Cyclic nucleotide gated channel alpha 3

Overview
NameCyclic nucleotide gated channel alpha 3
Smed IDSMED30007138
Length (bp)1923
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cyclic nucleotide gated channel alpha 3 (SMED30007138) t-SNE clustered cells

Violin plots show distribution of expression levels for Cyclic nucleotide gated channel alpha 3 (SMED30007138) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007138

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007138SMESG000013398.1 SmedASXL_015385SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA3 (cyclic nucleotide gated channel subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:2150])

HSP 1 Score: 543.888 bits (1400), Expect = 0.000e+0
Identity = 266/515 (51.65%), Postives = 370/515 (71.84%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
             W+  + L V +N  +L  RA F   Q +Y  LW V DY  D   V+D+++ +R  FLEQGL+V + NRL ++Y +  +FK+D+++++P +L  L +     +Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L++++LI+IHWN C +F +S  IG G+D +VYP          ++S+ +   + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVGSMISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR  VFSPGDYIC+KGDIGKEMYI+  GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNLID E +     +   +E  + ++ SS+    ++ ++L+ ++      MK +LS++E Q+
Sbjct:  170 RWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYLKV---GTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYP----------NISIPEH-GRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAR-AGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQV 669          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA3 (cyclic nucleotide gated channel subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:2150])

HSP 1 Score: 543.888 bits (1400), Expect = 0.000e+0
Identity = 266/515 (51.65%), Postives = 370/515 (71.84%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
             W+  + L V +N  +L  RA F   Q +Y  LW V DY  D   V+D+++ +R  FLEQGL+V + NRL ++Y +  +FK+D+++++P +L  L +     +Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L++++LI+IHWN C +F +S  IG G+D +VYP          ++S+ +   + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVGSMISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR  VFSPGDYIC+KGDIGKEMYI+  GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNLID E +     +   +E  + ++ SS+    ++ ++L+ ++      MK +LS++E Q+
Sbjct:  152 RWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYLKV---GTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYP----------NISIPE-HGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAR-AGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQV 651          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA1 (cyclic nucleotide gated channel subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:2148])

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 256/514 (49.81%), Postives = 370/514 (71.98%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEK 1853
            +W+  +TL V++N  ++  RA F   Q  Y   W + DY+ D   +ID+ + +R  +LEQGLLVKE  +L   Y S ++FK+D+++++P +L    L     +Y   R NRL +  ++FEF  RT+TRTN+PNIFRIS+L+++++I+IHWN C F+ +S +IG G+D +VYP             ++ P + + +  Y+YS +WSTLTLTT+ E P PV +SE++ + ++ L GVLIFATI+GN+GSMISNMNAA+ +FQ +ID +K+YM FR V K++E+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSK+GNRRTAN+KS+GYSDLFCL+KDDL + L EYPDAK  L ++GK+ILMKD L+DL  + N   +   +E  + ++E S+    ++ ++++ ++E+    +K +L+K+EK
Sbjct:  167 NWLFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNLQFKLDVLSLIPTDLLYFKL---GWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYP------------DINDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDLNIA-NAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK 664          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA1 (cyclic nucleotide gated channel subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:2148])

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 256/514 (49.81%), Postives = 370/514 (71.98%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEK 1853
            +W+  +TL V++N  ++  RA F   Q  Y   W + DY+ D   +ID+ + +R  +LEQGLLVKE  +L   Y S ++FK+D+++++P +L    L     +Y   R NRL +  ++FEF  RT+TRTN+PNIFRIS+L+++++I+IHWN C F+ +S +IG G+D +VYP             ++ P + + +  Y+YS +WSTLTLTT+ E P PV +SE++ + ++ L GVLIFATI+GN+GSMISNMNAA+ +FQ +ID +K+YM FR V K++E+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSK+GNRRTAN+KS+GYSDLFCL+KDDL + L EYPDAK  L ++GK+ILMKD L+DL  + N   +   +E  + ++E S+    ++ ++++ ++E+    +K +L+K+EK
Sbjct:  167 NWLFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNLQFKLDVLSLIPTDLLYFKL---GWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYP------------DINDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDLNIA-NAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK 664          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA1 (cyclic nucleotide gated channel subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:2148])

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 256/514 (49.81%), Postives = 370/514 (71.98%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEK 1853
            +W+  +TL V++N  ++  RA F   Q  Y   W + DY+ D   +ID+ + +R  +LEQGLLVKE  +L   Y S ++FK+D+++++P +L    L     +Y   R NRL +  ++FEF  RT+TRTN+PNIFRIS+L+++++I+IHWN C F+ +S +IG G+D +VYP             ++ P + + +  Y+YS +WSTLTLTT+ E P PV +SE++ + ++ L GVLIFATI+GN+GSMISNMNAA+ +FQ +ID +K+YM FR V K++E+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSK+GNRRTAN+KS+GYSDLFCL+KDDL + L EYPDAK  L ++GK+ILMKD L+DL  + N   +   +E  + ++E S+    ++ ++++ ++E+    +K +L+K+EK
Sbjct:  167 NWLFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNLQFKLDVLSLIPTDLLYFKL---GWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYP------------DINDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDLNIA-NAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK 664          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: tax-4 (Cyclic nucleotide-gated cation channel [Source:UniProtKB/Swiss-Prot;Acc:Q03611])

HSP 1 Score: 486.493 bits (1251), Expect = 1.284e-163
Identity = 254/507 (50.10%), Postives = 360/507 (71.01%), Query Frame = 3
Query:  402 YRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIE-LFSLILPHRNIDYVWY-----RFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI*EKHFSQFTVI 1904
            +R LW  FD ++D   +ID  +N R  +++QGL+V+E  ++ K Y    +++ID I+++P++ +    +P+ N    W      R NRL +  ++   ++RT+TR++ PN FR+  ++ +++I+IHWN C +F++S  IGLG+D +VY    +  + +L   ++   D     Y+YSF+WSTL LTT+ EVP PV N E+  +TL+L+ GVLIFATI+GNVGSMISNM+AA+T+FQ K+DG+K+YME R V K+LE R+I WFDYLW NKQSL +  +L  LPDKL+AEIA+QVH+ETL+ V+IFQDCE  LL +L+LKL++QVFSPGD+IC+KGDIG+EMYIVKRG+L VV DDG KVFVTL+EGSVFGELSILNI GSK+GNRRTANV+SVGY+DLF L+K DLW+ L EYPDA+  L+ +G+EIL KDNL+D    EN       +E I   + +++K   +++++LI      HSS + KL K  + +     EKH S++  +
Sbjct:  200 FRMLWVFFDLLMDCVYLIDTFLNYRMGYMDQGLVVREAEKVTKAYWQSKQYRIDGISLIPLDYILGWPIPYIN----WRGLPILRLNRLIRYKRVRNCLERTETRSSMPNAFRVVVVVWYIVIIIHWNACLYFWISEWIGLGTDAWVY---GHLNKQSLPDDIT---DTLLRRYVYSFYWSTLILTTIGEVPSPVRNIEYAFVTLDLMCGVLIFATIVGNVGSMISNMSAARTEFQNKMDGIKQYMELRKVSKQLEIRVIKWFDYLWTNKQSLSDQQVLKVLPDKLQAEIAMQVHFETLRKVRIFQDCEAGLLAELVLKLQLQVFSPGDFICKKGDIGREMYIVKRGRLQVVDDDGKKVFVTLQEGSVFGELSILNIAGSKNGNRRTANVRSVGYTDLFVLSKTDLWNALREYPDARKLLLAKGREILKKDNLLD----ENAPEEQKTVEEIAEHLNNAVKVLQTRMARLI----VEHSSTEGKLMKRIEML-----EKHLSRYKAL 683          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: cng-1 (Cyclic Nucleotide Gated channel [Source:UniProtKB/TrEMBL;Acc:A8WI01])

HSP 1 Score: 338.191 bits (866), Expect = 4.828e-107
Identity = 191/510 (37.45%), Postives = 292/510 (57.25%), Query Frame = 3
Query:  483 FLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGS----------DGFVYP---------PRSNN------------TEATLSVSVSQ---PWDQFST---------MYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQS-LDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNG-MENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI*E 1877
            ++E G+ VK +++L  + +    F +D+IA++P E   +        + W R NRLTK Y+LF+F  +TDTRT  P+ F +  LI   +++ HWNGC +F++S      +          D  + P         P   +             E  +  +V+     W+  +T          Y  SF+WS LTL T+ E P P    +      + L G++IFA I+G+VG+M+  +N  K++F+  +DG KR+M +R V   L ++ + +F Y+W +  + +DE+ I   LP +L  EIAV++H +TLK VK+F+ C+  LL +LILKL+++V+SP DYIC+KGD+G EMYIVK G + VV++DG  +FVTL  G VFGELSILNIPG+K+ N RTA+V+S GYSDL+ L+K+DLW+ L EYP AK  LIQ+G +IL KD +ID    ++   + NG +E+ +  +E  I      I Q  +    ++  MK +L  +E  +   I E
Sbjct:  136 YVENGVAVKNLSKLMHHRLKSTFFILDVIAVVPAESLHIF----GDSFFWSRINRLTKCYRLFDFSTQTDTRTTSPHAFGLFKLIFICVVIFHWNGCLYFYISKVYNYTTARLEHWIFSYDKIINPILATCVTDIPNHRDFCDTDDLLITHLPENEVQFTVTDYMTTWENKTTTIKFANFFRQYALSFYWSALTLVTLGEQPSPCTTFQNAFEIGDTLLGLVIFAVIVGDVGNMVVAINLRKSEFENVLDGCKRFMVYRKVPNLLRKKAVEYFAYVWAHGGAQVDEEEIAEFLPPRLFGEIAVEIHMDTLKKVKLFESCDPRLLYELILKLQLRVYSPMDYICKKGDVGTEMYIVKEGFVEVVSEDGQTIFVTLPAGFVFGELSILNIPGNKNKNLRTASVRSKGYSDLYVLDKEDLWEALHEYPQAKDSLIQKGIQILEKDKMIDPNMVDDEDESFNGPIEDYMEHLEHEILKITKMIDQAEDKIHKSNQKMKTRLFGMEMDLVHEIKE 641          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: cng-2 (Cyclic Nucleotide Gated channel [Source:UniProtKB/TrEMBL;Acc:Q9N4C1])

HSP 1 Score: 289.271 bits (739), Expect = 5.788e-87
Identity = 177/563 (31.44%), Postives = 304/563 (54.00%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSD-----GF----VYPPRSNNTEA-------------TLSVSVSQP---------WDQ---------FSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMEN-----------IINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIE 1850
            +W  ++++ +L+N+  + V   F      Y + W   +   D   ++D ++ SR  F+ +G  V + +++ KNY      K+DL+ + P + +  I    ++     R  RL K Y+L+EFI  T  RT+FP+  +I  L     I+ HWN C +F  S   GL  D     GF    V+ PR +  +A              L +   +P         WD+         FS  Y  + +WS+LT+T   + P P  +S+  +   + L GVL+FATIIG VGS+++ M+    DF+  +DG+K YM++RGV   ++ R++N F YL  + Q  DE+ ILS LP   +A IA  +H +TL  V +F  C++ LL ++++ ++ QV+SP DY+CRK +  KEM+IVK+G L V+ DD      +LKEG  FGELSI+ + G+  G+RR+ +++SVGYSD++ L++DD+  +L EYP+ +++L++  + +L    L++      +   D+G+++            +N++E+ I   D+ ++ +I  F     + K +++ +E
Sbjct:  233 YWTAIISIGILYNMFAM-VIFIFDDVHFGYFNQWLYVNLFFDFCFLLDCLVGSRMTFVSEGNEVSQTDKMFKNYRQSRRCKLDLLCLAPADFYLFIDTKASL----VRAIRLVKAYRLYEFIMLTQRRTDFPHFMKILFLTSSCAILFHWNACVYFLFSLYQGLTEDDPNAFGFSYYKVFDPRFSICDALYDQDCYYPEDTEVLDIRDERPHYMEDMYKFWDKKFNILQIGNFSREYSMTIYWSSLTITKCGQQPWPSKSSQNSLEIFDTLIGVLVFATIIGGVGSVVTQMSQNVNDFREMMDGIKFYMKYRGVQSAIQDRVLNCFLYLNSHNQLYDEEEILSLLPPFFQARIAANLHQDTLSKVSLFYKCDQRLLQEVVMLVKQQVYSPNDYLCRKNEKAKEMFIVKKGLLAVIDDDTGVELDSLKEGHTFGELSIVQVKGNILGDRRSVSLRSVGYSDVYVLHQDDVTRLLQEYPEERVRLMENARRMLHSRGLLETNELGEMCETDDGLDDEAMLEFLSVDEQLNRLENIIDSIDTDLANMITSFSYNSVAYKKRVTALE 790          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: che-6 (pep chromosome:WBcel235:IV:2104056:2111408:-1 gene:WBGene00000487.1 transcript:C23H5.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:che-6)

