Kunitz-type serine protease inhibitor 6

Overview
NameKunitz-type serine protease inhibitor 6
Smed IDSMED30007141
Length (bp)336
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kunitz-type serine protease inhibitor 6 (SMED30007141) t-SNE clustered cells

Violin plots show distribution of expression levels for Kunitz-type serine protease inhibitor 6 (SMED30007141) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kunitz-type serine protease inhibitor 6 (SMED30007141) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kunitz-type serine protease inhibitor 6 (SMED30007141) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007141

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30007141 SmedASXL_015573SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30007141 SmedASXL_015573SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30007141 dd_Smed_v4_41_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30007141 dd_Smed_v6_41_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
goblet cellSMED30007141 dd_Smed_v6_41_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 63.5438 bits (153), Expect = 8.754e-13
Identity = 29/53 (54.72%), Postives = 37/53 (69.81%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C L ++ G+CRGY  RYF+N +T +CE+F YGGC GN NNF T  EC+  CE 
Sbjct:  125 CFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICED 177          

HSP 2 Score: 51.6026 bits (122), Expect = 2.035e-8
Identity = 23/51 (45.10%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C+   + G C+    R+FFN  T +CE+FIYGGC+GN+N F +  EC+  C
Sbjct:   54 CAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMC 104          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 63.5438 bits (153), Expect = 8.754e-13
Identity = 29/53 (54.72%), Postives = 37/53 (69.81%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C L ++ G+CRGY  RYF+N +T +CE+F YGGC GN NNF T  EC+  CE 
Sbjct:  125 CFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICED 177          

HSP 2 Score: 51.6026 bits (122), Expect = 2.035e-8
Identity = 23/51 (45.10%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C+   + G C+    R+FFN  T +CE+FIYGGC+GN+N F +  EC+  C
Sbjct:   54 CAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMC 104          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 62.7734 bits (151), Expect = 1.035e-12
Identity = 29/53 (54.72%), Postives = 37/53 (69.81%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C L ++ G+CRGY  RYF+N +T +CE+F YGGC GN NNF T  EC+  CE 
Sbjct:  112 CFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICED 164          

HSP 2 Score: 51.2174 bits (121), Expect = 2.131e-8
Identity = 23/51 (45.10%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C+   + G C+    R+FFN  T +CE+FIYGGC+GN+N F +  EC+  C
Sbjct:   54 CAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMC 104          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 62.7734 bits (151), Expect = 2.498e-12
Identity = 29/53 (54.72%), Postives = 37/53 (69.81%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C L ++ G+CRGY  RYF+N +T +CE+F YGGC GN NNF T  EC+  CE 
Sbjct:  125 CFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICED 177          

HSP 2 Score: 51.2174 bits (121), Expect = 3.915e-8
Identity = 23/51 (45.10%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C+   + G C+    R+FFN  T +CE+FIYGGC+GN+N F +  EC+  C
Sbjct:   54 CAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMC 104          

HSP 3 Score: 48.521 bits (114), Expect = 2.766e-7
Identity = 23/53 (43.40%), Postives = 31/53 (58.49%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C  P + GLCR    R+++N   GKC  F Y GC GN+NNF +  EC   C++
Sbjct:  217 CLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKK 269          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 62.7734 bits (151), Expect = 2.498e-12
Identity = 29/53 (54.72%), Postives = 37/53 (69.81%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C L ++ G+CRGY  RYF+N +T +CE+F YGGC GN NNF T  EC+  CE 
Sbjct:  125 CFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICED 177          

HSP 2 Score: 51.2174 bits (121), Expect = 3.915e-8
Identity = 23/51 (45.10%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C+   + G C+    R+FFN  T +CE+FIYGGC+GN+N F +  EC+  C
Sbjct:   54 CAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMC 104          

HSP 3 Score: 48.521 bits (114), Expect = 2.766e-7
Identity = 23/53 (43.40%), Postives = 31/53 (58.49%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C  P + GLCR    R+++N   GKC  F Y GC GN+NNF +  EC   C++
Sbjct:  217 CLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKK 269          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667211:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 64.6994 bits (156), Expect = 3.286e-13
Identity = 25/51 (49.02%), Postives = 36/51 (70.59%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C++P + G+C  Y PR+FFN +TG+CE+F YG C GN+NNF+    C  +C
Sbjct: 2177 CAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 2227          

HSP 2 Score: 56.9954 bits (136), Expect = 1.468e-10
Identity = 26/51 (50.98%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C  P++ G CRG F R+FF++E   C+ F Y GCQGN NNF +  EC A C
Sbjct:  737 CLHPRDSGNCRGQFVRWFFDDEKKNCDVFTYTGCQGNGNNFASKEECMAIC 787          

HSP 3 Score: 54.299 bits (129), Expect = 1.232e-9
Identity = 26/64 (40.62%), Postives = 37/64 (57.81%), Query Frame = 1
Query:   88 HLGDCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ*L 279
            +L    E +C  P E G C+ +  R++FN + G C  F YGGC GN+N+F+T  EC   C + L
Sbjct: 1074 NLAAQIEEKCLQPVEPGPCKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECEVHCARFL 1137          

HSP 4 Score: 53.1434 bits (126), Expect = 3.130e-9
Identity = 24/51 (47.06%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            CSLPKE G C  Y  R++FN +  +C+ F +GGC+GN+NNF    +C + C
Sbjct:  539 CSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESAC 589          

HSP 5 Score: 52.7582 bits (125), Expect = 4.355e-9
Identity = 26/51 (50.98%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
             SLP   G C G F RYF+NE++ KCE+F Y GC GN NN+ +   C  RC
Sbjct:  426 VSLP---GPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACEDRC 473          

HSP 6 Score: 50.8322 bits (120), Expect = 2.020e-8
Identity = 24/51 (47.06%), Postives = 28/51 (54.90%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C    EVG C G F R+ F++    C  F YGGC GN NNF T  EC  +C
Sbjct:  866 CEADIEVGECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKC 916          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667211:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 64.6994 bits (156), Expect = 3.306e-13
Identity = 25/51 (49.02%), Postives = 36/51 (70.59%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C++P + G+C  Y PR+FFN +TG+CE+F YG C GN+NNF+    C  +C
Sbjct: 1651 CAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 1701          

HSP 2 Score: 57.3806 bits (137), Expect = 1.276e-10
Identity = 26/53 (49.06%), Postives = 34/53 (64.15%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C  P++ G CRG F R+FF++E   C+ F Y GCQGN NNF +  EC A C +
Sbjct:  737 CLHPRDSGNCRGQFVRWFFDDEKKNCDVFTYTGCQGNGNNFASKEECMAICHK 789          

HSP 3 Score: 55.0694 bits (131), Expect = 8.242e-10
Identity = 27/68 (39.71%), Postives = 40/68 (58.82%), Query Frame = 1
Query:   88 HLGDCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ*LLNIY 291
            +L    E +C  P E G C+ +  R++FN + G C  F YGGC GN+N+F+T  EC   C +  L+I+
Sbjct: 1074 NLAAQIEEKCLQPVEPGPCKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECEVHCAR-FLSIH 1140          

HSP 4 Score: 53.1434 bits (126), Expect = 2.885e-9
Identity = 24/51 (47.06%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            CSLPKE G C  Y  R++FN +  +C+ F +GGC+GN+NNF    +C + C
Sbjct:  539 CSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESAC 589          

