINEAEQTHEDNPESGGPTNDTDEAATSRTE
PDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005777peroxisome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR003117cAMP_dep_PK_reg_su_I/II_a/b
IPR000048IQ_motif_EF-hand-BS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003117cAMP-dependent protein kinase regulatory subunit, dimerization-anchoring domainSMARTSM00394akam_3coord: 14..51
e-value: 4.1E-13
score: 59.6
IPR003117cAMP-dependent protein kinase regulatory subunit, dimerization-anchoring domainPFAMPF02197RIIacoord: 14..50
e-value: 5.1E-14
score: 51.7
IPR000048IQ motif, EF-hand binding siteSMARTSM00015iq_5coord: 235..257
e-value: 0.29
score: 20.2
coord: 293..315
e-value: 0.027
score: 23.6
coord: 111..133
e-value: 3.3E-4
score: 30.0
coord: 86..108
e-value: 0.9
score: 18.6
coord: 356..378
e-value: 0.12
score: 21.5
IPR000048IQ motif, EF-hand binding sitePFAMPF00612IQcoord: 295..313
e-value: 5.6E-4
score: 19.5
coord: 114..131
e-value: 0.0026
score: 17.4
coord: 358..376
e-value: 0.0014
score: 18.2
coord: 89..106
e-value: 0.043
score: 13.6
coord: 237..254
e-value: 1.9E-4
score: 20.9
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 295..323
score: 9.359
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 237..265
score: 7.455
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 87..116
score: 7.821
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 112..141
score: 9.304
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 358..386
score: 7.895
NoneNo IPR availableGENE3DG3DSA:1.20.890.10coord: 8..51
e-value: 4.1E-14
score: 53.7
NoneNo IPR availableGENE3DG3DSA:1.20.5.190coord: 87..131
e-value: 1.9E-12
score: 48.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 125..164
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 141..161
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 400..453
NoneNo IPR availablePANTHERPTHR10699NEUROMODULINcoord: 1..95
coord: 265..322
coord: 336..447
coord: 207..257
NoneNo IPR availableCDDcd12100DD_CABYR_SP17coord: 12..50
e-value: 4.78231E-19
score: 78.0461
NoneNo IPR availableSUPERFAMILYSSF47391Dimerization-anchoring domain of cAMP-dependent PK regulatory subunitcoord: 8..50