HSP 1 Score: 264.233 bits (674), Expect = 3.838e-79
Identity = 162/513 (31.58%), Postives = 273/513 (53.22%), Query Frame = 3
Query:  474 RKCFLEQGLLVKEVNRLRKNYI-SKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSD-----GF----VYPPRSNNTEA--------------TLSV---------SVSQPWD---------QFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLI------------DLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIE 1850
            R  +L +G  VK   +LRKNY   K++   D+  +LP++         ++     R  R+ K+ +L +F+ RT  +T FP  F+I  L V  +++ HWN C +F  S   G+  +     GF    V+ P     +A              TL +          +++ W           FS  Y  S +WS LT+TT  + P P  +S+  +   + L GVL+FATIIG+VGS+++ M+    +F+  +DG+K YM++R V   ++ R ++ F YL  + Q  DE+ ILS LP +L+A IA  +H ETL+ ++IF  CE   + +++L ++ QVFSP DY+CRK +  KE++IVK+GKL V+ DD  +    L EG+ FGELSI+ + G+  G RR  +++SVG+SD++ L +DD+  +L E+P     ++   + +L    L+            D E +++++L +  +   +N++   I G +  ++ +I  F  + S  K K++ +E
Sbjct:  122 RLTYLHEGEEVKNTKKLRKNYFFQKLKVANDIFCLLPLDFLLFFDDSMSL----VRTIRIVKVIRLMDFVQRTQQQTTFPRAFKIILLAVSCIVLFHWNACLYFLFSLYEGITEESQTEFGFSYYKVFEPVFPTCQAYYDENCWFGEDIDHTLDLDDVRDSYKKEMAEYWKDKHYRWTTGNFSREYSMSIYWSALTITTCGQQPWPSTSSQNSLEVFDTLIGVLVFATIIGSVGSVVTQMSQTVNEFRQMMDGIKFYMKYREVNSAIQERALSCFMYLMAHNQLDDEEGILSLLPPRLQANIAANLHMETLQNIQIFALCESRFMHEVVLLVKQQVFSPNDYLCRKNEKAKELFIVKKGKLRVIDDDTGEEMGELTEGATFGELSIVYVKGNLLGTRRCCSLQSVGFSDIYVLYRDDVSRLLQEFPQEYKTIVMNARNLLHSRGLLETTELGEMCDPSDHEEADDLVLEEMSVVEQLNRLNGIIDGLNGNMNVMILSFSNSCSYYKQKITGLE 630          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: tax-2 (TAX2 [Source:UniProtKB/TrEMBL;Acc:G5EEE2])

HSP 1 Score: 259.996 bits (663), Expect = 3.034e-76
Identity = 158/468 (33.76%), Postives = 254/468 (54.27%), Query Frame = 3
Query:  312 LHWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXX-XXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVV-ADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENV 1709
            + W+ ++TL  LFN   +P+R+++          W++ DY  D   VID+++   R  F   G+ VK     +++Y+    FK+D+++ILP +L         I    +R NR+ KI   +   D  D     P   RI+  + +++ +IH N C ++ +S     G   ++      N +  L+  V   ++     YI  F+++    T+    P P    E+I MT   + GV +FA ++G +  ++SN N  + +FQ K+D      +  G+  E   R+ +WF Y W  +++LDE  ++  LP KL+ ++A+ VHY TL  V++FQDC+  LL  L+LKLR  +F PGD IC KGD+GKEMYI+ +G L VV  D   K+F  L +G+VFGE+S+L I G+   NRRTA++++ GY  LF L K+DL DV+  YP A+  L ++   +L  D   D E +E +
Sbjct:  222 MTWLSLVTLCFLFNAFCIPLRSSYPYQTADNWMYWFIVDYSCDLVYVIDMLLIKPRLRFTRGGIQVKIYKDTQRHYLMTRTFKLDILSILPTDLMYFFFGKMPI----WRINRVLKINSFWLLFDMLDNSFANPYAIRIARTLSYMIYIIHCNSCVYYKLSALQAFGQIAYL-----ENGKWYLNKWV---YNNQGNAYIRCFYFTAAVATSTGNNPAPTNVIEYIYMTCSWMMGVFVFALLLGQIRDIVSNANRNREEFQRKMDLALGECKKLGLKMETTNRVRDWFIYTWQQQKTLDEKKLIEKLPLKLQTDLALSVHYTTLSKVQLFQDCDRALLRDLVLKLRPVIFLPGDMICLKGDVGKEMYIINQGILQVVGGDHNEKIFAELAQGAVFGEISLLAIGGN---NRRTASIRAKGYCTLFVLAKEDLNDVIRYYPQAQTILRRKAAAMLKNDKKSD-EKTEKI 673          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CngA (gene:FBgn0261612 transcript:FBtr0302924)

HSP 1 Score: 497.664 bits (1280), Expect = 1.063e-168
Identity = 242/518 (46.72%), Postives = 355/518 (68.53%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWY------RFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIE 1850
             W+ +++L VL+NI+ +  RA F    +   + WY  DY+ D   ++D +++  + FL+QGLLV++  RLR++Y     + +D++++LP +L  +  P      ++       R NRL +I +L+E+ DRT+T T +PN FRI  +++ +L++IHWN C +F +S  IG  SD +VY     N   T + ++ +        YIYSF+WSTLTLTT+ E P P  + E++ +  + L GVLIFATI+GN+GSMISNMN A+ +FQ ++DGVK+YM FR VG ELE R+I WF Y W    +LDE+ +L+ LPDKLKAEIA+QVH +TLK V+IF D E  LL  L+LKL++QVFSPGDYICRKGD+GKEMYIVKRGKL+VV DDGI V  TL  GSVFGE+S+L I G+++GNRRTANV+S+GYSDLFCL K DLW+ L++YP+A+  L QRG ++L KD L+D +   +     + +E  I K+E S++  + ++++L+ ++  + + +K +L+K+E
Sbjct:  109 RWLAIVSLAVLYNIIFVVGRAVFWEINKSAPAFWYTLDYLCDFIYLLDTLVHMHEGFLDQGLLVRDAFRLRRHYFHTKGWYLDVLSMLPTDLAYIWWPPETCSSLYLPCPVIVRLNRLLRINRLWEWFDRTETATGYPNAFRICKVVLAILVLIHWNACMYFAISYEIGFSSDSWVY-----NLNGTRNNTLQR-------QYIYSFYWSTLTLTTIGETPTPENDVEYLFVVADFLAGVLIFATIVGNIGSMISNMNVARVEFQNRMDGVKQYMAFRRVGHELEARVIRWFAYTWSQSGALDEERVLAALPDKLKAEIAIQVHMDTLKQVRIFHDTEPGLLEALVLKLKLQVFSPGDYICRKGDVGKEMYIVKRGKLSVVGDDGITVLATLGAGSVFGEVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLSDYPEARSTLTQRGCQLLRKDGLLDEQIFADSQRVHDSIEGGIEKLELSVENLNMRLARLLAEYTASQAKIKQRLAKLE 614          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CngA (gene:FBgn0261612 transcript:FBtr0302925)

HSP 1 Score: 498.049 bits (1281), Expect = 1.656e-166
Identity = 242/517 (46.81%), Postives = 355/517 (68.67%), Query Frame = 3
Query:  318 WIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWY------RFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIE 1850
            W+ +++L VL+NI+ +  RA F    +   + WY  DY+ D   ++D +++  + FL+QGLLV++  RLR++Y     + +D++++LP +L  +  P      ++       R NRL +I +L+E+ DRT+T T +PN FRI  +++ +L++IHWN C +F +S  IG  SD +VY     N   T + ++ +        YIYSF+WSTLTLTT+ E P P  + E++ +  + L GVLIFATI+GN+GSMISNMN A+ +FQ ++DGVK+YM FR VG ELE R+I WF Y W    +LDE+ +L+ LPDKLKAEIA+QVH +TLK V+IF D E  LL  L+LKL++QVFSPGDYICRKGD+GKEMYIVKRGKL+VV DDGI V  TL  GSVFGE+S+L I G+++GNRRTANV+S+GYSDLFCL K DLW+ L++YP+A+  L QRG ++L KD L+D +   +     + +E  I K+E S++  + ++++L+ ++  + + +K +L+K+E
Sbjct:  285 WLAIVSLAVLYNIIFVVGRAVFWEINKSAPAFWYTLDYLCDFIYLLDTLVHMHEGFLDQGLLVRDAFRLRRHYFHTKGWYLDVLSMLPTDLAYIWWPPETCSSLYLPCPVIVRLNRLLRINRLWEWFDRTETATGYPNAFRICKVVLAILVLIHWNACMYFAISYEIGFSSDSWVY-----NLNGTRNNTLQR-------QYIYSFYWSTLTLTTIGETPTPENDVEYLFVVADFLAGVLIFATIVGNIGSMISNMNVARVEFQNRMDGVKQYMAFRRVGHELEARVIRWFAYTWSQSGALDEERVLAALPDKLKAEIAIQVHMDTLKQVRIFHDTEPGLLEALVLKLKLQVFSPGDYICRKGDVGKEMYIVKRGKLSVVGDDGITVLATLGAGSVFGEVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLSDYPEARSTLTQRGCQLLRKDGLLDEQIFADSQRVHDSIEGGIEKLELSVENLNMRLARLLAEYTASQAKIKQRLAKLE 789          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CG42260 (gene:FBgn0259145 transcript:FBtr0299573)

HSP 1 Score: 394.815 bits (1013), Expect = 2.686e-125
Identity = 197/446 (44.17%), Postives = 301/446 (67.49%), Query Frame = 3
Query:  306 ILLHWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKL 1643
            +  +W  V+++  L+N  V+  R AF    R+  ++W+  DY+ D   +IDI+ + R  +LE G+L  +  +LR +Y++   F ID + +LP++   L +   +I     R  RL KIY+ + F+DRT+  TN+PN+FR ++LI +LL++ HWNGC +  +  + G GS  +VY    +++E+   V            Y+ S++W TL LTT+ ++P P    E++ + L+LL G+++FAT++G+V +++++++AA+ +FQ K+DGVK YM  R V   L+ ++I WFDYLW+ ++  DE+  +S LPDKLKAEIA+ VH +TLK V+IFQ+ E   L +L+L+LR  +FSPGDYICRKG++GKEMYIV RG+L VVAD+G  V  +LK GS FGE+SILN+    +GNRRTA+V+SVGYSDLF L+K D+WDVL EYP A+++L
Sbjct:  304 LCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFNSI----LRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVY----HDSESADVVK----------QYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRL 729          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CG42260 (gene:FBgn0259145 transcript:FBtr0330241)

HSP 1 Score: 395.201 bits (1014), Expect = 2.597e-123
Identity = 198/448 (44.20%), Postives = 302/448 (67.41%), Query Frame = 3
Query:  306 ILLHWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNI--PGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKL 1643
            +  +W  V+++  L+N  V+  R AF    R+  ++W+  DY+ D   +IDI+ + R  +LE G+L  +  +LR +Y++   F ID + +LP++   L +   +I     R  RL KIY+ + F+DRT+  TN+PN+FR ++LI +LL++ HWNGC +  +  + G GS  +VY    +++E+   V            Y+ S++W TL LTT+ ++P P    E++ + L+LL G+++FAT++G+V +++++++AA+ +FQ K+DGVK YM  R V   L+ ++I WFDYLW+ ++  DE+  +S LPDKLKAEIA+ VH +TLK V+IFQ+ E   L +L+L+LR  +FSPGDYICRKG++GKEMYIV RG+L VVAD+G  V  +LK GS FGE+SILN+   G + GNRRTA+V+SVGYSDLF L+K D+WDVL EYP A+++L
Sbjct:  579 LCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFNSI----LRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVY----HDSESADVVK----------QYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNMGTAGKELGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRL 1008          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CG42260 (gene:FBgn0259145 transcript:FBtr0299572)

HSP 1 Score: 394.43 bits (1012), Expect = 5.705e-123
Identity = 197/446 (44.17%), Postives = 301/446 (67.49%), Query Frame = 3
Query:  306 ILLHWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKL 1643
            +  +W  V+++  L+N  V+  R AF    R+  ++W+  DY+ D   +IDI+ + R  +LE G+L  +  +LR +Y++   F ID + +LP++   L +   +I     R  RL KIY+ + F+DRT+  TN+PN+FR ++LI +LL++ HWNGC +  +  + G GS  +VY    +++E+   V            Y+ S++W TL LTT+ ++P P    E++ + L+LL G+++FAT++G+V +++++++AA+ +FQ K+DGVK YM  R V   L+ ++I WFDYLW+ ++  DE+  +S LPDKLKAEIA+ VH +TLK V+IFQ+ E   L +L+L+LR  +FSPGDYICRKG++GKEMYIV RG+L VVAD+G  V  +LK GS FGE+SILN+    +GNRRTA+V+SVGYSDLF L+K D+WDVL EYP A+++L
Sbjct:  579 LCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFNSI----LRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVY----HDSESADVVK----------QYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRL 1004          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga1b (cyclic nucleotide gated channel subunit alpha 1b [Source:ZFIN;Acc:ZDB-GENE-110408-39])

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 260/515 (50.49%), Postives = 370/515 (71.84%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
            +W+ V+T  V++N + +  RA F   Q  Y  LW+  DY+ D+  ++D++  +R  +LEQGLLVK+  +LR  Y   ++F++DL +++P ++F L   +  ++Y   R N+L +I +LFEF  RT+TRTNFPN+FRIS+L+++++I+IHWN C ++  S +IG GSD FVYP  S+             + +    Y YS +WSTLTLTT+ E P PV NSE+  +  + L GVLIFATI+GNVGSMI+N NAA+ DFQ +ID +K+YM FR V K+LE+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GS++GNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNL+DLE ++    +   ME  + KI   ++   ++ ++L+ + E A   +K +++K+EK++
Sbjct:  123 NWLFVITCPVMYNWIFIIARACFEELQGDYLILWFFLDYLSDAVYLLDMVFRTRTGYLEQGLLVKDQKKLRDRYTDSLQFRLDLASMVPTDIFYL---YFGMNYPEIRMNKLLRINRLFEFFQRTETRTNFPNVFRISNLVMYIVIIIHWNACMYYSFSKAIGFGSDAFVYPDPSDPE-----------FGRLVRKYAYSMYWSTLTLTTIGETPPPVENSEYFFVVTDFLVGVLIFATIVGNVGSMITNANAARADFQARIDAIKQYMSFRKVTKDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSRAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGRQILMKDNLLDLELAKQG-PDPKDMEEKVQKIGGVLEDLQTRFARLLAEQEAAQGKLKKRVTKLEKKM 622          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga1b (cyclic nucleotide gated channel subunit alpha 1b [Source:ZFIN;Acc:ZDB-GENE-110408-39])