HSP 5 Score: 52.7582 bits (125), Expect = 4.828e-9
Identity = 26/51 (50.98%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
             SLP   G C G F RYF+NE++ KCE+F Y GC GN NN+ +   C  RC
Sbjct:  426 VSLP---GPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACEDRC 473          

HSP 6 Score: 51.2174 bits (121), Expect = 1.690e-8
Identity = 24/51 (47.06%), Postives = 28/51 (54.90%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C    EVG C G F R+ F++    C  F YGGC GN NNF T  EC  +C
Sbjct:  866 CEADIEVGECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKC 916          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667211:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 64.6994 bits (156), Expect = 3.318e-13
Identity = 25/51 (49.02%), Postives = 36/51 (70.59%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C++P + G+C  Y PR+FFN +TG+CE+F YG C GN+NNF+    C  +C
Sbjct: 2168 CAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 2218          

HSP 2 Score: 56.9954 bits (136), Expect = 1.454e-10
Identity = 26/51 (50.98%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C  P++ G CRG F R+FF++E   C+ F Y GCQGN NNF +  EC A C
Sbjct:  728 CLHPRDSGNCRGQFVRWFFDDEKKNCDVFTYTGCQGNGNNFASKEECMAIC 778          

HSP 3 Score: 54.299 bits (129), Expect = 1.244e-9
Identity = 26/64 (40.62%), Postives = 37/64 (57.81%), Query Frame = 1
Query:   88 HLGDCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ*L 279
            +L    E +C  P E G C+ +  R++FN + G C  F YGGC GN+N+F+T  EC   C + L
Sbjct: 1065 NLAAQIEEKCLQPVEPGPCKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECEVHCARFL 1128          

HSP 4 Score: 53.1434 bits (126), Expect = 3.070e-9
Identity = 24/51 (47.06%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            CSLPKE G C  Y  R++FN +  +C+ F +GGC+GN+NNF    +C + C
Sbjct:  539 CSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESAC 589          

HSP 5 Score: 52.7582 bits (125), Expect = 4.271e-9
Identity = 26/51 (50.98%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
             SLP   G C G F RYF+NE++ KCE+F Y GC GN NN+ +   C  RC
Sbjct:  426 VSLP---GPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACEDRC 473          

HSP 6 Score: 50.8322 bits (120), Expect = 2.039e-8
Identity = 24/51 (47.06%), Postives = 28/51 (54.90%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C    EVG C G F R+ F++    C  F YGGC GN NNF T  EC  +C
Sbjct:  857 CEADIEVGECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKC 907          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667209:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 64.6994 bits (156), Expect = 3.414e-13
Identity = 25/51 (49.02%), Postives = 36/51 (70.59%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C++P + G+C  Y PR+FFN +TG+CE+F YG C GN+NNF+    C  +C
Sbjct: 2048 CAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 2098          

HSP 2 Score: 56.9954 bits (136), Expect = 1.438e-10
Identity = 26/53 (49.06%), Postives = 34/53 (64.15%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C  P++ G CRG F R+FF++E   C+ F Y GCQGN NNF +  EC A C +
Sbjct:  608 CLHPRDSGNCRGQFVRWFFDDEKKNCDVFTYTGCQGNGNNFASKEECMAICHK 660          

HSP 3 Score: 54.299 bits (129), Expect = 1.196e-9
Identity = 26/64 (40.62%), Postives = 37/64 (57.81%), Query Frame = 1
Query:   88 HLGDCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ*L 279
            +L    E +C  P E G C+ +  R++FN + G C  F YGGC GN+N+F+T  EC   C + L
Sbjct:  945 NLAAQIEEKCLQPVEPGPCKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECEVHCARFL 1008          

HSP 4 Score: 53.1434 bits (126), Expect = 3.067e-9
Identity = 24/51 (47.06%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            CSLPKE G C  Y  R++FN +  +C+ F +GGC+GN+NNF    +C + C
Sbjct:  410 CSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESAC 460          

HSP 5 Score: 52.7582 bits (125), Expect = 4.394e-9
Identity = 26/51 (50.98%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
             SLP   G C G F RYF+NE++ KCE+F Y GC GN NN+ +   C  RC
Sbjct:  297 VSLP---GPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACEDRC 344          

HSP 6 Score: 50.8322 bits (120), Expect = 2.018e-8
Identity = 24/51 (47.06%), Postives = 28/51 (54.90%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C    EVG C G F R+ F++    C  F YGGC GN NNF T  EC  +C
Sbjct:  737 CEADIEVGECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKC 787          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667209:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3f.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 64.6994 bits (156), Expect = 3.430e-13
Identity = 25/51 (49.02%), Postives = 36/51 (70.59%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C++P + G+C  Y PR+FFN +TG+CE+F YG C GN+NNF+    C  +C
Sbjct: 1430 CAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 1480          

HSP 2 Score: 57.3806 bits (137), Expect = 1.202e-10
Identity = 26/53 (49.06%), Postives = 34/53 (64.15%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C  P++ G CRG F R+FF++E   C+ F Y GCQGN NNF +  EC A C +
Sbjct:  516 CLHPRDSGNCRGQFVRWFFDDEKKNCDVFTYTGCQGNGNNFASKEECMAICHK 568          

HSP 3 Score: 55.0694 bits (131), Expect = 8.067e-10
Identity = 27/68 (39.71%), Postives = 40/68 (58.82%), Query Frame = 1
Query:   88 HLGDCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ*LLNIY 291
            +L    E +C  P E G C+ +  R++FN + G C  F YGGC GN+N+F+T  EC   C +  L+I+
Sbjct:  853 NLAAQIEEKCLQPVEPGPCKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECEVHCAR-FLSIH 919          

HSP 4 Score: 53.1434 bits (126), Expect = 2.908e-9
Identity = 24/51 (47.06%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            CSLPKE G C  Y  R++FN +  +C+ F +GGC+GN+NNF    +C + C
Sbjct:  318 CSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESAC 368          

HSP 5 Score: 52.7582 bits (125), Expect = 5.107e-9
Identity = 26/50 (52.00%), Postives = 32/50 (64.00%), Query Frame = 1
Query:  118 SLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            SLP   G C G F RYF+NE++ KCE+F Y GC GN NN+ +   C  RC
Sbjct:  206 SLP---GPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACEDRC 252          

HSP 6 Score: 51.2174 bits (121), Expect = 1.606e-8
Identity = 24/51 (47.06%), Postives = 28/51 (54.90%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C    EVG C G F R+ F++    C  F YGGC GN NNF T  EC  +C
Sbjct:  645 CEADIEVGECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKC 695          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Fly
Match: CG15418 (gene:FBgn0031554 transcript:FBtr0077556)

HSP 1 Score: 59.6918 bits (143), Expect = 8.967e-13
Identity = 30/55 (54.55%), Postives = 35/55 (63.64%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ*L 279
            C  PK  GLCRG+  RY +N++TG CE FIY GC   +NNF T  ECR  C Q L
Sbjct:   41 CRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDCMQRL 95          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Fly
Match: CG15418 (gene:FBgn0031554 transcript:FBtr0446100)