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 259/515 (50.29%), Postives = 370/515 (71.84%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
            +W+ V+T  V++N + +  R+ F   Q  Y  LW+  DY+ D+  ++D++  +R  +LEQGLLVK+  +LR  Y   ++F++DL +++P ++F L   +  ++Y   R N+L +I +LFEF  RT+TRTNFPN+FRIS+L+++++I+IHWN C ++  S +IG GSD FVYP  S+             + +    Y YS +WSTLTLTT+ E P PV NSE+  +  + L GVLIFATI+GNVGSMI+N NAA+ DFQ +ID +K+YM FR V K+LE+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GS++GNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNL+DLE ++    +   ME  + KI   ++   ++ ++L+ + E A   +K +++K+EK++
Sbjct:  129 NWLFVITCPVMYNWIFIIARSCFEELQGDYLILWFFLDYLSDAVYLLDMVFRTRTGYLEQGLLVKDQKKLRDRYTDSLQFRLDLASMVPTDIFYL---YFGMNYPEIRMNKLLRINRLFEFFQRTETRTNFPNVFRISNLVMYIVIIIHWNACMYYSFSKAIGFGSDAFVYPDPSDPE-----------FGRLVRKYAYSMYWSTLTLTTIGETPPPVENSEYFFVVTDFLVGVLIFATIVGNVGSMITNANAARADFQARIDAIKQYMSFRKVTKDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSRAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGRQILMKDNLLDLELAKQG-PDPKDMEEKVQKIGGVLEDLQTRFARLLAEQEAAQGKLKKRVTKLEKKM 628          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3a [Source:ZFIN;Acc:ZDB-GENE-090611-2])

HSP 1 Score: 531.561 bits (1368), Expect = 0.000e+0
Identity = 262/516 (50.78%), Postives = 364/516 (70.54%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
             W+ ++   V +N+++L  RA F   Q  Y  LW V DY  D    +D  + SR  FLEQGLLVK+  +L  NY +  +FK D+I+++P +LF L +   N +    RFNRL K+ +LFEF DRT+TRTN+PNIFRIS+L++++L++IHWN C FF +S +IG G+D +VYP            ++S P + + +  YIY  +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L EYPDAK  L ++GK IL KDNL+D EA      +   +E  I+++E ++     K ++L+ ++ +    +K +++ +E ++
Sbjct:  183 RWLSIIAAPVFYNLMMLVTRACFNELQNTYTILWIVLDYTSDVIYYMDTFVRSRTGFLEQGLLVKDSKKLINNYRTIPQFKYDMISMIPTDLFMLKVGFNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILVIIHWNACIFFAISKTIGFGTDTWVYP------------NISHPEYGRLARKYIYCLYWSTLTLTTIGETPPPVRDIEYLFVVMDFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLVEALTEYPDAKKALEEKGKAILRKDNLLD-EAVAAAGADPKDLEEKIHRLEGNLDIMTGKFAKLMAEYTSYQGKIKQRITNMENKV 682          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3a [Source:ZFIN;Acc:ZDB-GENE-090611-2])

HSP 1 Score: 531.561 bits (1368), Expect = 0.000e+0
Identity = 262/516 (50.78%), Postives = 364/516 (70.54%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
             W+ ++   V +N+++L  RA F   Q  Y  LW V DY  D    +D  + SR  FLEQGLLVK+  +L  NY +  +FK D+I+++P +LF L +   N +    RFNRL K+ +LFEF DRT+TRTN+PNIFRIS+L++++L++IHWN C FF +S +IG G+D +VYP            ++S P + + +  YIY  +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L EYPDAK  L ++GK IL KDNL+D EA      +   +E  I+++E ++     K ++L+ ++ +    +K +++ +E ++
Sbjct:  189 RWLSIIAAPVFYNLMMLVTRACFNELQNTYTILWIVLDYTSDVIYYMDTFVRSRTGFLEQGLLVKDSKKLINNYRTIPQFKYDMISMIPTDLFMLKVGFNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILVIIHWNACIFFAISKTIGFGTDTWVYP------------NISHPEYGRLARKYIYCLYWSTLTLTTIGETPPPVRDIEYLFVVMDFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLVEALTEYPDAKKALEEKGKAILRKDNLLD-EAVAAAGADPKDLEEKIHRLEGNLDIMTGKFAKLMAEYTSYQGKIKQRITNMENKV 688          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3a [Source:ZFIN;Acc:ZDB-GENE-090611-2])

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 262/516 (50.78%), Postives = 364/516 (70.54%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
             W+ ++   V +N+++L  RA F   Q  Y  LW V DY  D    +D  + SR  FLEQGLLVK+  +L  NY +  +FK D+I+++P +LF L +   N +    RFNRL K+ +LFEF DRT+TRTN+PNIFRIS+L++++L++IHWN C FF +S +IG G+D +VYP            ++S P + + +  YIY  +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L EYPDAK  L ++GK IL KDNL+D EA      +   +E  I+++E ++     K ++L+ ++ +    +K +++ +E ++
Sbjct:  184 RWLSIIAAPVFYNLMMLVTRACFNELQNTYTILWIVLDYTSDVIYYMDTFVRSRTGFLEQGLLVKDSKKLINNYRTIPQFKYDMISMIPTDLFMLKVGFNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILVIIHWNACIFFAISKTIGFGTDTWVYP------------NISHPEYGRLARKYIYCLYWSTLTLTTIGETPPPVRDIEYLFVVMDFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLVEALTEYPDAKKALEEKGKAILRKDNLLD-EAVAAAGADPKDLEEKIHRLEGNLDIMTGKFAKLMAEYTSYQGKIKQRITNMENKV 683          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 271/516 (52.52%), Postives = 374/516 (72.48%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
             W+ ++++ VL+N   L  RA F   QR    LW V DY  D   + D ++  R  FLEQGLLVK+  +L++NY    +FK+DL+++LP +L  L +    ++Y   RFNRL +  ++FEF DRT+TRTN+PNIFRI +L++++LI+IHWN C +F +S +IG G+D +VYP            ++S P + + +  YIYS +WSTLTLTT+ E P PV + EF+ +  + L GVLIFATI+GNVGSMISNMNA+K +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR QVFSPGDYICRKGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD LID EA++    +   +E  + K+E+++    ++ ++L+ D+ +    +K +++K+E Q+
Sbjct:  143 RWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYLKI---GLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP------------NISHPEYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAK-AGADPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLESQV 642          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 271/516 (52.52%), Postives = 374/516 (72.48%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
             W+ ++++ VL+N   L  RA F   QR    LW V DY  D   + D ++  R  FLEQGLLVK+  +L++NY    +FK+DL+++LP +L  L +    ++Y   RFNRL +  ++FEF DRT+TRTN+PNIFRI +L++++LI+IHWN C +F +S +IG G+D +VYP            ++S P + + +  YIYS +WSTLTLTT+ E P PV + EF+ +  + L GVLIFATI+GNVGSMISNMNA+K +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR QVFSPGDYICRKGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD LID EA++    +   +E  + K+E+++    ++ ++L+ D+ +    +K +++K+E Q+
Sbjct:  210 RWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYLKI---GLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP------------NISHPEYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAK-AGADPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLESQV 709          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 271/516 (52.52%), Postives = 374/516 (72.48%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
             W+ ++++ VL+N   L  RA F   QR    LW V DY  D   + D ++  R  FLEQGLLVK+  +L++NY    +FK+DL+++LP +L  L +    ++Y   RFNRL +  ++FEF DRT+TRTN+PNIFRI +L++++LI+IHWN C +F +S +IG G+D +VYP            ++S P + + +  YIYS +WSTLTLTT+ E P PV + EF+ +  + L GVLIFATI+GNVGSMISNMNA+K +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR QVFSPGDYICRKGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD LID EA++    +   +E  + K+E+++    ++ ++L+ D+ +    +K +++K+E Q+
Sbjct:   60 RWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYLKI---GLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP------------NISHPEYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAK-AGADPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLESQV 559          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 271/516 (52.52%), Postives = 374/516 (72.48%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
             W+ ++++ VL+N   L  RA F   QR    LW V DY  D   + D ++  R  FLEQGLLVK+  +L++NY    +FK+DL+++LP +L  L +    ++Y   RFNRL +  ++FEF DRT+TRTN+PNIFRI +L++++LI+IHWN C +F +S +IG G+D +VYP            ++S P + + +  YIYS +WSTLTLTT+ E P PV + EF+ +  + L GVLIFATI+GNVGSMISNMNA+K +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR QVFSPGDYICRKGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD LID EA++    +   +E  + K+E+++    ++ ++L+ D+ +    +K +++K+E Q+
Sbjct:   90 RWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYLKI---GLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP------------NISHPEYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAK-AGADPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLESQV 589          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: amacr (alpha-methylacyl-CoA racemase [Source:Xenbase;Acc:XB-GENE-1009589])

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 258/516 (50.00%), Postives = 374/516 (72.48%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
            +W+  +T+ V++N  ++  RA F   Q+ Y  LW+  DY+ D+  + D+ + +R  +LEQGLLV++  +LR  Y   ++FK+D+++I+P ++  L      ++Y   R N+L ++ ++FEF  RT+TRTN+PNIFRIS+LI++++I+IHWN C ++ +S +IG G D +VYP            + S P + + +  Y+YS +WSTLTLTT+ E P PV +SEF  +  + L GVLIFATI+GNVGSMISNMNAA+ +FQ +ID +K+YM FR V K+LE+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LL++L+LKL+ QV+SPGDYICRKGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GSK+GNRRTAN+KS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD L+DL+ + N   +   +E  + ++E  ++   +K ++L+ ++++A   +K +++KIEK I
Sbjct:   21 NWLFCITMPVMYNWTMIIARACFDELQQDYLELWFFLDYMSDAIYIADMFVRTRTGYLEQGLLVRDEVKLRDKYKMTMQFKLDVLSIIPTDILYL---QFGLNYPELRLNKLLRVARMFEFFQRTETRTNYPNIFRISNLIMYIVIIIHWNACVYYSISKAIGFGEDTWVYP------------NTSHPEYGRLARKYVYSLYWSTLTLTTIGETPPPVQDSEFWFVVADFLVGVLIFATIVGNVGSMISNMNAARAEFQGRIDAIKQYMHFRKVSKDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLIELVLKLQPQVYSPGDYICRKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGRQILMKDGLLDLDIA-NSGADPKDIEEKVIQMEGLVENLQTKFARLLAEYDSAQQKLKQRVTKIEKII 520          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga3 (cyclic nucleotide gated channel alpha 3 [Source:MGI Symbol;Acc:MGI:1341818])

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 267/519 (51.45%), Postives = 371/519 (71.48%), Query Frame = 3
Query:  306 ILLHWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
            I   W+  + L V +N  +L  RA F   Q ++ +LW V DY  D   V+D+++ +R  FLEQGL+V++  RL K+Y   + FK+D+++++P +L  L L    ++Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L+++ LI+IHWN C +F +S  IG G+D +VYP            + S+P + + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L G+LIFATI+GNVGSMISNMNA + +FQ KID VK+YM+FR V K+LE R+I WFDYLW N++++DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR  VFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNLID E      ++   +E  +  +ESS+    ++ ++L+ ++  +   +K +L+++E Q+
Sbjct:  146 IYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYLKL---GVNYPELRFNRLLKFSRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYP------------NTSKPEYARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLID-EDLVAARVDTRDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLKQRLTRLESQM 648          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga3 (cyclic nucleotide gated channel alpha 3 [Source:MGI Symbol;Acc:MGI:1341818])

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 267/519 (51.45%), Postives = 371/519 (71.48%), Query Frame = 3
Query:  306 ILLHWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
            I   W+  + L V +N  +L  RA F   Q ++ +LW V DY  D   V+D+++ +R  FLEQGL+V++  RL K+Y   + FK+D+++++P +L  L L    ++Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L+++ LI+IHWN C +F +S  IG G+D +VYP            + S+P + + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L G+LIFATI+GNVGSMISNMNA + +FQ KID VK+YM+FR V K+LE R+I WFDYLW N++++DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR  VFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNLID E      ++   +E  +  +ESS+    ++ ++L+ ++  +   +K +L+++E Q+
Sbjct:  108 IYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYLKL---GVNYPELRFNRLLKFSRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYP------------NTSKPEYARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLID-EDLVAARVDTRDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLKQRLTRLESQM 610          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga3 (cyclic nucleotide gated channel alpha 3 [Source:MGI Symbol;Acc:MGI:1341818])

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 267/519 (51.45%), Postives = 371/519 (71.48%), Query Frame = 3
Query:  306 ILLHWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
            I   W+  + L V +N  +L  RA F   Q ++ +LW V DY  D   V+D+++ +R  FLEQGL+V++  RL K+Y   + FK+D+++++P +L  L L    ++Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L+++ LI+IHWN C +F +S  IG G+D +VYP            + S+P + + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L G+LIFATI+GNVGSMISNMNA + +FQ KID VK+YM+FR V K+LE R+I WFDYLW N++++DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR  VFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNLID E      ++   +E  +  +ESS+    ++ ++L+ ++  +   +K +L+++E Q+
Sbjct:  108 IYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYLKL---GVNYPELRFNRLLKFSRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYP------------NTSKPEYARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLID-EDLVAARVDTRDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLKQRLTRLESQM 610          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga1 (cyclic nucleotide gated channel alpha 1 [Source:MGI Symbol;Acc:MGI:88436])

HSP 1 Score: 531.946 bits (1369), Expect = 0.000e+0
Identity = 253/514 (49.22%), Postives = 373/514 (72.57%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEK 1853
            +W+  +TL V++N  ++  RA F   Q  Y   W +FDY+ D   + D+ + +R  +LEQGLLVK+  +L + Y + ++FK+D+++++P +L  +       +Y   R NRL +I ++FEF  RT+TRTN+PNIFRIS+L+++++I+IHWN C ++ +S +IG G+D +VYP             V+ P + + +  Y+YS +WSTLTLTT+ E P PV +SE+I + ++ L GVLIFATI+GN+GSMISNMNAA+ +FQ ++D +K+YM FR V K++E+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GSK+GNRRTAN+KS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD L+D+  + N+  +   +E  + ++E S+    ++ ++++ ++E+    +K +L+K+EK
Sbjct:  159 NWLFCITLPVMYNWTMIIARACFDELQSDYLEYWLIFDYVSDVVYLADMFVRTRTGYLEQGLLVKDRMKLIEKYKANLQFKLDVLSVIPTDLLYIKF---GWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGNDTWVYP------------DVNDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVLDSEYIFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQSRVDAIKQYMNFRNVSKDMEKRVIKWFDYLWTNKKTVDEREVLRYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQILMKDGLLDINIA-NMGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK 656          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga1 (cyclic nucleotide gated channel alpha 1 [Source:MGI Symbol;Acc:MGI:88436])

HSP 1 Score: 531.946 bits (1369), Expect = 0.000e+0
Identity = 253/514 (49.22%), Postives = 373/514 (72.57%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEK 1853
            +W+  +TL V++N  ++  RA F   Q  Y   W +FDY+ D   + D+ + +R  +LEQGLLVK+  +L + Y + ++FK+D+++++P +L  +       +Y   R NRL +I ++FEF  RT+TRTN+PNIFRIS+L+++++I+IHWN C ++ +S +IG G+D +VYP             V+ P + + +  Y+YS +WSTLTLTT+ E P PV +SE+I + ++ L GVLIFATI+GN+GSMISNMNAA+ +FQ ++D +K+YM FR V K++E+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GSK+GNRRTAN+KS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD L+D+  + N+  +   +E  + ++E S+    ++ ++++ ++E+    +K +L+K+EK
Sbjct:  159 NWLFCITLPVMYNWTMIIARACFDELQSDYLEYWLIFDYVSDVVYLADMFVRTRTGYLEQGLLVKDRMKLIEKYKANLQFKLDVLSVIPTDLLYIKF---GWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGNDTWVYP------------DVNDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVLDSEYIFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQSRVDAIKQYMNFRNVSKDMEKRVIKWFDYLWTNKKTVDEREVLRYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQILMKDGLLDINIA-NMGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK 656          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q90980|CNG3_CHICK (Cyclic nucleotide-gated channel rod photoreceptor subunit alpha OS=Gallus gallus OX=9031 PE=2 SV=1)

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 265/527 (50.28%), Postives = 380/527 (72.11%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI*EKHFSQF 1895
            +W+  +T+ V++N  ++  RA F   Q  Y ++W++ DY+ D   + D+ + +R  +LEQGLLVKE  +L++ Y S ++FK+D ++I+P +L    L    ++Y   R NRL ++ ++FEF  RT+TRTN+PNIFRIS+L+++++I+IHWN C ++ +S +IG G+D +VYP  S+   A L+             Y+YS +WSTLTLTT+ E P PV +SE+  + ++ L GVLIFATI+GNVGSMISNMNAA+ +FQ KID +K+YM FR V K++E+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH ETLK V+IF DCE  LLV+L+LKL+ QV+SPGDYICRKGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++GK+ILMKD L+D+E + N+  +   +E  +  +E S+    +K ++L+ +++ A   +K +L++IEK I   + E+ F  F
Sbjct:  119 NWLFCITMPVMYNWTMIIARACFDELQNDYLAVWFIVDYVSDVIYIADMFVRTRTGYLEQGLLVKEEQKLKEKYKSSLQFKLDFLSIIPTDLLYFKL---GLNYPELRINRLLRVARMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGADTWVYPNTSHPEFARLT-----------RKYVYSLYWSTLTLTTIGETPPPVRDSEYFFVVVDFLVGVLIFATIVGNVGSMISNMNAARAEFQAKIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLETLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGKQILMKDGLLDIEVA-NLGSDPKDLEEKVAYMEGSMDRLQTKFARLLAEYDAAQQKLKKRLTQIEK-ILKPVMEQEFLDF 629          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q29441|CNGA3_BOVIN (Cyclic nucleotide-gated cation channel alpha-3 OS=Bos taurus OX=9913 GN=CNGA3 PE=2 SV=1)

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 265/516 (51.36%), Postives = 373/516 (72.29%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
            HW+ V+ + V +N  +L  RA F   Q ++  LW V DY  D    +D+++ +R  FLEQGL+V + +RL K+Y   + FK+D+++++P +L    L    ++Y   RFNRL K+ +LFEF DRT+TRTN+PN+FRI +L++++LI+IHWN C +F +S  IG G+D +VYP            +VS P + + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVGSMISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TL+ V+IFQDCE  LLV+L+LKLR  VFSPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNLID E ++    +   +E  +  +E+S+    ++ ++L+ ++      +K +LS++E Q+
Sbjct:  189 HWLTVIAVPVFYNWCLLVCRACFDELQSEHLMLWLVLDYSADILYGMDMLVRARTGFLEQGLMVMDASRLWKHYTQTLHFKLDVLSLVPTDLAYFKL---GMNYPELRFNRLLKLARLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYP------------NVSNPEYGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLRKVRIFQDCEAGLLVELVLKLRPAVFSPGDYICKKGDIGREMYIIKEGKLAVVAEDGITQFVVLGDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAK-AGADPKDIEEKVEHLETSLDSLQTRFARLLAEYNATQMKVKQRLSQLESQV 688          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q9JJZ8|CNGA3_MOUSE (Cyclic nucleotide-gated cation channel alpha-3 OS=Mus musculus OX=10090 GN=Cnga3 PE=1 SV=2)

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 267/519 (51.45%), Postives = 371/519 (71.48%), Query Frame = 3
Query:  306 ILLHWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
            I   W+  + L V +N  +L  RA F   Q ++ +LW V DY  D   V+D+++ +R  FLEQGL+V++  RL K+Y   + FK+D+++++P +L  L L    ++Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L+++ LI+IHWN C +F +S  IG G+D +VYP            + S+P + + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L G+LIFATI+GNVGSMISNMNA + +FQ KID VK+YM+FR V K+LE R+I WFDYLW N++++DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR  VFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNLID E      ++   +E  +  +ESS+    ++ ++L+ ++  +   +K +L+++E Q+
Sbjct:  108 IYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYLKL---GVNYPELRFNRLLKFSRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYP------------NTSKPEYARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLID-EDLVAARVDTRDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLKQRLTRLESQM 610          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q16281|CNGA3_HUMAN (Cyclic nucleotide-gated cation channel alpha-3 OS=Homo sapiens OX=9606 GN=CNGA3 PE=1 SV=2)

HSP 1 Score: 543.888 bits (1400), Expect = 0.000e+0
Identity = 266/515 (51.65%), Postives = 370/515 (71.84%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
             W+  + L V +N  +L  RA F   Q +Y  LW V DY  D   V+D+++ +R  FLEQGL+V + NRL ++Y +  +FK+D+++++P +L  L +     +Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L++++LI+IHWN C +F +S  IG G+D +VYP          ++S+ +   + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVGSMISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW NK+++DE  +L +LPDKLKAEIA+ VH +TLK V+IFQDCE  LLV+L+LKLR  VFSPGDYIC+KGDIGKEMYI+  GKL VVADDG+  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNLID E +     +   +E  + ++ SS+    ++ ++L+ ++      MK +LS++E Q+
Sbjct:  170 RWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYLKV---GTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYP----------NISIPEH-GRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAR-AGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQV 669          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q90805|CNG1_CHICK (Cyclic nucleotide-gated channel cone photoreceptor subunit alpha OS=Gallus gallus OX=9031 PE=2 SV=1)

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 263/515 (51.07%), Postives = 374/515 (72.62%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
            +W+ ++   V +N  +L  RA F   Q  +  LW   DY  D   V D+ +  R  FLEQGLLVK+  +LR +Y   ++FK+D++++LP +L  L L    ++Y   RFNRL +I +LFEF DRT+TRTN+PN+FRI +L++++LI+IHWN C +F +S  IG G+D +VYP          +VS+ + + + S  YIYS +WSTLTLTT+ E P PV + E++ + ++ L GVLIFATI+GNVGSMISNMNA++ +FQ K+D +K+YM FR V K+LE R+I WFDYLW NK+++DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+  VFSPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GSKSGNRRTAN++S+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNLID EA++    +   +E  I+++E+++    ++ ++L+ ++ ++   +K +L+++E ++
Sbjct:  212 NWLTIIAAPVFYNWCMLICRACFDELQIDHIKLWLFLDYCSDIIYVFDMFVRFRTGFLEQGLLVKDEKKLRDHYTQTVQFKLDVLSLLPTDLAYLKL---GLNYPELRFNRLLRIARLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKVIGFGTDSWVYP----------NVSIPE-YGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKVDSIKQYMHFRKVTKDLEARVIKWFDYLWTNKKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLKPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEEAAK-AGADPKDLEEKIDRLETALDTLQTRFARLLAEYSSSQQKVKQRLARVETRV 711          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A3P7XJ78 (Cyclic nucleotide-binding domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS4000 PE=4 SV=1)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 288/514 (56.03%), Postives = 393/514 (76.46%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQ 1856
            +WIG++T+TVL+N +VLP+R+AF         +W V DY ID    +DI +  R  +LE+GLLV++  +L++ YI + +F ID++AILP +LF  I P  N    W RFNRL KIY+ FEF+DRT+TRTN PN+FRIS L  ++L++IHWN C +F  S + GL SD FVYPPRS++  +    + ++ WD+  + Y+YSF+WSTL LTT+ E P PV N+E+I +T++ L GVLIFAT++GNVG+MI+NMNAA+T+FQ K+DGVKRYMEFR V KELE R+I WFDYLW NKQSL+ED+ L+ LPDKLKAEIA+ VH++TLK V IF+DC+  LLV+L+LKL++QVFSPGDYICRKGDIGKEMYIVKRGKL+VV++DG  VFVTL EGSVFGE+SILNI G+K+GNRR+ANV+SVGYSDLFCL+KDDLWD L EYP+ K  L+QRG++IL KDNL+D +           +E  + +I+ ++    +++++LI +F  + + +K +L+++E++
Sbjct:  111 YWIGIVTITVLYNAIVLPMRSAFTQFHELSPIIWMVLDYCIDCVYFMDIFVGLRTGYLEEGLLVRDKEKLKQAYIKRRQFIIDIMAILPTDLFYFI-PVLNHYASWLRFNRLMKIYRSFEFVDRTETRTNRPNLFRISMLTTYILVLIHWNACIYFGFSRATGLSSDSFVYPPRSSDDTSDEFKNYTEQWDRLFSQYVYSFYWSTLILTTIGETPKPVRNAEYIFITIDFLVGVLIFATVVGNVGAMITNMNAARTEFQNKMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSLEEDS-LNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILNIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPETKTILMQRGQDILRKDNLLDEDVLRKAQEQQESIEQCVQRIDGTVNQLTTRLARLIGEFGASQAKLKRRLARLEQE 622          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A183LJM5 (Cyclic nucleotide-binding domain-containing protein OS=Schistosoma margrebowiei OX=48269 PE=4 SV=1)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 288/514 (56.03%), Postives = 393/514 (76.46%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQ 1856
            +WIG++T+TVL+N +VLP+R+AF         +W V DY ID    +DI +  R  +LE+GLLV++  +L++ YI + +F ID++AILP +LF  I P  N    W RFNRL KIY+ FEF+DRT+TRTN PN+FRIS L  ++L++IHWN C +F  S + GL SD FVYPPRS++  +    + ++ WD+  + Y+YSF+WSTL LTT+ E P PV N+E+I +T++ L GVLIFAT++GNVG+MI+NMNAA+T+FQ K+DGVKRYMEFR V KELE R+I WFDYLW NKQSL+ED+ L+ LPDKLKAEIA+ VH++TLK V IF+DC+  LLV+L+LKL++QVFSPGDYICRKGDIGKEMYIVKRGKL+VV++DG  VFVTL EGSVFGE+SILNI G+K+GNRR+ANV+SVGYSDLFCL+KDDLWD L EYP+ K  L+QRG++IL KDNL+D +           +E  + +I+ ++    +++++LI +F  + + +K +L+++E++
Sbjct:  111 YWIGIVTITVLYNAIVLPMRSAFTQFHELSPIIWMVLDYCIDCVYFMDIFVGLRTGYLEEGLLVRDKEKLKQAYIKRRQFIIDIMAILPTDLFYFI-PVLNHYASWLRFNRLMKIYRSFEFVDRTETRTNRPNLFRISMLTTYILVLIHWNACIYFGFSRATGLSSDSFVYPPRSSDDTSDEFKNYTEQWDRLFSQYVYSFYWSTLILTTIGETPKPVRNAEYIFITIDFLVGVLIFATVVGNVGAMITNMNAARTEFQNKMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSLEEDS-LNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILNIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPETKTILMQRGQDILRKDNLLDEDVLRKAQEQQESIEQCVQRIDGTVNQLTTRLARLIGEFGASQAKLKRRLARLEQE 622          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A504Z0W2 (Cyclic nucleotide-gated channel cone photoreceptor subunit alpha OS=Fasciola gigantica OX=46835 GN=FGIG_00261 PE=4 SV=1)