HSP 1 Score: 59.6918 bits (143), Expect = 8.967e-13
Identity = 30/55 (54.55%), Postives = 35/55 (63.64%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ*L 279
            C  PK  GLCRG+  RY +N++TG CE FIY GC   +NNF T  ECR  C Q L
Sbjct:   41 CRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDCMQRL 95          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Fly
Match: CG3604 (gene:FBgn0031562 transcript:FBtr0077545)

HSP 1 Score: 58.9214 bits (141), Expect = 4.535e-12
Identity = 26/52 (50.00%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  112 ECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            +C  PKE G C   F RY +N +T  CE+F+YGGC GNKNNF +  +C   C
Sbjct:   54 DCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Fly
Match: CG3604 (gene:FBgn0031562 transcript:FBtr0346581)

HSP 1 Score: 58.9214 bits (141), Expect = 4.535e-12
Identity = 26/52 (50.00%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  112 ECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            +C  PKE G C   F RY +N +T  CE+F+YGGC GNKNNF +  +C   C
Sbjct:   54 DCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Fly
Match: Ppn (gene:FBgn0003137 transcript:FBtr0300337)

HSP 1 Score: 56.9954 bits (136), Expect = 1.866e-10
Identity = 24/53 (45.28%), Postives = 31/53 (58.49%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C LPKE G C  Y  +Y+F+   G C +F YGGC GN N F +  EC+  C+ 
Sbjct: 1612 CGLPKETGTCNNYSVKYYFDTSYGGCARFWYGGCDGNDNRFESEAECKDTCQD 1664          

HSP 2 Score: 56.225 bits (134), Expect = 3.310e-10
Identity = 26/55 (47.27%), Postives = 32/55 (58.18%), Query Frame = 1
Query:  109 PECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            P C  P E G C G F R++++ ET  C  F YGGC+GNKNN+ T   C   C Q
Sbjct: 1728 PTCEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQ 1782          

HSP 3 Score: 48.1358 bits (113), Expect = 2.716e-7
Identity = 20/51 (39.22%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C LPK  G C G+  +++F+ +  +CE+F YGGC G  N F +  +C+  C
Sbjct: 1671 CLLPKSAGPCTGFTKKWYFDVDRNRCEEFQYGGCYGTNNRFDSLEQCQGTC 1721          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Zebrafish
Match: spint2 (serine peptidase inhibitor, Kunitz type, 2 [Source:ZFIN;Acc:ZDB-GENE-061013-323])

HSP 1 Score: 62.7734 bits (151), Expect = 2.033e-12
Identity = 27/51 (52.94%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C  P  VG CR  FPR+F++     C+ FIYGGC GN+NNFY+  EC A C
Sbjct:  133 CRFPSAVGNCRAAFPRFFYDITDQTCKSFIYGGCGGNENNFYSQAECEASC 183          

HSP 2 Score: 50.0618 bits (118), Expect = 6.747e-8
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 1
Query:  106 EPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            E +C +P + G CR  F  +FF   +  C+ FIYGGC+GN N + +  EC + C
Sbjct:  301 EEKCVVPSDSGPCRASFRMFFFEASSQSCQPFIYGGCRGNLNRYGSEEECMSVC 354          

HSP 3 Score: 48.1358 bits (113), Expect = 2.627e-7
Identity = 22/54 (40.74%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  106 EPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            + +C  P   G CR    R+++N   G C++FIYGGC GNKNN+ +   C   C
Sbjct:  225 QEKCQSPAVTGNCRASIKRFYYN--NGVCQQFIYGGCGGNKNNYESEDSCMTAC 276          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Zebrafish
Match: spint2 (serine peptidase inhibitor, Kunitz type, 2 [Source:ZFIN;Acc:ZDB-GENE-061013-323])

HSP 1 Score: 62.7734 bits (151), Expect = 2.053e-12
Identity = 27/51 (52.94%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C  P  VG CR  FPR+F++     C+ FIYGGC GN+NNFY+  EC A C
Sbjct:  133 CRFPSAVGNCRAAFPRFFYDITDQTCKSFIYGGCGGNENNFYSQAECEASC 183          

HSP 2 Score: 50.0618 bits (118), Expect = 6.813e-8
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 1
Query:  106 EPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            E +C +P + G CR  F  +FF   +  C+ FIYGGC+GN N + +  EC + C
Sbjct:  301 EEKCVVPSDSGPCRASFRMFFFEASSQSCQPFIYGGCRGNLNRYGSEEECMSVC 354          

HSP 3 Score: 48.1358 bits (113), Expect = 2.679e-7
Identity = 22/54 (40.74%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  106 EPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            + +C  P   G CR    R+++N   G C++FIYGGC GNKNN+ +   C   C
Sbjct:  225 QEKCQSPAVTGNCRASIKRFYYN--NGVCQQFIYGGCGGNKNNYESEDSCMTAC 276          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Zebrafish
Match: wfikkn1 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 [Source:NCBI gene;Acc:406570])

HSP 1 Score: 61.6178 bits (148), Expect = 5.205e-12
Identity = 28/51 (54.90%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            CSLP   G CR +  R+F+N  T +CE F+YGGC GNKN+F T  EC A C
Sbjct:  257 CSLPAVQGPCRHWQARWFYNSLTERCEAFLYGGCSGNKNSFGTRRECDAHC 307          

HSP 2 Score: 43.8986 bits (102), Expect = 8.519e-6
Identity = 22/54 (40.74%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  112 ECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            +CS   E G C      +FF+   G C  F +GGC+G +N F+T  ECRA C++
Sbjct:  199 DCSAAVERGDCGEKRVDWFFDPARGSCHTFTHGGCEG-RNRFHTFEECRASCQR 251          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Zebrafish
Match: aplp2 (amyloid beta (A4) precursor-like protein 2 [Source:ZFIN;Acc:ZDB-GENE-061009-28])

HSP 1 Score: 61.2326 bits (147), Expect = 8.087e-12
Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 1
Query:  106 EPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            E  CSL  E G CR   PR+ F+ +  KC +FIYGGC GN+NNF +   C   C++
Sbjct:  312 EAVCSLEAETGPCRASMPRWHFDMQQRKCVRFIYGGCAGNRNNFDSEEYCMVVCKR 367          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Zebrafish
Match: aplp2 (amyloid beta (A4) precursor-like protein 2 [Source:ZFIN;Acc:ZDB-GENE-061009-28])

HSP 1 Score: 60.8474 bits (146), Expect = 9.834e-12
Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 1
Query:  106 EPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            E  CSL  E G CR   PR+ F+ +  KC +FIYGGC GN+NNF +   C   C++
Sbjct:  312 EAVCSLEAETGPCRASMPRWHFDMQQRKCVRFIYGGCAGNRNNFDSEEYCMVVCKR 367          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Xenopus
Match: itch (itchy E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-976485])

HSP 1 Score: 60.4622 bits (145), Expect = 2.457e-11
Identity = 25/54 (46.30%), Postives = 34/54 (62.96%), Query Frame = 1
Query:  109 PE-CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            PE C+L KE G CR +  +++++ ET  C +F YGGC GN+N F T  EC   C
Sbjct: 2826 PEVCNLQKEEGTCRDFVLKWYYDPETKSCARFWYGGCGGNENRFSTQKECEKIC 2879          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Xenopus
Match: itch (itchy E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-976485])