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 291/517 (56.29%), Postives = 395/517 (76.40%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFF 1865
            +WIG+++ TVL+N +VLP+R+AF         +W  FDY+ID+   IDI +  R  FLEQGLLV++VN+LRK Y+ + E   D++A+ P +L  LI P       W RFNRL K+Y+LFEFIDRT+TRT  P +FRIS+L + +L++IH N C +F  S + GLGS+ FVYPPRSN+  + +  + S  W+   + Y+YSF+WSTL LTT+ E P PV+N+E+I +T++ L GVLIFAT++GNVG+MI+NMNAA+T+FQ ++DGVKRYMEFR V KELE R+I WFDYLW NKQSL+EDT L+ LPDKLKAEIA+ VH++TLK V IF+DC+  LLV+L+LKL++QVFSPGDYICRKGDIGKEMYIVKRGKL+VV++DG  VFVTL EGSVFGE+SIL+I G+K+GNRR+ANV+SVGYSDLFCL+KDDLWD L EYP+AK  L+QRG+EIL KDNLID E           +E  + ++++++    +++++LI +F  + + +K +L+++E+  +F
Sbjct:  100 YWIGIVSATVLYNSIVLPMRSAFTQFHELSAIMWMFFDYLIDAIYFIDIFVGCRTGFLEQGLLVRDVNQLRKAYLKRREIYADVLAVFPTDLLYLI-PSVGHYGAWLRFNRLLKVYRLFEFIDRTETRTTRPYLFRISTLTMNILVLIHLNACIYFGFSKATGLGSNSFVYPPRSNDEISEVQYNYSARWNHLFSQYVYSFYWSTLILTTIGETPKPVYNAEYIFITIDFLAGVLIFATVVGNVGAMITNMNAARTEFQSRMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSLEEDT-LNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILDIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPEAKEILMQRGEEILRKDNLIDEEVLRKAQEKKETIEQCVTRVDNTLNQISTRLARLIGEFGASQAKLKRRLTRLEEYQYF 614          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A4E0RSW7 (Cyclic nucleotide-gated channel cone photoreceptor subunit alpha OS=Fasciola hepatica OX=6192 GN=D915_005543 PE=4 SV=1)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 290/517 (56.09%), Postives = 394/517 (76.21%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFF 1865
            +WIG+++ TVL+N +VLP+R+AF         +W  FDY+ID+   IDI +  R  FLEQGLLV++VN+LRK Y+ + E   D++A+ P +L  LI P       W RFNRL K+Y+LFEFIDRT+TRT  P +FRIS+L + +L++IH N C +F  S + GLGS+ FVYPPRS +  + +  + S  W+   + Y+YSF+WSTL LTT+ E P PV+N+E+I +T++ L GVLIFAT++GNVG+MI+NMNAA+T+FQ ++DGVKRYMEFR V KELE R+I WFDYLW NKQSL+EDT L+ LPDKLKAEIA+ VH++TLK V IF+DC+  LLV+L+LKL++QVFSPGDYICRKGDIGKEMYIVKRGKL+VV++DG  VFVTL EGSVFGE+SIL+I G+K+GNRR+ANV+SVGYSDLFCL+KDDLWD L EYP+AK  L+QRG+EIL KDNLID E           +E  + ++++++    +++++LI +F  + + +K +L+++E+  +F
Sbjct:  100 YWIGIVSATVLYNSIVLPMRSAFTQFHELSAIMWMFFDYLIDAIYFIDIFVGCRTGFLEQGLLVRDVNQLRKAYLKRREIYADVLAVFPTDLLYLI-PSVGHYGAWLRFNRLLKVYRLFEFIDRTETRTTRPYLFRISTLTMNILVLIHLNACIYFGFSKATGLGSNSFVYPPRSTDEISEVQYNYSARWNHLFSQYVYSFYWSTLILTTIGETPKPVYNAEYIFITIDFLAGVLIFATVVGNVGAMITNMNAARTEFQSRMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSLEEDT-LNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILDIVGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPEAKEILMQRGEEILRKDNLIDEEVLRKAQEKKETIEQCVTRVDNTLNQISTRLARLIGEFGASQAKLKRRLTRLEEYQYF 614          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: G4VGD7 (Putative cyclic-nucleotide-gated cation channel OS=Schistosoma mansoni OX=6183 GN=Smp_194700 PE=4 SV=1)

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 286/514 (55.64%), Postives = 392/514 (76.26%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQ 1856
            +WIG++T+TVL+N +VLP+R+AF          W V DY ID    +DI +  R  +LE+GLLV++  +L++ Y+ + +F ID+I ILP +L  LI P  N    W RFNRL KIY+ FEF+DRT+TRTN PN+FRIS L  ++L++IHWN C +F  S + GL SD FVYPPRS++  +    + ++ WD+  + Y+YSF+WSTL LTT+ E P PV N+E+I +T++ L GVLIFAT++GNVG+MI+NMNAA+T+FQ K+DGVKRYMEFR V KELE R+I WFDYLW NKQSL+ED+ L+ LPDKLKAEIA+ VH++TL+ V IF+DC+  LLV+L+LKL++QVFSPGDYICRKGDIGKEMYIVKRGKL+VV++DG  VFVTL EGSVFGE+SILNI G+K+GNRR+ANV+SVGYSDLFCL+KDDLWD L EYP+ K  L+QRG++IL KDNL+D +           +E  + +I++++    +++++LI +F  + + +K +L+++E++
Sbjct:  103 YWIGIVTITVLYNAIVLPMRSAFTQFHELSPITWMVLDYCIDCVYFMDIFVGFRTGYLEEGLLVRDKEKLKQAYLKRRQFIIDIITILPTDLLYLI-PIFNHYASWLRFNRLMKIYRSFEFVDRTETRTNRPNLFRISMLTTYILVLIHWNACIYFGFSRASGLSSDSFVYPPRSSDDTSDEYKNYTEQWDRLFSQYVYSFYWSTLILTTIGETPKPVRNAEYIFITIDFLVGVLIFATVVGNVGAMITNMNAARTEFQNKMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSLEEDS-LNALPDKLKAEIAIHVHFDTLQRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILNIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPETKTILMQRGQDILRKDNLLDEDILRKAQEQQESIEQCVQRIDNTMNQLTTRLARLIGEFGASQAKLKRRLTRLEQE 614          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga3a (cyclic nucleotide-gated channel cone photoreceptor subunit alpha-like [Source:NCBI gene;Acc:103043103])

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 262/516 (50.78%), Postives = 364/516 (70.54%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
            HW+ ++   V +N++++  RA F   Q  Y  LW + DY  D     D  + SR  FLEQGLLVK+  +L  +Y    +FK D+++++P +   L + + N +    RFNRL K+ +LFEF DRT+TRTN+PNIFRIS+L++++LI+IHWN C FF +S +IG G+D +VYP            ++S P + + +  YIY  +WSTLTLTT+ E P PV + E++ +  + L GVLIFATI+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L EYP+AK  L ++GK ILMKDNLID EA  N   +   +E  I K+ES++    +K  +L+ ++ +  + +K +L+ +E ++
Sbjct:  148 HWLTIIAAPVFYNLMMIVTRACFNELQNTYTILWIILDYTSDVIYYTDTFVRSRTGFLEQGLLVKDGTKLMGHYRQTSQFKYDMLSMIPTDFLMLKVGYNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILIIIHWNACIFFAISKTIGFGTDTWVYP------------NISHPEYGRLARKYIYCLYWSTLTLTTIGETPPPVKDVEYLFVVADFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPEAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLESNLDVMTTKFGRLMAEYTSYQAKIKQRLTNMESKV 647          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga3a (cyclic nucleotide-gated channel cone photoreceptor subunit alpha-like [Source:NCBI gene;Acc:103043103])

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 262/516 (50.78%), Postives = 364/516 (70.54%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
            HW+ ++   V +N++++  RA F   Q  Y  LW + DY  D     D  + SR  FLEQGLLVK+  +L  +Y    +FK D+++++P +   L + + N +    RFNRL K+ +LFEF DRT+TRTN+PNIFRIS+L++++LI+IHWN C FF +S +IG G+D +VYP            ++S P + + +  YIY  +WSTLTLTT+ E P PV + E++ +  + L GVLIFATI+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L  LPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L EYP+AK  L ++GK ILMKDNLID EA  N   +   +E  I K+ES++    +K  +L+ ++ +  + +K +L+ +E ++
Sbjct:   74 HWLTIIAAPVFYNLMMIVTRACFNELQNTYTILWIILDYTSDVIYYTDTFVRSRTGFLEQGLLVKDGTKLMGHYRQTSQFKYDMLSMIPTDFLMLKVGYNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILIIIHWNACIFFAISKTIGFGTDTWVYP------------NISHPEYGRLARKYIYCLYWSTLTLTTIGETPPPVKDVEYLFVVADFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPEAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLESNLDVMTTKFGRLMAEYTSYQAKIKQRLTNMESKV 573          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga1b (cyclic nucleotide gated channel subunit alpha 1b [Source:ZFIN;Acc:ZDB-GENE-110408-39])

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 259/518 (50.00%), Postives = 372/518 (71.81%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFS 1868
            +W+ V+T  V++N +++  RA F   Q  Y   W++ D++ D   V D++  +R  +LEQGLLVK+  +LR+ Y+  ++FK+DLI+++P +L  +++    ++Y   R N+L ++ +LFEF  RT+TRTNFPN+FRIS+L+++++I+IHWN C ++ VS ++G GSD FVYP  SN             + +    Y YS +WSTLTLTT+ E P P  ++EF  +  + L GVLIFATI+GNVGSMI+NMNAA+ DFQ +ID +K+YM FR V  +LE+R+I WFDYLW NK+++DE  +L  LPDKL+AEIA+ VH +TLK V+IF DCE  LLV+L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVADDGI  FV L +GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNL+DLE ++    +   ME  + +I S ++   ++ ++L+   E   S +K +++K+E +I  S
Sbjct:   96 NWLFVITCPVMYNWVLIIARACFEELQHDYLIYWFILDFVSDLVYVADMVFRTRTGYLEQGLLVKDEKKLRERYMVSLQFKLDLISMIPTDLLYVLV---GLNYPEIRMNKLFRVNRLFEFFQRTETRTNFPNVFRISNLVMYIVIIIHWNACLYYSVSKAMGFGSDRFVYPDPSNPE-----------FGRLIRKYAYSMYWSTLTLTTIGETPPPEKDAEFFFVVTDFLVGVLIFATIVGNVGSMITNMNAARADFQARIDAIKQYMSFRKVTTDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKSMLEEKGRQILMKDNLLDLEVAKQG-PDPKDMEEKVVRIGSVLEDLQTRFARLLAQHEAVQSRLKRRVTKLETKITVS 598          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga2a (cyclic nucleotide gated channel subunit alpha 2 [Source:NCBI gene;Acc:103043109])

HSP 1 Score: 528.865 bits (1361), Expect = 1.108e-180
Identity = 259/519 (49.90%), Postives = 358/519 (68.98%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFS 1868
            HW+ ++   VL+N  +L  RA F   Q     +W V DY+ D   ++D  +  R  +LEQGLLVK++ +LR  YIS ++FK+DL++ILP +L  +      I     RFNRL +  +LFEF DRT+TRT++PN FRI +L++++L++IHWN C +F +S S+G GSD +VYP            ++S P +   S  YIY  +WSTLTLTT+ E+P PV + E++ +  + L GVLIFATI+GNVG+MISNMNA + +FQ +ID +K YM+FR V KELE R+I WFDYLW NK+++DE  +L  LP+KL+AEIA+ VH ETLK V+I QDCE  LLV+L+LKLR QVFSPGDY+CRKGDIGKEMYI+K G+L VVADDG+  F  L  GS FGE+SILNI GSK GNRRTAN++S+GYSDLFCL+KDDL + + EYPDAK  L +RG+EIL K+ L  LE      L    ME  + ++E+S+    ++ ++L+ ++      +K +++ +E ++  S
Sbjct:  149 HWLFIIATAVLYNWCLLVARACFDELQTNNYIVWLVLDYLSDLVYILDTCVRLRTGYLEQGLLVKDLKKLRDTYISNLQFKLDLLSILPTDLAYIAT---GIHVPELRFNRLMRFSRLFEFFDRTETRTSYPNTFRIGNLVLYILVIIHWNACIYFAISKSLGFGSDQWVYP------------NISDPEFGALSRGYIYCLYWSTLTLTTIGEMPAPVRDEEYLFVIFDFLVGVLIFATIVGNVGAMISNMNATRAEFQARIDSIKHYMQFRKVSKELEARVIKWFDYLWTNKKAIDEQEVLKNLPNKLRAEIAINVHLETLKKVRILQDCEAGLLVELVLKLRPQVFSPGDYVCRKGDIGKEMYIIKEGRLAVVADDGVTQFALLTSGSCFGEISILNIKGSKMGNRRTANIRSIGYSDLFCLSKDDLMEAVIEYPDAKKVLEERGREILRKEGL--LEELRAGGLTGEQMEEKVERLETSLDTLQTRFARLLGEYMATQQRLKQRVTTLESRMQLS 650          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga3b (cyclic nucleotide gated channel subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-090312-121])

HSP 1 Score: 526.554 bits (1355), Expect = 4.519e-180
Identity = 254/515 (49.32%), Postives = 365/515 (70.87%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
            HW+ ++++   +N+++L  RA F   Q  Y ++W   DY  D    ID  + SR  FLEQGLLVK+  +L +NY    +F+ DL++++P ++  L + + N +    RFNRL K+ +LFEF DRT+TRTNFPNIFRI +L++++LI+IHWN C FF +S ++G GSD +VYP  S+     L+             YIY  +WSTLTLTT+ E P PV + E++ +  + L GVLIFATI+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R++ WFDYLW  +++ DE  +L  LPDKLKAEIA+ VH ETL+ V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L EYP+AK  L ++G+ ILMKD LID  A++     D  +E+ ++ +E++++   +K++++  D+  +   +K +++ +E ++
Sbjct:  138 HWLTIISVPAFYNLMMLITRACFNELQDSYTTVWITLDYSSDVIYYIDTFVRSRTGFLEQGLLVKDRKKLWENYKKTPQFRYDLVSMIPTDIAMLYVGYNNPEL---RFNRLLKMARLFEFFDRTETRTNFPNIFRIGNLVLYILIIIHWNACIFFAISKTLGFGSDTWVYPDISDPEHGRLARK-----------YIYCLYWSTLTLTTIGETPPPVRDIEYLFVVADFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVVKWFDYLWTEEKTCDEKEVLKYLPDKLKAEIAINVHLETLRKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPEAKKALEEKGRAILMKDGLIDESAAKTADAKD--LEDKVSMLETNLEVMQAKMTRITADWAASQGRIKQRINNMEARV 636          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: cngb1a (cyclic nucleotide gated channel subunit beta 1a [Source:ZFIN;Acc:ZDB-GENE-050419-164])

HSP 1 Score: 238.424 bits (607), Expect = 9.991e-72
Identity = 144/453 (31.79%), Postives = 249/453 (54.97%), Query Frame = 3
Query:  306 ILLHWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXX-XXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVAD-DGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGK 1658
            I L W+ ++ L   ++   LP+R +F +      S WY+ DY  D+  ++  +++  R  F+ +G ++ +     K Y    +FK DL+++LP+++  L      +    +R  RL K Y  FEF DR +   +   I+R+     +LL  +H N CF++FVS+  GLGS  +VY  +                      YI  ++W+  TL T+  +P P    E +        GV + + +IG +G +I    A +  ++  +D    YM    + + ++ R+  W++Y W ++  LDE  +L  LP K++ EIA+ V+Y  +  V +F+ C+  ++  ++L+L+  V+ PGD++C+KG++G+EMYI+K G++ VV   D   VFVTL+ GSVFGE+S+L + G   GNRRTANV + G+++LF L+K DL ++L  YP+++  L ++ K
Sbjct:   53 IYLIWLTLVMLAFQWSCWFLPLRLSFPVHTPNTMSFWYIGDYTCDAIYLLDILVMQCRLQFVHRGDIITDQKETSKFYYHSEKFKSDLLSLLPLDILYLKFGPSAM----FRLPRLIKYYAFFEFNDRLEAIMSKAYIYRVIRTTGYLLFSLHLNACFYYFVSDMEGLGSTRWVYNGKGYR-------------------YIRCYYWAVKTLITIGGLPEPSNLIEIVFQLSNYFLGVFVVSIMIGQMGDVIGAATAGQNYYRTCMDNTLSYMNMYHISRAVQNRVRMWYEYTWASQGMLDESELLEKLPIKMRLEIAIDVNYTIVNKVALFKGCDRQMIYDMLLRLKSVVYLPGDFVCKKGELGREMYIIKAGEVQVVGGPDNKIVFVTLRTGSVFGEISLLAVGG---GNRRTANVMAHGFANLFILDKRDLNEILRIYPESEKLLRKKAK 479          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005922.1 (pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-1 gene:ENSPMAG00000005344.1 transcript:ENSPMAT00000005922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.464 bits (280), Expect = 4.422e-26
Identity = 81/318 (25.47%), Postives = 153/318 (48.11%), Query Frame = 3
Query:  729 SLIVFLL-IMIHWNGCFFFFVSNS-----------IG----LGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVA--EVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPD 1628
            +L++F+  ++ HW  C ++ +  +           IG    LG      P  +NNT    S           + YI S +++  +LT+V    V     ++E I     +L G L+ A + GNV ++I  M + ++ +  +   +K ++    + K+L++R++ +F   W     +D   +L   PD+L+A+IA+ ++ E L+ + IF+      L  L L ++    +PG+++ R+GD  +  Y V  G + V+ DD   V   L +G + G     ++       +  A+VK++ Y DL C++   L+DVL  YP+
Sbjct:  195 TLLMFMFGLLAHWMACIWYKIGRAEIEINDRHSWDIGWLHELGKK-LETPFHTNNTGGGPSTR---------SAYIASLYFALSSLTSVGFGNVSANT-DAEKIFSVCAMLIGALMHAVVFGNVTAIIQRMYSRRSQYHTRTKDLKDFIRVHRLPKQLKQRMLEYFQTTWSVNNGIDTHELLKDFPDELRADIAMHMNKEILQ-LAIFESASRGCLRSLSLSIKPSFCAPGEFLIRQGDALQAFYFVCSGSMEVLKDD--MVLAILGKGDLIGS----DLSSKDQVLKTNADVKALTYCDLQCIHLRGLYDVLDLYPE 494          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005594.1 (pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1 gene:ENSPMAG00000005049.1 transcript:ENSPMAT00000005594.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 9.538e-26
Identity = 80/316 (25.32%), Postives = 148/316 (46.84%), Query Frame = 3
Query:  732 LIVFLLIMIHWNGCFFFFVSN-----------SIGL-----GSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGE-LSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPD 1628
            L+    ++ HW  C ++ + N            IG      G  G  Y    N+T+ +   S+    D++ T   ++F  S+LT      V  P  N E I     +L G L++A+I GNV ++I  + +    +  ++  VK ++ F  +   L +R+  +F + W     +D + +L   P+ L+A+I + ++   L+  K F    +  L  L +K +     PGD +   GD+   MY + RG + ++ +D   V   L +  +FGE ++  + PG  S     A+V+++ Y DL  + ++D+ +VL  YP+
Sbjct:  249 LMCTFALIAHWLACIWYAIGNMERPVDSLAKDRIGWLDQLGGQIGKPY----NDTDTSSGPSIK---DKYVTALYFTF--SSLTSVGFGNV-SPNTNYEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNMVLKGFPECLQADICLHLNRTLLESCKAFNGASKGCLRALAMKFKTTHAPPGDTLVHSGDVITAMYFLSRGSIEILRED--IVVAILGKNDIFGEPVNQYSRPGKSS-----ADVRALTYCDLHKIVREDMLEVLDMYPE 547          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001558.1 (pep scaffold:Pmarinus_7.0:GL480650:659:21543:-1 gene:ENSPMAG00000001411.1 transcript:ENSPMAT00000001558.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 9.384e-20
Identity = 56/256 (21.88%), Postives = 121/256 (47.27%), Query Frame = 3
Query:  723 ISSLIVFLLIMIHWNGCFFFFVSNS---IGLGSDGFVYPP-------RSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVA--EVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGI 1454
            ++ L+    ++ HW  C +F +      + + SD  + P        +      + + SVS       + YI S +++  ++T+V    V     +SE I     +L G L+ A + GNV ++I  M + ++ +  +   +K ++    + + L++R++ +F   W     +D + +L   PD+L+A++ + ++ E L+ + +F+      L  L L ++    +PG+Y+ R+GD  +    V  G + V+ D  +
Sbjct:   32 LTMLMSMFALLAHWMACIWFVIGCQEIVVRVSSDTHISPHCWLHQLRKRLEASGSANSSVSHCGPPLRSAYITSLYFTLSSITSVGFGNVSANT-DSEKIFSICAMLIGALMHAVVFGNVTAIIQRMYSRRSLYLTRTKDLKEFIRIHRLPQPLKQRMLEYFQTTWSVNNGIDTNELLKDFPDELRADVTMHLNKEMLQ-LPLFEAASRGCLRSLSLNVKTTFCAPGEYLIRQGDALQAFCFVLSGSMEVLKDGTV 285          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: kcnh1b (potassium voltage-gated channel, subfamily H (eag-related), member 1b [Source:ZFIN;Acc:ZDB-GENE-121128-4])

HSP 1 Score: 90.8929 bits (224), Expect = 3.584e-19
Identity = 62/243 (25.51%), Postives = 116/243 (47.74%), Query Frame = 3
Query:  897 TMYIYSFFWSTLTLTTVA-EVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEY 1622
             +YI S +++  +LT++      P  + E I     ++ G L++ATI GNV ++   M A    +   ++ V+ +++   V K L  R++++    W   + +D + +L   P  ++A+I V ++ +       F+   +  L  L ++ +    +PGD I   G+    +  V  G L V+ DD  +V   L +G VFG++       + S     ANV+++ Y DL  + +D L  VL  Y
Sbjct:  427 AVYISSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLHICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRALAVEFQTHHCAPGDLIYHAGESVDTLCFVVSGSLEVIQDD--EVVAILGKGDVFGDVFWKERVIAPS----CANVRALTYCDLHVIRRDALVKVLDFY 663          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO35393 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM8])

HSP 1 Score: 445.662 bits (1145), Expect = 6.865e-152
Identity = 219/457 (47.92%), Postives = 319/457 (69.80%), Query Frame = 3
Query:  309 LLHWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRS----NNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEIL 1667
            L  W+ V++L VL+N   + +R AF     K   +W + DY  D   + DI+++ R  FLE+G+L     ++R++Y+   EF +D  A++P+++  + + H       +R NR+ K ++ + F+DRT++RT FPN+ R++SL+ F+L++IHWN C +F VS  IG GSD +VYP       N++E T+S            MYIYSF+WSTLTLTT+ EVP P    E+II+TL+ L GVL+FATI+GNVG++I+N+NA + DFQ K+DG+K YM F  + + L+RR+I WFDYLW  K+  DE+ IL +LPDKL+AEIA+ VH ++L+ V IFQDCE   L +L+L+LR Q+FSPGDY+CRKG++G+EMYIV RGKL VV++ G K++  L+ GS FGE+S+L++  S +GNRRTA+V+SVGY++LFCL K+DL +VL EYP+ K K+ +  KE L
Sbjct:    5 LYFWLLVVSLAVLYNCWAIILRTAFPQINDKITYIWLILDYSCDLIYIADILVSMRTGFLEEGILQTCSTKMRRHYLHTYEFYLDAGALIPLDIAYIFIEHEPA----FRINRILKFHRFWHFLDRTESRTTFPNVVRLASLVQFILLIIHWNACIYFIVSREIGFGSDVWVYPGVRQEILNSSENTIS-----------RMYIYSFYWSTLTLTTIGEVPPPYSEVEYIIVTLDYLIGVLLFATIVGNVGNIITNLNATRLDFQNKMDGIKAYMRFHKIPQHLQRRVIKWFDYLWTYKKHPDEEEILLSLPDKLRAEIAINVHLDSLRKVAIFQDCEAGFLCELVLRLRSQLFSPGDYVCRKGEVGREMYIVNRGKLEVVSEHGTKIYAVLEAGSYFGEISVLSM--SSAGNRRTASVRSVGYTELFCLAKNDLMEVLDEYPNIKEKIEKIAKEKL 444          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO34633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNW2])

HSP 1 Score: 377.096 bits (967), Expect = 3.328e-125
Identity = 188/457 (41.14%), Postives = 299/457 (65.43%), Query Frame = 3
Query:  309 LLHWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDN 1679
            +  W+ ++++ V++N + +  R  F   Q ++ +LW+V DYI D    +DI++  R  +L+QGLLV+++ +LR+NY++ ++FK+D+I+ILP +     L  R       R  R+ ++ KLF+   R +T++++PN+ +  ++++ +L++ HWN CF+F +S SIG GSD +VYP  S+N            +D+ S  Y+YSF+WST  + T      P  + E + +  +L  G L FA ++G  G+++ ++  A+ +F    + +K+YM    V  +L+ R+I+W DY+W  K+SLD + IL  LP+KL+ +IAV V+   L+ V +F DCE  LL ++++KLR QVFSPGDYICRKGD+G+EMYIV  G L VV DDG  V   L EGS FGE+SILN+ G   GNRRTA V+SVG+SDL CL+KDDL + +++YP+A+M+L +RG+E+L + +
Sbjct:    1 MFFWLYIVSVAVVYNWVFIIARQCFSQLQVRFMTLWFVMDYICDIIYGMDIMVEFRTAYLDQGLLVRDLKKLRQNYLATVKFKLDMISILPFDFLYFGLGTRFTLCRLLRLLRIHRVVKLFQ---RGETKSSYPNLLQTFAVVLVILLVFHWNACFYFAISESIGFGSDKWVYPNLSSNN-----------YDKLSRQYLYSFYWSTRMMITGESENPPETDMELLFVVADLTVGYLTFAALVGQFGAILGHIMRARVEFITHSNSIKQYMNNHKVNNDLQERVISWIDYMWHKKRSLDHERILKKLPEKLRGQIAVHVYLAVLRHVPVFADCEPGLLREIVVKLRSQVFSPGDYICRKGDVGREMYIVNSGCLQVVGDDGTTVLAILSEGSYFGEISILNLSG--IGNRRTAAVRSVGFSDLLCLSKDDLLEAMSDYPEARMRLEERGRELLNRTH 441          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO49540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK0])

HSP 1 Score: 306.22 bits (783), Expect = 8.166e-98
Identity = 179/438 (40.87%), Postives = 260/438 (59.36%), Query Frame = 3
Query:  318 WIGVLTLTVLFNILVLPVRAAF--VIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLE-QGLLVKEVNRLRKNYISKIEFKIDLIAILPIEL---FSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADD---GIKVFV-TLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDL 1601
            W  ++T  V +N  ++ +R AF  V  +  YR +++  D I D   ++DI++  R  + +  G+++     L  NY SKI F +D +++ P+E    F+L+ P      VW+R  RL K + +  F   +D RTN PN  R+  L ++L + +HW  C ++ +S   GLGS+ +VYP  S                     YI S +WS LTLTT+ E P P  N E +  +   L G+ +FA ++GNVG +ISNMNAA+TDFQ K+D +K YME   V ++L+ R   W  Y W    S   D  L  LP +L+AE+A+ VH  TLK VKIF+DC+E LL +L+LKLR Q+FSPGDYICR G+IG+EMYI+  GK+ VV  D   G K+ V +L EG+ FGE+S+L +   +  NRR+A+V+SVGYS+L  L++ DL
Sbjct:   14 WAALVTFAVFYNFCIVLLRIAFKEVRNELFYRMIYWPLDVISDIIYLVDILVQFRTAYRDDHGIMINTPKLLALNYCSKIPFFLDALSVFPLETTLPFTLVQPS-----VWFRCLRLLKWHCVLRFFVISDLRTNKPNRLRVVKLALYLGLALHWVACGYYMISEYEGLGSNSWVYPEASGED---------------GKKYIKSLYWSILTLTTIGETPEPSTNLEHVFTSAMFLFGIFVFAAVVGNVGDVISNMNAARTDFQTKMDYIKSYMEHHKVPEDLQNRAKRWAYYAW----SRHSDA-LGMLPLRLRAELAIHVHLATLKKVKIFKDCDEGLLCELVLKLRPQIFSPGDYICRCGEIGREMYIINHGKVEVVVPDSTTGEKIVVASLTEGNYFGEISLLRLDEGR--NRRSADVRSVGYSELLWLSQKDL 424          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO39918 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S2])

HSP 1 Score: 288.886 bits (738), Expect = 2.525e-91
Identity = 158/439 (35.99%), Postives = 254/439 (57.86%), Query Frame = 3
Query:  318 WIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAK 1634
            W   +   + +N+ V+ +R AF   Q ++   W VFDY  D   V+DIIIN R  FLE+G+LV +  R+ ++Y     F  DL+++ P ++  ++ P R       R NRL K YK F      ++ T +P   R+  L+  + ++I+WN  F+  +S + G G++ +VYP   +                    Y+ S +WSTLTLT + ++P P  N E++      L GV +FATI+GN GS+I N NA + DF+ + +G   YM    V K+L+RR++ W+DY W +     +   L+ LPDKLK EIA+ V+ ETL+ V   Q C+   L  L+L +++++F+PGD+ICRKG++ +EMY++  GK+ VV + G +V   L  G  FGE+ IL++  S+  NRRTA+++++GY + F L+K+D+     +YP+A+
Sbjct:   12 WFYFVVFAIRYNLWVVILRIAFPAAQDEFTVAWLVFDYFCDFLYVLDIIINFRTGFLEEGILVVDAKRVARHYAVSKNFIADLLSVFPTDILCVLYPER---LPMLRINRLIKAYKSFRIKSLMESHTTYPTFLRVFFLLHLMFLLINWNAGFYIMISRTEGFGTNAWVYPGNGS----------------LYQQYLKSLYWSTLTLTAIGDLPSPATNFEYLYTIACYLCGVFMFATIVGNAGSIIVNRNANRLDFERQREGTNNYMRKNRVPKDLQRRVLMWYDYSWASGGG--DLNSLTLLPDKLKTEIALHVNLETLRKVTFLQKCQPEFLHDLVLMMKLRIFTPGDFICRKGEVAREMYVIIDGKIEVVGEVG-QVLKVLSGGDFFGEIGILSL--SEGQNRRTADIRTIGYVECFVLSKEDVLKATRDYPEAQ 426          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO35376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM9])