HSP 1 Score: 60.4622 bits (145), Expect = 2.459e-11
Identity = 25/54 (46.30%), Postives = 34/54 (62.96%), Query Frame = 1
Query:  109 PE-CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            PE C+L KE G CR +  +++++ ET  C +F YGGC GN+N F T  EC   C
Sbjct: 3006 PEVCNLQKEEGTCRDFVLKWYYDPETKSCARFWYGGCGGNENRFSTQKECEKIC 3059          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Xenopus
Match: itch (itchy E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-976485])

HSP 1 Score: 60.4622 bits (145), Expect = 2.460e-11
Identity = 25/54 (46.30%), Postives = 34/54 (62.96%), Query Frame = 1
Query:  109 PE-CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            PE C+L KE G CR +  +++++ ET  C +F YGGC GN+N F T  EC   C
Sbjct: 3023 PEVCNLQKEEGTCRDFVLKWYYDPETKSCARFWYGGCGGNENRFSTQKECEKIC 3076          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Xenopus
Match: PAPLN (papilin, proteoglycan-like sulfated glycoprotein [Source:NCBI gene;Acc:100489537])

HSP 1 Score: 59.6918 bits (143), Expect = 3.388e-11
Identity = 26/53 (49.06%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C LP   G C  +  R++F  E GKC +F YG C GNKNNF T  EC + C+Q
Sbjct:  666 CLLPSATGSCADWSTRWYFVPEVGKCNRFWYGNCHGNKNNFATEQECMSSCQQ 718          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Xenopus
Match: PAPLN (papilin, proteoglycan-like sulfated glycoprotein [Source:NCBI gene;Acc:100489537])

HSP 1 Score: 59.6918 bits (143), Expect = 3.694e-11
Identity = 26/53 (49.06%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C LP   G C  +  R++F  E GKC +F YG C GNKNNF T  EC + C+Q
Sbjct:  646 CLLPSATGSCADWSTRWYFVPEVGKCNRFWYGNCHGNKNNFATEQECMSSCQQ 698          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Mouse
Match: Spint3 (serine peptidase inhibitor, Kunitz type, 3 [Source:MGI Symbol;Acc:MGI:3651470])

HSP 1 Score: 65.855 bits (159), Expect = 4.152e-15
Identity = 29/53 (54.72%), Postives = 40/53 (75.47%), Query Frame = 1
Query:  109 PECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            P C LPK++G CR  F R+++N +TGKCE F YGGC+GN+NNF +  +C+A C
Sbjct:   33 PMCILPKDIGGCRAVFVRWYYNSKTGKCEWFRYGGCKGNENNFPSRSQCQAVC 85          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Mouse
Match: Eppin (epididymal peptidase inhibitor [Source:MGI Symbol;Acc:MGI:1922776])

HSP 1 Score: 65.855 bits (159), Expect = 1.112e-14
Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = 1
Query:  103 KEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            ++  CSLPK+ G C  YF R++FN+E   C+ FIYGGCQGN NNF +   C+  CE+
Sbjct:   73 QQDICSLPKDSGYCMAYFRRWWFNKENSTCQVFIYGGCQGNNNNFQSQSICQNACEK 129          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 66.6254 bits (161), Expect = 3.922e-14
Identity = 29/53 (54.72%), Postives = 38/53 (71.70%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C L ++ GLCRGY  RY +N +T +CE+F+YGGC GN+NNF T  EC+  CE 
Sbjct:  121 CFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICEN 173          

HSP 2 Score: 53.5286 bits (127), Expect = 2.429e-9
Identity = 24/51 (47.06%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C++  + G C+     YFFN  T +CE+FIYGGC+GN+N F T  EC+  C
Sbjct:   50 CAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTC 100          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 66.6254 bits (161), Expect = 3.922e-14
Identity = 29/53 (54.72%), Postives = 38/53 (71.70%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C L ++ GLCRGY  RY +N +T +CE+F+YGGC GN+NNF T  EC+  CE 
Sbjct:  121 CFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICEN 173          

HSP 2 Score: 53.5286 bits (127), Expect = 2.429e-9
Identity = 24/51 (47.06%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C++  + G C+     YFFN  T +CE+FIYGGC+GN+N F T  EC+  C
Sbjct:   50 CAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTC 100          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 66.6254 bits (161), Expect = 3.922e-14
Identity = 29/53 (54.72%), Postives = 38/53 (71.70%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C L ++ GLCRGY  RY +N +T +CE+F+YGGC GN+NNF T  EC+  CE 
Sbjct:  121 CFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICEN 173          

HSP 2 Score: 53.5286 bits (127), Expect = 2.429e-9
Identity = 24/51 (47.06%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C++  + G C+     YFFN  T +CE+FIYGGC+GN+N F T  EC+  C
Sbjct:   50 CAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTC 100          
BLAST of Kunitz-type serine protease inhibitor 6 vs. UniProt/SwissProt
Match: sp|P0DMW6|VKT3A_ACTEQ (PI-actitoxin-Aeq3a OS=Actinia equina OX=6106 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.125e-18
Identity = 34/53 (64.15%), Postives = 40/53 (75.47%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C LP  VG CRGYFPRY++N E GKC++FIYGGC GN+NNF T  +CRA C  
Sbjct:    6 CQLPAVVGKCRGYFPRYYYNTEAGKCQQFIYGGCGGNRNNFETVEDCRATCHS 58          
BLAST of Kunitz-type serine protease inhibitor 6 vs. UniProt/SwissProt
Match: sp|P0DMW7|VKT3B_ACTEQ (PI-actitoxin-Aeq3b OS=Actinia equina OX=6106 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.820e-18
Identity = 33/53 (62.26%), Postives = 40/53 (75.47%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C LP  VG CRGYFPR+++N E GKC++FIYGGC GN+NNF T  +CRA C  
Sbjct:    6 CQLPAVVGKCRGYFPRFYYNTEAGKCQQFIYGGCGGNRNNFETVEDCRATCHS 58          
BLAST of Kunitz-type serine protease inhibitor 6 vs. UniProt/SwissProt
Match: sp|P0DMX0|VKT3_ANTAF (PI-actitoxin-Axm2b OS=Anthopleura aff. xanthogrammica OX=152178 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.813e-17
Identity = 34/51 (66.67%), Postives = 39/51 (76.47%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C LP   G CRGYFPRYFF+ ETGKCE+FIYGGC GN+NNF +  EC + C
Sbjct:    7 CYLPAVRGRCRGYFPRYFFSSETGKCERFIYGGCGGNRNNFESAQECGSTC 57          
BLAST of Kunitz-type serine protease inhibitor 6 vs. UniProt/SwissProt
Match: sp|P0DJ50|VKT31_MESMA (Kunitz-type serine protease inhibitor BmKTT-2 OS=Mesobuthus martensii OX=34649 PE=2 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 1.387e-16
Identity = 28/60 (46.67%), Postives = 43/60 (71.67%), Query Frame = 1
Query:   91 LGDCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCE 270
            + D +  +C+LP + G C+ YF RYF+N++ G+C+KF+YGGC+GN NNF T  +C  +C 
Sbjct:   18 ISDAEGVDCTLPSDTGRCKAYFIRYFYNQKAGECQKFVYGGCEGNSNNFLTKSDCCKQCS 77          
BLAST of Kunitz-type serine protease inhibitor 6 vs. UniProt/SwissProt
Match: sp|B1B5I8|VKT3_STIHA (KappaPI-stichotoxin-Shd2a OS=Stichodactyla haddoni OX=475174 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 6.724e-16
Identity = 33/51 (64.71%), Postives = 38/51 (74.51%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C L  +V  CRGYFPRY++N E GKCE+FIYGGC GNKNNF +   CRA C
Sbjct:   27 CHLQPDVPKCRGYFPRYYYNPEVGKCEQFIYGGCGGNKNNFVSFEACRATC 77          
BLAST of Kunitz-type serine protease inhibitor 6 vs. TrEMBL
Match: I1ZII0 (Serine protease inhibitor-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.339e-16
Identity = 33/59 (55.93%), Postives = 42/59 (71.19%), Query Frame = 1
Query:   97 DCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
             C    CSLPK  G C+ YFPRY++N +TGKCEKFIYGGC+GN+NNF +  +C   C +
Sbjct:   17 SCLNSICSLPKNAGPCKAYFPRYYYNSKTGKCEKFIYGGCKGNQNNFQSSKDCEQNCHK 75          
BLAST of Kunitz-type serine protease inhibitor 6 vs. TrEMBL
Match: A7T2J6 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g143195 PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 4.730e-15
Identity = 32/53 (60.38%), Postives = 38/53 (71.70%), Query Frame = 1
Query:  109 PECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
              C+LPK+VG CR   PR FFN ++GKCE FIYGGC GN NNF+T  EC+  C
Sbjct:   12 SACTLPKKVGDCRAAMPRVFFNSQSGKCEDFIYGGCGGNANNFHTMEECKKAC 64          
BLAST of Kunitz-type serine protease inhibitor 6 vs. TrEMBL
Match: A0A1V0FWP9 (Venom kunitz type-like peptide Vf1 (Fragment) OS=Viridasius fasciatus OX=1971609 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.095e-15
Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C LP E G+CRG+FPRY+F+  TG+C+KF+YGGC GN+NNF T  EC+  C
Sbjct:    9 CDLPAETGVCRGFFPRYYFDRTTGQCQKFVYGGCGGNENNFETVEECQRTC 59          
BLAST of Kunitz-type serine protease inhibitor 6 vs. TrEMBL
Match: H9GVB9 (Tissue factor pathway inhibitor OS=Anolis carolinensis OX=28377 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 8.129e-15
Identity = 35/61 (57.38%), Postives = 45/61 (73.77%), Query Frame = 1
Query:  103 KEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ*LLN 285
            +E  CSLPK+ GLCR  F R++FN ETG+CE F YGGC+GN NNF T  EC ++CE  ++N
Sbjct:   64 QETICSLPKKTGLCRAAFHRFYFNSETGQCESFTYGGCEGNANNFLTWDECFSKCEGFIVN 124          

HSP 2 Score: 55.8398 bits (133), Expect = 6.947e-7
Identity = 25/51 (49.02%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            CSLP+E G CR  F R++F+ ++G+CE F Y G  GN NNF T  +C  +C
Sbjct:  177 CSLPRETGRCRRSFRRFYFDSKSGQCESFRYSGRGGNANNFLTQDDCVTKC 227          

HSP 3 Score: 53.5286 bits (127), Expect = 4.606e-6
Identity = 23/44 (52.27%), Postives = 28/44 (63.64%), Query Frame = 1
Query:  136 GLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            G C GYFP Y++N E   C+ FIY GC GN NNF++  EC   C
Sbjct:    2 GFCNGYFPHYYYNAENKTCQLFIYNGCGGNDNNFHSVRECLQTC 45          
BLAST of Kunitz-type serine protease inhibitor 6 vs. TrEMBL
Match: A0A2T7PBH0 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_10027 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.701e-14
Identity = 32/53 (60.38%), Postives = 39/53 (73.58%), Query Frame = 1
Query:  109 PECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            P CSLP E G C+ YFPR++FN  TG CE+FIYGGC GN NN+ T  +C+A C
Sbjct:  148 PACSLPSETGPCKAYFPRFYFNTNTGSCEQFIYGGCDGNDNNYLTVEDCQATC 200          

HSP 2 Score: 58.151 bits (139), Expect = 7.286e-8
Identity = 27/51 (52.94%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C+ P  +G CRG F RYFFN+ +  CE FIYGGC  N NNF T  +C+  C
Sbjct:   22 CTDPAIIGPCRGQFYRYFFNQISQSCELFIYGGCGANDNNFLTLEDCQTAC 72          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Cavefish
Match: lrp11 (LDL receptor related protein 11 [Source:NCBI gene;Acc:103032685])

HSP 1 Score: 64.3142 bits (155), Expect = 6.178e-13
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C  P  VG CRG FPR++++   G+C+ F+YGGC+GN+NNF    +C   C Q
Sbjct:  417 CMEPPVVGPCRGTFPRWYYDAAAGECKHFLYGGCKGNRNNFLQQTDCVNECIQ 469          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Cavefish
Match: lrp11 (LDL receptor related protein 11 [Source:NCBI gene;Acc:103032685])

HSP 1 Score: 63.1586 bits (152), Expect = 1.459e-12
Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C  P  VG CRG FPR++++   G+C+ F+YGGC+GN+NNF    +C   C Q
Sbjct:  417 CMEPPVVGPCRGTFPRWYYDAAAGECKHFLYGGCKGNRNNFLQQTDCVNECIQ 469          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Cavefish
Match: aplp2 (amyloid beta precursor like protein 2 [Source:NCBI gene;Acc:103022515])

HSP 1 Score: 62.003 bits (149), Expect = 3.718e-12
Identity = 26/53 (49.06%), Postives = 34/53 (64.15%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            CSL  E G CR   PR+ F+ +  KC +FIYGGC GN+NNF +   C A C++
Sbjct:  315 CSLEAETGPCRASMPRWHFDMQQRKCVRFIYGGCAGNRNNFDSEEYCMAVCKR 367          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Cavefish
Match: aplp2 (amyloid beta precursor like protein 2 [Source:NCBI gene;Acc:103022515])

HSP 1 Score: 61.6178 bits (148), Expect = 4.434e-12
Identity = 26/53 (49.06%), Postives = 34/53 (64.15%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            CSL  E G CR   PR+ F+ +  KC +FIYGGC GN+NNF +   C A C++
Sbjct:  315 CSLEAETGPCRASMPRWHFDMQQRKCVRFIYGGCAGNRNNFDSEEYCMAVCKR 367          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Cavefish
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:NCBI gene;Acc:103023332])

HSP 1 Score: 60.077 bits (144), Expect = 6.032e-12
Identity = 28/51 (54.90%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C  P EVG CR    RYFFN  T +CE+F YGGCQGN+NNF +   C   C
Sbjct:   87 CRFPSEVGPCRALLSRYFFNMTTMQCEQFYYGGCQGNENNFQSHQSCMEYC 137          

HSP 2 Score: 56.225 bits (134), Expect = 1.624e-10
Identity = 28/51 (54.90%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C LP   G CRG   RYF+N  T +CE+F YGGC GN NNF T  EC   C
Sbjct:   27 CLLPAVEGPCRGLVSRYFYNTLTQRCEEFSYGGCGGNANNFVTFQECHKMC 77          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Sea Lamprey
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:ZFIN;Acc:ZDB-GENE-060503-38])