HSP 1 Score: 289.271 bits (739), Expect = 2.860e-91
Identity = 176/449 (39.20%), Postives = 262/449 (58.35%), Query Frame = 3
Query:  318 WIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTV-AEVPGPVFNSE------FIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKL 1643
            W+  ++L V++N   L V  AF              DY  DS   +D ++  R  FLE G++V    +L K Y     F +DLI+ILP ++  L L    I     RFNRL K ++   F DR +  +  P +F ++ LI +L ++IHW  C +F +S   G G+D +++P      +  LS        + S  Y+YS + S++++TTV A V G +          F+I+T   L GVLIFATI+GN G MI  M  ++  +  K++G+K Y+E   +   L++R+I+WFDYLW +K+ ++E  +   L D  KAEIA+ V+ +TL  V++F DC+   L +L+LKLR  + SPGD+ICR+G+ G+EMYIV +G L V+ D+   V  TL  GS FGE+S+LN+ G   GN RTA+V+SVG+SDLF L+K DL +VL  YP AK ++
Sbjct:   13 WLLTVSLGVIYNYWALIVYVAFPSVHEANLKTCIAVDYTFDSIFFLDTLVQFRVGFLEHGVMVVGCWKLTKKYGCSFGFMLDLISILPFDVLYLYLGVLPI----LRFNRLFKAHRFLLFCDRGEIYSGRPKLFNLAKLIHYLFLIIHWVACVYFILSRYEGFGTDEWLHP----RLDGQLS--------KLSMQYLYSLYRSSVSMTTVGAGVIGTIATPRTELTLCFVIVTY--LTGVLIFATIVGNAGDMIVEMRRSRERYLRKLNGMKEYIEAYQLPAHLKKRVIHWFDYLWRHKRDMNEQELFHKLNDNFKAEIAIHVNLDTLIRVEMFHDCDPGFLHELVLKLRPVICSPGDFICRQGEKGREMYIVNKGSLEVL-DEKETVLATLSAGSHFGEISLLNMKG--IGNLRTASVRSVGFSDLFQLSKTDLEEVLEFYPQAKEQM 440          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3 [Source:NCBI gene;Acc:101163892])

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 265/516 (51.36%), Postives = 367/516 (71.12%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
             W+ V+   V +N++++  RA+F   Q+ Y  LW V DY  D   + D  + SR  +LEQGLLVK+  +LR  Y +  +FK D+IA++P +L  L       D   +RFNRL KI +LFEF +RT+TRT+FPN+FRIS+L++++L++IHWN C FF +S +IG GSD +VYP            ++S P   + +  YIYS +WSTLTLTT+ E P PV + E++ +  + L GVLIFA+I+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L TLPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L EYPDAK  L ++GK ILMKDNLID EA  N   +   +E  I K++ ++    +  +QL+ ++ +    +K +++K+E+++
Sbjct:  187 RWLTVIAGPVFYNLMMIVTRASFNDLQKSYTKLWIVLDYTSDIIYLADTFVRSRTGYLEQGLLVKDSKKLRDKYRTTSQFKYDMIAMIPTDLLFL---QYGFDNPEFRFNRLCKIQRLFEFFERTETRTSFPNMFRISNLVLYILVIIHWNACAFFSISKTIGFGSDTWVYP------------NISHPEHGRLARKYIYSLYWSTLTLTTIGETPAPVRDVEYLFVIADFLTGVLIFASIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTEKKTCDEKEVLKTLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLQGNLDMMQTNFAQLMAEYTSGQMRIKQRVTKMEEKV 686          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: ENSORLT00000025598.2 (cyclic nucleotide-gated channel cone photoreceptor subunit alpha [Source:NCBI gene;Acc:101170498])

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 261/515 (50.68%), Postives = 362/515 (70.29%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
            HW+  L + V +N+++L  RA F   Q  Y ++W V DY  D    ID  + +R  FLEQGLLVK+   L++ Y++ ++FK D+I++LP ++   ++   N ++   RFNRL ++ +LFEF DRT+TRTNFPNIFRI++L+++++I+IHWN C +F VS  +G GSD +VYP  +    + L++            YIY F+WSTLTLTT+ E P PV + E+  +  + L GVLIFATI+GNVG+MISNM AA+ +FQ KID +K+YM FR V K+LE R++ WFDYLW  +++ DE  +L +LPDKLKAEIA+ VH ETL  V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L EYPDAK  L  +G+ ILMKDNLID   S     +   +EN +N+IE+S++   +K  +L    +++   +K +LS +  Q+
Sbjct:  119 HWLSALAVPVFYNLMLLVARACFNELQYNYTTMWIVLDYGSDVFYYIDTFVRARTGFLEQGLLVKDPKVLKEKYMTTLQFKFDVISLLPTDIVFFVIGINNPEW---RFNRLFRLPRLFEFFDRTETRTNFPNIFRIANLVLYIIIIIHWNACLYFAVSKVLGFGSDTWVYPALTGPKFSRLAIQ-----------YIYCFYWSTLTLTTIGETPPPVRDIEYFFVVADFLTGVLIFATIVGNVGAMISNMGAARVEFQAKIDSIKQYMHFRKVTKDLEARVVKWFDYLWTEEKTCDEKQVLKSLPDKLKAEIAINVHLETLSKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKYALEDKGRAILMKDNLID--ESLVAACDAKDLENKVNQIEASVEVMTNKFKKLTAQHQSSQRKLKQRLSNLSNQV 617          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3 [Source:NCBI gene;Acc:101163892])

HSP 1 Score: 528.094 bits (1359), Expect = 0.000e+0
Identity = 266/542 (49.08%), Postives = 368/542 (67.90%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRK-----------------------C---FLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
             W+ V+   V +N++++  RA+F   Q+ Y  LW V DY  D   + D  + SR                        C   +LEQGLLVK+  +LR  Y +  +FK D+IA++P +L  L       D   +RFNRL KI +LFEF +RT+TRT+FPN+FRIS+L++++L++IHWN C FF +S +IG GSD +VYP            ++S P   + +  YIYS +WSTLTLTT+ E P PV + E++ +  + L GVLIFA+I+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L TLPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L EYPDAK  L ++GK ILMKDNLID EA  N   +   +E  I K++ ++    +  +QL+ ++ +    +K +++K+E+++
Sbjct:  101 RWLTVIAGPVFYNLMMIVTRASFNDLQKSYTKLWIVLDYTSDIIYLADTFVRSRTGIVAVWFGAPLLVGFCSSSPVLFCPSGYLEQGLLVKDSKKLRDKYRTTSQFKYDMIAMIPTDLLFL---QYGFDNPEFRFNRLCKIQRLFEFFERTETRTSFPNMFRISNLVLYILVIIHWNACAFFSISKTIGFGSDTWVYP------------NISHPEHGRLARKYIYSLYWSTLTLTTIGETPAPVRDVEYLFVIADFLTGVLIFASIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTEKKTCDEKEVLKTLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLQGNLDMMQTNFAQLMAEYTSGQMRIKQRVTKMEEKV 626          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga2b (cyclic nucleotide gated channel subunit alpha 2 [Source:NCBI gene;Acc:101171687])

HSP 1 Score: 527.324 bits (1357), Expect = 1.622e-180
Identity = 263/518 (50.77%), Postives = 362/518 (69.88%), Query Frame = 3
Query:  306 ILLHWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
            I   W+ V+++TVL+N  V+  RA F   Q  +   W V DYI D+  ++D I+  R  FLEQGLLVK+  +LR +Y+  ++FK+D+ +ILP +L  +      I     RFNRL    ++FEF DRT+TRTN+PNIFRI +L++++L++IHWN C ++ +S S+G GSD +V+P  S     TLS S           Y+Y  +WSTLTLTT+ E+P PV + E++ +  + L GVLIFATI+GNVGSMISNMNA + +FQ +ID +K YM FR V +ELE R+I WFDYLW NK+++DE  +L  LP+KL+AEIA+ VH ETLK V+IF+DCE  LLV+L+LKLR QVFSPGDYICRKGDIGKEMYI+K GKL VVADDG+  +  L  GS FGE+SILNI GSK GNRRTAN++S+GYSDLFCL+KDDL + + EYPDAK  L +RG+EIL K+ L+D E +++  L     E  + ++E S+    ++ ++L+ D+      +K +++ +E+QI
Sbjct:  129 IYYRWLLVISITVLYNWFVVVARACFDELQVTFFIWWLVLDYISDTVYILDTIVRLRTGFLEQGLLVKDHIKLRDSYVRTLQFKLDVASILPTDLGYIAT---GIHTPQLRFNRLLHFPRMFEFFDRTETRTNYPNIFRICNLVLYILVIIHWNACIYYAISKSLGFGSDTWVFPNASRTGFTTLSES-----------YVYCLYWSTLTLTTIGEMPPPVRDEEYLFVVFDFLVGVLIFATIVGNVGSMISNMNATRAEFQARIDAIKHYMHFRKVSRELETRVIKWFDYLWTNKKAVDEQEVLKNLPNKLRAEIAINVHLETLKKVRIFKDCEAGLLVELVLKLRQQVFSPGDYICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLTSGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLMEAVIEYPDAKTVLEERGREILKKEGLLD-ENADSGGLQKEDTEEKVERLEMSLDTLQTRFARLLNDYTHTQQRLKQRVTLLEQQI 631          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3 [Source:NCBI gene;Acc:101163892])

HSP 1 Score: 528.094 bits (1359), Expect = 5.579e-180
Identity = 266/542 (49.08%), Postives = 368/542 (67.90%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRK-----------------------C---FLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQP-WDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 1859
             W+ V+   V +N++++  RA+F   Q+ Y  LW V DY  D   + D  + SR                        C   +LEQGLLVK+  +LR  Y +  +FK D+IA++P +L  L       D   +RFNRL KI +LFEF +RT+TRT+FPN+FRIS+L++++L++IHWN C FF +S +IG GSD +VYP            ++S P   + +  YIYS +WSTLTLTT+ E P PV + E++ +  + L GVLIFA+I+GNVG+MISNMNA++ +FQ KID +K+YM+FR V K+LE R+I WFDYLW  K++ DE  +L TLPDKLKAEIA+ VH +TLK V+IFQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVADDG+  FV L +G+ FGE+SIL I GSK+GNRRTAN++SVGYSDLF L+KDDL + L EYPDAK  L ++GK ILMKDNLID EA  N   +   +E  I K++ ++    +  +QL+ ++ +    +K +++K+E+++
Sbjct:  164 RWLTVIAGPVFYNLMMIVTRASFNDLQKSYTKLWIVLDYTSDIIYLADTFVRSRTGIVAVWFGAPLLVGFCSSSPVLFCPSGYLEQGLLVKDSKKLRDKYRTTSQFKYDMIAMIPTDLLFL---QYGFDNPEFRFNRLCKIQRLFEFFERTETRTSFPNMFRISNLVLYILVIIHWNACAFFSISKTIGFGSDTWVYP------------NISHPEHGRLARKYIYSLYWSTLTLTTIGETPAPVRDVEYLFVIADFLTGVLIFASIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTEKKTCDEKEVLKTLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLQGNLDMMQTNFAQLMAEYTSGQMRIKQRVTKMEEKV 689          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000035733.1 (SMESG000035733.1)

HSP 1 Score: 904.434 bits (2336), Expect = 0.000e+0
Identity = 469/519 (90.37%), Postives = 506/519 (97.50%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI 1871
            +WIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYIIDSGNVIDIIINSRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFI+RTDTRTNFPNIFRISSLI+FLLI+IHWNGCFFFF+SNSIGLGSDGFVYPPRSN+T+ T+++ V++PWDQF +MY+Y+FFWSTLTLTT+AEVP PV N EFIIMT+ELLGGVLIFA+I+GNVGSMISN+NA KTDFQMK+DGVKRYMEFRGV KELE+RIINWFDYLW+NKQSLDE+ +LSTLPDKL+AEIA+ VHYET++ V +FQDCE++LL+QLILKL++QVFSPGDYICRKGDIGKEMYIVKRGKLNVVA+DGIKVFVTL EGSVFGELSILNIPGSKSGNRRTANV+SVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI
Sbjct:   56 NWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYIIDSGNVIDIIINSRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNIFRISSLIIFLLIIIHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSLLIQLILKLKLQVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI 574          

HSP 2 Score: 118.242 bits (295), Expect = 1.091e-27
Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 1
Query:  151 MTLWKRIKKCFVRNNERFPVLGNIENIPPLKGDLFTRIGSWNQKFVVDSSSVFYY 315
            MTLWKRIKKCFVRNNERFPVLGNIENIPPLKGDLFTRIGSWNQKFVVDSSSVFYY
Sbjct:    1 MTLWKRIKKCFVRNNERFPVLGNIENIPPLKGDLFTRIGSWNQKFVVDSSSVFYY 55          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000013398.1 (SMESG000013398.1)

HSP 1 Score: 867.84 bits (2241), Expect = 0.000e+0
Identity = 430/519 (82.85%), Postives = 472/519 (90.94%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI 1871
            +WIG LT+T+LFN+++LPVRAAF IPQ+ YR +W++FDY+ID  N+ID+ I SR  FLE GL+V +  ++ KNYISK+ FK+D   ILP+ELFSLI P +NIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVL E P+AK +LI+RGKEILMKDNL+DLEA++N L N + ++ I+ +I  ++  F++K S+L++DFE     MK KL  ++  +  SI
Sbjct:   53 NWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSLNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGSI 571          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000013398.1 (SMESG000013398.1)