HSP 1 Score: 69.707 bits (169), Expect = 4.945e-16
Identity = 32/56 (57.14%), Postives = 37/56 (66.07%), Query Frame = 1
Query:  103 KEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCE 270
            +   C+LP + G CR  FPRYFFN  T +CE FIYGGC  N+NNF T  ECRA C 
Sbjct:   23 QRVTCTLPAKPGDCRAAFPRYFFNRSTLRCESFIYGGCHSNENNFETMQECRAACS 78          

HSP 2 Score: 45.8246 bits (107), Expect = 2.235e-7
Identity = 22/51 (43.14%), Postives = 25/51 (49.02%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C    E G CR +  RYF+N   G C  F+YGGC GN N F     C   C
Sbjct:   87 CRPDAETGRCRAHITRYFYNMTLGMCMPFVYGGCGGNNNRFEDMESCVFSC 137          

HSP 3 Score: 42.743 bits (99), Expect = 3.231e-6
Identity = 20/52 (38.46%), Postives = 28/52 (53.85%), Query Frame = 1
Query:  112 ECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            EC    + G C+G F R+++N +   C  F Y GC GN NNF +   C + C
Sbjct:  146 ECLSRHDTGNCQGNFRRFYYNIQKRSCLPFSYSGCGGNNNNFISAKTCLSTC 197          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005038.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 8.568e-13
Identity = 29/57 (50.88%), Postives = 32/57 (56.14%), Query Frame = 1
Query:   97 DCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            D     C L  EVG+CR    RYFFN  +G CE+F YGGCQGN NNF     C   C
Sbjct:   69 DIAPKACRLDMEVGVCRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHC 125          

HSP 2 Score: 55.8398 bits (133), Expect = 6.498e-11
Identity = 26/52 (50.00%), Postives = 32/52 (61.54%), Query Frame = 1
Query:  112 ECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
             C +  + G CR Y PR F+N  T +CE F YGGC GN NNF +  EC A+C
Sbjct:    2 SCMMDLDPGPCRAYLPRVFYNRYTQRCEPFHYGGCFGNGNNFESLAECNAKC 53          

HSP 3 Score: 49.2914 bits (116), Expect = 1.207e-8
Identity = 22/53 (41.51%), Postives = 29/53 (54.72%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C +  + G C    PR+ +N +T  CE F YGGC GN NNF +   C + C Q
Sbjct:  167 CLMKADPGECTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVCGQ 219          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005043.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 2.302e-12
Identity = 28/51 (54.90%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C L  EVG+CR    RYFFN  +G CE+F YGGCQGN NNF     C   C
Sbjct:   74 CRLDMEVGVCRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHC 124          

HSP 2 Score: 55.4546 bits (132), Expect = 7.206e-11
Identity = 26/52 (50.00%), Postives = 32/52 (61.54%), Query Frame = 1
Query:  112 ECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
             C +  + G CR Y PR F+N  T +CE F YGGC GN NNF +  EC A+C
Sbjct:    2 SCMMDLDPGPCRAYLPRVFYNRYTQRCEPFHYGGCFGNGNNFESLAECNAKC 53          

HSP 3 Score: 49.2914 bits (116), Expect = 1.176e-8
Identity = 22/53 (41.51%), Postives = 29/53 (54.72%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C +  + G C    PR+ +N +T  CE F YGGC GN NNF +   C + C Q
Sbjct:  166 CLMKADPGECTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVCGQ 218          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009465.1 (pep scaffold:Pmarinus_7.0:GL478507:22936:25713:-1 gene:ENSPMAG00000008558.1 transcript:ENSPMAT00000009465.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 4.216e-10
Identity = 24/51 (47.06%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C L + VG CRG F R+ ++ E+  C++F YGGC GN NNF    EC   C
Sbjct:   72 CLLEEAVGPCRGSFTRWIYDAESSNCKEFTYGGCGGNFNNFLEETECMVTC 122          

HSP 2 Score: 51.6026 bits (122), Expect = 2.296e-9
Identity = 24/54 (44.44%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  106 EPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            +  C L      CRG F R+ ++ E+G C++F YGGC GN NNF    EC A C
Sbjct:  163 QDVCLLEAVTSPCRGSFTRWTYDAESGHCKEFTYGGCGGNFNNFLEETECVAMC 216          

HSP 3 Score: 51.2174 bits (121), Expect = 3.384e-9
Identity = 23/51 (45.10%), Postives = 30/51 (58.82%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C L    G CRG F R+ ++  T  C++F YGGC+GN+NNF    EC   C
Sbjct:    1 CLLNPTTGPCRGSFTRWTYDAATSTCKEFTYGGCRGNQNNFLEEAECLMDC 51          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Sea Lamprey
Match: WFIKKN1 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30912])

HSP 1 Score: 50.8322 bits (120), Expect = 5.682e-9
Identity = 22/51 (43.14%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            CSLP + G C+ +  R+ +N    +C+ FIYGGC+GN+NNF +   C   C
Sbjct:  374 CSLPVQQGPCKQWALRWAYNPLIKRCQSFIYGGCEGNENNFQSQELCEDNC 424          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Nematostella
Match: EDO29819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2J6])

HSP 1 Score: 73.559 bits (179), Expect = 6.541e-19
Identity = 32/53 (60.38%), Postives = 38/53 (71.70%), Query Frame = 1
Query:  109 PECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
              C+LPK+VG CR   PR FFN ++GKCE FIYGGC GN NNF+T  EC+  C
Sbjct:   12 SACTLPKKVGDCRAAMPRVFFNSQSGKCEDFIYGGCGGNANNFHTMEECKKAC 64          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Nematostella
Match: EDO41696 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T1])

HSP 1 Score: 64.6994 bits (156), Expect = 1.345e-15
Identity = 28/52 (53.85%), Postives = 37/52 (71.15%), Query Frame = 1
Query:  112 ECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            EC  PK  G CR YF R+F+N+ + KC++F+YGGCQGN NNF +  EC  +C
Sbjct:    1 ECLQPKLTGPCRAYFERWFYNQTSRKCKQFVYGGCQGNSNNFESKAECEKKC 52          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Nematostella
Match: EDO26263 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T1])

HSP 1 Score: 64.6994 bits (156), Expect = 1.345e-15
Identity = 28/52 (53.85%), Postives = 37/52 (71.15%), Query Frame = 1
Query:  112 ECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            EC  PK  G CR YF R+F+N+ + KC++F+YGGCQGN NNF +  EC  +C
Sbjct:    1 ECLQPKLTGPCRAYFERWFYNQTSRKCKQFVYGGCQGNSNNFESKAECEKKC 52          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Nematostella
Match: EDO49645 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFR1])

HSP 1 Score: 62.003 bits (149), Expect = 1.913e-14
Identity = 28/57 (49.12%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ*LLN 285
            C LPKE GLC G F ++F+N     C+KF YGGC GN N F T   C+  C+  LL+
Sbjct:    4 CQLPKEAGLCEGLFTKWFYNATANHCQKFTYGGCGGNANRFDTKRACKLACKGILLS 60          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Nematostella
Match: EDO31760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX09])

HSP 1 Score: 59.3066 bits (142), Expect = 2.163e-13
Identity = 27/51 (52.94%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C LPK  G+CR    R+++N ET KC KF +GGC GN NNF T   CR  C
Sbjct:    1 CDLPKNPGVCRASIQRWYYNNETRKCIKFTFGGCHGNANNFPTKSSCRNAC 51          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Medaka
Match: ENSORLT00000012975.2 (pep primary_assembly:ASM223467v1:12:15740273:15760140:1 gene:ENSORLG00000010354.2 transcript:ENSORLT00000012975.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 1.770e-13
Identity = 30/51 (58.82%), Postives = 35/51 (68.63%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C+   + GLC GYF RYF+N   G+CE FIYGGC GN+NNF T  EC  RC
Sbjct:  125 CAQAPDSGLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKECLQRC 175          

HSP 2 Score: 61.2326 bits (147), Expect = 1.677e-12
Identity = 29/50 (58.00%), Postives = 34/50 (68.00%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRAR 264
            C+   + GLC GYF RYF+N   G+CE FIYGGC GN+NNF T  EC  R
Sbjct:   73 CAQAPDSGLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKECLQR 122          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Medaka
Match: lrp11 (low-density lipoprotein receptor-related protein 11 [Source:NCBI gene;Acc:101175213])

HSP 1 Score: 64.6994 bits (156), Expect = 3.715e-13
Identity = 25/53 (47.17%), Postives = 37/53 (69.81%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            C     VG C+G FPR+++++ TG+C+ F+YGGCQGN NNF   ++C + C Q
Sbjct:  394 CGADPVVGPCKGTFPRWYYDQNTGECKHFLYGGCQGNHNNFLQELDCISECIQ 446          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Medaka
Match: ENSORLT00000042019.1 (pep primary_assembly:ASM223467v1:12:15740119:15780496:1 gene:ENSORLG00000010354.2 transcript:ENSORLT00000042019.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 4.755e-13
Identity = 31/54 (57.41%), Postives = 37/54 (68.52%), Query Frame = 1
Query:  103 KEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRAR 264
            K P+  +P + GLC GYF RYF+N   G+CE FIYGGC GN+NNF T  EC  R
Sbjct:   77 KLPQPHIPPDSGLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKECLQR 130          

HSP 2 Score: 58.5362 bits (140), Expect = 3.151e-11
Identity = 28/47 (59.57%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIEC 255
            C+   + GLC GYF RYF+N   G+CE FIYGGC GN+NNF T  EC
Sbjct:   25 CAQAPDSGLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKEC 71          

HSP 3 Score: 50.0618 bits (118), Expect = 4.075e-8
Identity = 26/51 (50.98%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C+L  + G C  Y  RYF+N +  +CE FIYG C GN+NNF T  EC  RC
Sbjct:  133 CTLDPDPGPCECYSERYFYNFKKRRCEIFIYGCCNGNQNNFETEQECLRRC 183          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Medaka
Match: APP (amyloid-beta A4 protein [Source:NCBI gene;Acc:101162104])

HSP 1 Score: 62.7734 bits (151), Expect = 1.667e-12
Identity = 25/51 (49.02%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C    E G CR   PR+FF+ E G+C +FIYGGC GN+NNF +   C + C
Sbjct:  330 CWADAETGPCRALLPRWFFDREEGRCVQFIYGGCGGNRNNFESEEYCMSVC 380          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Medaka
Match: spint1a (kunitz-type protease inhibitor 1 [Source:NCBI gene;Acc:101175207])

HSP 1 Score: 62.7734 bits (151), Expect = 1.932e-12
Identity = 27/51 (52.94%), Postives = 36/51 (70.59%), Query Frame = 1
Query:  115 CSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
            C +PK+VG CRG FPR+++N  + KCE F +GGC+ NKNN+ T  EC   C
Sbjct:  234 CLVPKKVGPCRGSFPRWYYNAASEKCETFFFGGCRQNKNNYLTEEECAMAC 284          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Planmine SMEST
Match: SMESG000013910.1 (SMESG000013910.1)

HSP 1 Score: 129.798 bits (325), Expect = 8.578e-41
Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 1
Query:   88 HLGDCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            HLGDCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ
Sbjct:   11 HLGDCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 72          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Planmine SMEST
Match: SMESG000013915.1 (SMESG000013915.1)

HSP 1 Score: 117.857 bits (294), Expect = 1.037e-35
Identity = 56/60 (93.33%), Postives = 58/60 (96.67%), Query Frame = 1
Query:   94 GDCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
            G  ++PECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ
Sbjct:   38 GRVEKPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 97          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Planmine SMEST
Match: SMESG000037994.1 (SMESG000037994.1)

HSP 1 Score: 79.7221 bits (195), Expect = 7.005e-21
Identity = 35/60 (58.33%), Postives = 44/60 (73.33%), Query Frame = 1
Query:   88 HLGDCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 267
             LG+ + PEC+ PK+ G+C  YFPR++FN ++G CE FIYGGCQ N NNF T  EC ARC
Sbjct:   16 SLGESRAPECNEPKKTGMCAAYFPRFYFNIQSGNCESFIYGGCQANGNNFNTIEECEARC 75          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Planmine SMEST
Match: SMESG000038052.1 (SMESG000038052.1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.373e-19
Identity = 34/62 (54.84%), Postives = 41/62 (66.13%), Query Frame = 1
Query:   88 HLGDCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
             L + K PEC+LP E GLC  YF RY F+ + GKC  F+YGGC  N NNF+T  EC  RCE+
Sbjct:   16 QLTESKSPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 77          
BLAST of Kunitz-type serine protease inhibitor 6 vs. Planmine SMEST
Match: SMESG000038055.1 (SMESG000038055.1)

HSP 1 Score: 72.0182 bits (175), Expect = 7.276e-18
Identity = 34/62 (54.84%), Postives = 41/62 (66.13%), Query Frame = 1
Query:   88 HLGDCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARCEQ 273
             L + K PEC+L  E GLCR YF RY F+ + GKC  F+YGGC  N NNF+T  EC  RCE+
Sbjct:   16 QLIEGKAPECNLSLETGLCRAYFVRYGFDVKLGKCRTFVYGGCPVNDNNFHTRAECEERCEK 77          
The following BLAST results are available for this feature:
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TFPI8.754e-1354.72tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
TFPI8.754e-1354.72tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
TFPI1.035e-1254.72tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
TFPI2.498e-1254.72tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
TFPI2.498e-1254.72tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mlt-113.286e-1349.02pep chromosome:WBcel235:V:20667211:20678513:1 gene... [more]
mlt-113.306e-1349.02pep chromosome:WBcel235:V:20667211:20678513:1 gene... [more]
mlt-113.318e-1349.02pep chromosome:WBcel235:V:20667211:20678513:1 gene... [more]
mlt-113.414e-1349.02pep chromosome:WBcel235:V:20667209:20678513:1 gene... [more]
mlt-113.430e-1349.02pep chromosome:WBcel235:V:20667209:20678513:1 gene... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG154188.967e-1354.55gene:FBgn0031554 transcript:FBtr0077556[more]
CG154188.967e-1354.55gene:FBgn0031554 transcript:FBtr0446100[more]
CG36044.535e-1250.00gene:FBgn0031562 transcript:FBtr0077545[more]
CG36044.535e-1250.00gene:FBgn0031562 transcript:FBtr0346581[more]
Ppn1.866e-1045.28gene:FBgn0003137 transcript:FBtr0300337[more]
back to top
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spint22.033e-1252.94serine peptidase inhibitor, Kunitz type, 2 [Source... [more]
spint22.053e-1252.94serine peptidase inhibitor, Kunitz type, 2 [Source... [more]
wfikkn15.205e-1254.90WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
aplp28.087e-1246.43amyloid beta (A4) precursor-like protein 2 [Source... [more]
aplp29.834e-1246.43amyloid beta (A4) precursor-like protein 2 [Source... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itch2.457e-1146.30itchy E3 ubiquitin protein ligase [Source:Xenbase;... [more]
itch2.459e-1146.30itchy E3 ubiquitin protein ligase [Source:Xenbase;... [more]
itch2.460e-1146.30itchy E3 ubiquitin protein ligase [Source:Xenbase;... [more]
PAPLN3.388e-1149.06papilin, proteoglycan-like sulfated glycoprotein [... [more]
PAPLN3.694e-1149.06papilin, proteoglycan-like sulfated glycoprotein [... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spint34.152e-1554.72serine peptidase inhibitor, Kunitz type, 3 [Source... [more]
Eppin1.112e-1450.88epididymal peptidase inhibitor [Source:MGI Symbol;... [more]
Tfpi3.922e-1454.72tissue factor pathway inhibitor [Source:MGI Symbol... [more]
Tfpi3.922e-1454.72tissue factor pathway inhibitor [Source:MGI Symbol... [more]
Tfpi3.922e-1454.72tissue factor pathway inhibitor [Source:MGI Symbol... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0DMW6|VKT3A_ACTEQ1.125e-1864.15PI-actitoxin-Aeq3a OS=Actinia equina OX=6106 PE=1 ... [more]
sp|P0DMW7|VKT3B_ACTEQ3.820e-1862.26PI-actitoxin-Aeq3b OS=Actinia equina OX=6106 PE=1 ... [more]
sp|P0DMX0|VKT3_ANTAF5.813e-1766.67PI-actitoxin-Axm2b OS=Anthopleura aff. xanthogramm... [more]
sp|P0DJ50|VKT31_MESMA1.387e-1646.67Kunitz-type serine protease inhibitor BmKTT-2 OS=M... [more]
sp|B1B5I8|VKT3_STIHA6.724e-1664.71KappaPI-stichotoxin-Shd2a OS=Stichodactyla haddoni... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZII09.339e-1655.93Serine protease inhibitor-1 (Fragment) OS=Schmidte... [more]
A7T2J64.730e-1560.38Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A1V0FWP96.095e-1560.78Venom kunitz type-like peptide Vf1 (Fragment) OS=V... [more]
H9GVB98.129e-1557.38Tissue factor pathway inhibitor OS=Anolis caroline... [more]
A0A2T7PBH02.701e-1460.38Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp116.178e-1347.17LDL receptor related protein 11 [Source:NCBI gene;... [more]
lrp111.459e-1247.17LDL receptor related protein 11 [Source:NCBI gene;... [more]
aplp23.718e-1249.06amyloid beta precursor like protein 2 [Source:NCBI... [more]
aplp24.434e-1249.06amyloid beta precursor like protein 2 [Source:NCBI... [more]
tfpi26.032e-1254.90tissue factor pathway inhibitor 2 [Source:NCBI gen... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfpi24.945e-1657.14tissue factor pathway inhibitor 2 [Source:ZFIN;Acc... [more]
ENSPMAT00000005038.18.568e-1350.88pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
ENSPMAT00000005043.12.302e-1254.90pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
ENSPMAT00000009465.14.216e-1047.06pep scaffold:Pmarinus_7.0:GL478507:22936:25713:-1 ... [more]
WFIKKN15.682e-943.14WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO298196.541e-1960.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416961.345e-1553.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262631.345e-1553.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496451.913e-1449.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317602.163e-1352.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000012975.21.770e-1358.82pep primary_assembly:ASM223467v1:12:15740273:15760... [more]
lrp113.715e-1347.17low-density lipoprotein receptor-related protein 1... [more]
ENSORLT00000042019.14.755e-1357.41pep primary_assembly:ASM223467v1:12:15740119:15780... [more]
APP1.667e-1249.02amyloid-beta A4 protein [Source:NCBI gene;Acc:1011... [more]
spint1a1.932e-1252.94kunitz-type protease inhibitor 1 [Source:NCBI gene... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013910.18.578e-41100.00SMESG000013910.1[more]
SMESG000013915.11.037e-3593.33SMESG000013915.1[more]
SMESG000037994.17.005e-2158.33SMESG000037994.1[more]
SMESG000038052.14.373e-1954.84SMESG000038052.1[more]
SMESG000038055.17.276e-1854.84SMESG000038055.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007141 ID=SMED30007141|Name=Kunitz-type serine protease inhibitor 6|organism=Schmidtea mediterranea sexual|type=transcript|length=336bp
TTTAAACCCTCAAGGTTTTTTTAAATAACAATAATAATAATAATGAATTC
GATAATCATTTTCTCAGTTATATTTGTCGCTACTATTCATTTGGGTGATT
GTAAAGAACCAGAATGCAGTCTTCCTAAAGAAGTCGGTCTGTGCAGAGGA
TATTTCCCAAGGTATTTTTTCAATGAAGAAACGGGAAAATGTGAGAAATT
CATTTATGGTGGATGCCAAGGAAACAAAAATAATTTCTACACTCCAATTG
AATGCAGAGCTCGATGCGAGCAATAATTACTGAATATTTATTTAATAAAA
ATTAAATAATTTTAAAAAAAAAAAAAAAAAATGCGA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0010466negative regulation of peptidase activity
GO:0006508proteolysis
GO:0010951negative regulation of endopeptidase activity
Vocabulary: molecular function
TermDefinition
GO:0030414peptidase inhibitor activity
GO:0004867serine-type endopeptidase inhibitor activity
GO:0008233peptidase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000067goblet cell
PLANA:0000419prepharyngeal region
PLANA:0000421tail
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR036880Kunitz_BPTI_sf
IPR002223Kunitz_BPTI
IPR020901Prtase_inh_Kunz-CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002223Pancreatic trypsin inhibitor Kunitz domainPRINTSPR00759BASICPTASEcoord: 50..60
score: 63.89
coord: 22..36
score: 35.27
coord: 60..75
score: 47.83
IPR002223Pancreatic trypsin inhibitor Kunitz domainSMARTSM00131KU_2coord: 23..76
e-value: 4.0E-23
score: 92.8
IPR002223Pancreatic trypsin inhibitor Kunitz domainPFAMPF00014Kunitz_BPTIcoord: 25..76
e-value: 1.8E-19
score: 69.7
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 25..75
score: 15.437
IPR002223Pancreatic trypsin inhibitor Kunitz domainCDDcd00109KUcoord: 25..75
e-value: 8.34499E-22
score: 77.6754
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilyGENE3DG3DSA:4.10.410.10coord: 21..77
e-value: 2.9E-23
score: 83.4
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilySUPERFAMILYSSF57362BPTI-likecoord: 19..76
NoneNo IPR availablePANTHERPTHR10083:SF322GEO10309P1coord: 14..75
NoneNo IPR availablePANTHERPTHR10083KUNITZ-TYPE PROTEASE INHIBITOR-RELATEDcoord: 14..75
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.756
IPR020901Proteinase inhibitor I2, Kunitz, conserved sitePROSITEPS00280BPTI_KUNITZ_1coord: 53..71