HSP 1 Score: 865.914 bits (2236), Expect = 0.000e+0
Identity = 430/519 (82.85%), Postives = 472/519 (90.94%), Query Frame = 3
Query:  315 HWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYXXXXXXXXXXXXXXRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI 1871
            +WIG LT+T+LFN+++LPVRAAF IPQ+ YR +W++FDY+ID  N+ID+ I SR  FLE GL+V +  ++ KNYISK+ FK+D   ILP+ELFSLI P +NIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVL E P+AK +LI+RGKEILMKDNL+DLEA++N L N + ++ I+ +I  ++  F++K S+L++DFE     MK KL  ++  +  SI
Sbjct:   60 NWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSLNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGSI 578          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000071536.1 (SMESG000071536.1)

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 278/446 (62.33%), Postives = 355/446 (79.60%), Query Frame = 3
Query:  543 KIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLS-VSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI*E 1877
            K EFK+DL++I+P E+FS I       + + RFNRL K YKLF F DRT+TR NFPN+FRI  LI ++LI+IH N C +FF+S  +GLG+D +VYPPR ++++A ++ +S+   W+ F   YIYSF+WSTL LTT+AE P PV N +F+ +T++LL GVLIFATI+GNVGSMI+NMNAA+++FQMK+DGVKRYMEFR V KELE R+I WFDY+W NKQSLDE TIL+TLPDKLKAEIA+ VHY+TLK V IFQDCE  LLV+L+LKL +QVFSPGDYICRKGDIGKEMYIVK+GKL VV+DDG  VFVTL  GSVFGE+SILNI GSK+GNRRTANVKS+GYSDLFCLNK+DLWDVL EYP+A+ KLI+RGKE+L KDNL+DL+A   V  +   ME  + K++++++   +++S+L  ++ T     K +++K E +I FSI E
Sbjct:    3 KWEFKLDLLSIVPFEIFSAIPQIGFRQFAFLRFNRLIKCYKLFTFADRTETRINFPNMFRILMLIFYILILIHLNACIYFFISTVVGLGADSWVYPPRGSDSKAPMAQISIQDSWNSFLVKYIYSFYWSTLILTTIAETPPPVKNYQFVFITIDLLAGVLIFATIVGNVGSMITNMNAARSEFQMKMDGVKRYMEFRKVNKELEERVIKWFDYIWSNKQSLDEKTILATLPDKLKAEIAIHVHYDTLKRVNIFQDCEPGLLVELVLKLNLQVFSPGDYICRKGDIGKEMYIVKQGKLGVVSDDGNTVFVTLNAGSVFGEISILNIAGSKTGNRRTANVKSIGYSDLFCLNKNDLWDVLDEYPEARNKLIERGKEVLQKDNLLDLDALAEVEKSQQTMEMKLKKLDATLEILLARLSRLQTEYVTNSQKFKQRINKWEMRIQFSIDE 448          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000044898.1 (SMESG000044898.1)

HSP 1 Score: 528.865 bits (1361), Expect = 0.000e+0
Identity = 257/325 (79.08%), Postives = 283/325 (87.08%), Query Frame = 3
Query:  855 TLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMK 1829
            T+++ V++PWDQF +MY+Y+FFWSTLTLTT+AEVP P              GGVLIFA+I+GNVGSMISN+NA KTDFQMK+DGVKRYMEFRGV KELE+RIINWFDYLW+NKQSLDE+ +LSTLPDKL+AEIA+ VHYET++ V +FQDCE+                 GDYICRKGDIGKEMYIVKRGKLNVVA+DGIKVFVTL EGSVFGELSILNIPGSKSGNRRTANV+SVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHS +K
Sbjct:    2 TIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRP--------------GGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQIR---------------GDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSIVK 297          
The following BLAST results are available for this feature:
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNGA30.000e+051.65cyclic nucleotide gated channel subunit alpha 3 [S... [more]
CNGA30.000e+051.65cyclic nucleotide gated channel subunit alpha 3 [S... [more]
CNGA10.000e+049.81cyclic nucleotide gated channel subunit alpha 1 [S... [more]
CNGA10.000e+049.81cyclic nucleotide gated channel subunit alpha 1 [S... [more]
CNGA10.000e+049.81cyclic nucleotide gated channel subunit alpha 1 [S... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tax-41.284e-16350.10Cyclic nucleotide-gated cation channel [Source:Un... [more]
cng-14.828e-10737.45Cyclic Nucleotide Gated channel [Source:UniProtKB... [more]
cng-25.788e-8731.44Cyclic Nucleotide Gated channel [Source:UniProtKB... [more]
che-63.838e-7931.58pep chromosome:WBcel235:IV:2104056:2111408:-1 gene... [more]
tax-23.034e-7633.76TAX2 [Source:UniProtKB/TrEMBL;Acc:G5EEE2][more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CngA1.063e-16846.72gene:FBgn0261612 transcript:FBtr0302924[more]
CngA1.656e-16646.81gene:FBgn0261612 transcript:FBtr0302925[more]
CG422602.686e-12544.17gene:FBgn0259145 transcript:FBtr0299573[more]
CG422602.597e-12344.20gene:FBgn0259145 transcript:FBtr0330241[more]
CG422605.705e-12344.17gene:FBgn0259145 transcript:FBtr0299572[more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnga1b0.000e+050.49cyclic nucleotide gated channel subunit alpha 1b [... [more]
cnga1b0.000e+050.29cyclic nucleotide gated channel subunit alpha 1b [... [more]
cnga3a0.000e+050.78cyclic nucleotide gated channel subunit alpha 3a [... [more]
cnga3a0.000e+050.78cyclic nucleotide gated channel subunit alpha 3a [... [more]
cnga3a0.000e+050.78cyclic nucleotide gated channel subunit alpha 3a [... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfyb0.000e+052.52nuclear transcription factor Y subunit beta [Sourc... [more]
nfyb0.000e+052.52nuclear transcription factor Y subunit beta [Sourc... [more]
nfyb0.000e+052.52nuclear transcription factor Y subunit beta [Sourc... [more]
nfyb0.000e+052.52nuclear transcription factor Y subunit beta [Sourc... [more]
amacr0.000e+050.00alpha-methylacyl-CoA racemase [Source:Xenbase;Acc:... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnga30.000e+051.45cyclic nucleotide gated channel alpha 3 [Source:MG... [more]
Cnga30.000e+051.45cyclic nucleotide gated channel alpha 3 [Source:MG... [more]
Cnga30.000e+051.45cyclic nucleotide gated channel alpha 3 [Source:MG... [more]
Cnga10.000e+049.22cyclic nucleotide gated channel alpha 1 [Source:MG... [more]
Cnga10.000e+049.22cyclic nucleotide gated channel alpha 1 [Source:MG... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90980|CNG3_CHICK0.000e+050.28Cyclic nucleotide-gated channel rod photoreceptor ... [more]
sp|Q29441|CNGA3_BOVIN0.000e+051.36Cyclic nucleotide-gated cation channel alpha-3 OS=... [more]
sp|Q9JJZ8|CNGA3_MOUSE0.000e+051.45Cyclic nucleotide-gated cation channel alpha-3 OS=... [more]
sp|Q16281|CNGA3_HUMAN0.000e+051.65Cyclic nucleotide-gated cation channel alpha-3 OS=... [more]
sp|Q90805|CNG1_CHICK0.000e+051.07Cyclic nucleotide-gated channel cone photoreceptor... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7XJ780.000e+056.03Cyclic nucleotide-binding domain-containing protei... [more]
A0A183LJM50.000e+056.03Cyclic nucleotide-binding domain-containing protei... [more]
A0A504Z0W20.000e+056.29Cyclic nucleotide-gated channel cone photoreceptor... [more]
A0A4E0RSW70.000e+056.09Cyclic nucleotide-gated channel cone photoreceptor... [more]
G4VGD70.000e+055.64Putative cyclic-nucleotide-gated cation channel OS... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnga3a0.000e+050.78cyclic nucleotide-gated channel cone photoreceptor... [more]
cnga3a0.000e+050.78cyclic nucleotide-gated channel cone photoreceptor... [more]
cnga1b0.000e+050.00cyclic nucleotide gated channel subunit alpha 1b [... [more]
cnga2a1.108e-18049.90cyclic nucleotide gated channel subunit alpha 2 [S... [more]
cnga3b4.519e-18049.32cyclic nucleotide gated channel subunit alpha 3b [... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cngb1a9.991e-7231.79cyclic nucleotide gated channel subunit beta 1a [S... [more]
ENSPMAT00000005922.14.422e-2625.47pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-... [more]
ENSPMAT00000005594.19.538e-2625.32pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1... [more]
ENSPMAT00000001558.19.384e-2021.88pep scaffold:Pmarinus_7.0:GL480650:659:21543:-1 ge... [more]
kcnh1b3.584e-1925.51potassium voltage-gated channel, subfamily H (eag-... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO353936.865e-15247.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346333.328e-12541.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495408.166e-9840.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399182.525e-9135.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353762.860e-9139.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnga3a0.000e+051.36cyclic nucleotide gated channel subunit alpha 3 [S... [more]
ENSORLT00000025598.20.000e+050.68cyclic nucleotide-gated channel cone photoreceptor... [more]
cnga3a0.000e+049.08cyclic nucleotide gated channel subunit alpha 3 [S... [more]
cnga2b1.622e-18050.77cyclic nucleotide gated channel subunit alpha 2 [S... [more]
cnga3a5.579e-18049.08cyclic nucleotide gated channel subunit alpha 3 [S... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035733.11.091e-2790.37SMESG000035733.1[more]
SMESG000013398.10.000e+082.85SMESG000013398.1[more]
SMESG000013398.10.000e+082.85SMESG000013398.1[more]
SMESG000071536.10.000e+062.33SMESG000071536.1[more]
SMESG000044898.10.000e+079.08SMESG000044898.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007138 ID=SMED30007138|Name=Cyclic nucleotide gated channel alpha 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1923bp
GAAAATTTTTTAAATTAATTATCCAATGAAATGAAAGTCAAATCTAAAAA
TACAATTCATTCGTTACGTATTTCAATCCTTATTTGTTCTCATCCAAAGA
GCAAGGCAGCCATTTTTATGATCAATTGTAAAAAAAATCTACGATAGAAA
ATGACTTTATGGAAACGAATTAAAAAATGCTTTGTCAGAAACAATGAAAG
ATTTCCAGTGTTAGGAAATATAGAAAATATCCCTCCACTTAAAGGAGATT
TATTTACAAGGATTGGCTCATGGAATCAAAAGTTTGTTGTGGACTCCTCT
TCTGTATTTTATTACATTGGATCGGGGTATTGACTTTAACTGTCCTTTTC
AATATCCTCGTGCTTCCTGTCAGAGCAGCTTTTGTGATTCCTCAAAGAAA
ATATCGATCTTTATGGTACGTTTTCGATTATATCATTGACAGTGGAAATG
TCATTGACATAATTATTAACTCAAGAAAATGTTTCCTTGAACAGGGCTTA
CTTGTGAAAGAGGTGAATAGGCTGAGGAAGAATTACATATCAAAAATTGA
GTTTAAAATTGATTTAATAGCAATTTTGCCTATCGAGTTATTCAGCCTGA
TTCTCCCGCACCGAAATATTGATTATGTTTGGTATCGATTTAATCGGCTC
ACAAAAATCTATAAATTGTTTGAATTCATCGACCGCACGGATACTAGAAC
CAACTTCCCAAATATTTTCAGAATTTCTTCACTAATAGTTTTTCTACTGA
TCATGATTCATTGGAATGGATGCTTTTTCTTTTTTGTTAGTAACTCCATT
GGACTGGGGTCCGATGGGTTTGTGTATCCCCCAAGGAGTAACAACACTGA
GGCGACACTGTCGGTGTCAGTTAGTCAACCCTGGGACCAATTTTCCACAA
TGTACATCTATTCATTTTTCTGGTCAACTTTGACCCTTACAACAGTCGCA
GAAGTACCAGGTCCAGTTTTCAATTCTGAATTCATAATAATGACTCTCGA
ACTTCTTGGGGGAGTTTTGATTTTCGCCACAATCATTGGAAATGTTGGCT
CAATGATATCTAACATGAACGCGGCAAAAACGGATTTTCAAATGAAAATT
GACGGAGTAAAAAGATATATGGAATTTCGTGGTGTTGGAAAGGAGTTAGA
AAGACGAATCATAAATTGGTTTGATTATTTGTGGATAAATAAGCAATCCT
TGGATGAAGACACTATTCTGTCAACACTTCCTGACAAATTAAAAGCAGAA
ATAGCTGTCCAGGTTCATTATGAAACTCTGAAAGGGGTAAAAATATTTCA
GGACTGCGAAGAAACTCTTTTAGTCCAGTTAATTCTCAAATTGCGAATGC
AAGTCTTCAGTCCAGGAGATTATATTTGTAGGAAAGGGGATATTGGCAAG
GAAATGTATATTGTCAAACGAGGAAAGCTAAATGTTGTTGCTGACGATGG
AATTAAGGTTTTTGTTACTCTAAAGGAAGGAAGCGTTTTTGGAGAGTTAT
CAATTCTGAATATTCCTGGCAGTAAAAGTGGAAATCGTAGAACTGCGAAT
GTAAAATCAGTTGGATATTCAGATTTGTTTTGTTTAAACAAAGATGATCT
TTGGGATGTCTTGGCTGAATATCCCGATGCAAAAATGAAATTGATTCAAC
GTGGTAAAGAAATTCTGATGAAAGATAACCTTATTGATTTAGAGGCAAGT
GAAAACGTATTATTAAACGATAACGGCATGGAAAATATCATAAATAAAAT
TGAATCTTCAATAAAAGGATTTGATTCAAAGATTTCACAACTTATAGAAG
ATTTCGAAACAGCCCATTCAAGTATGAAATGTAAACTTTCAAAAATTGAA
AAGCAGATTTTCTTTTCTATTTGAGAAAAACATTTTTCCCAATTTACTGT
GATTTTTTAATTGTTTAAATGAG
back to top

protein sequence of SMED30007138-orf-1

>SMED30007138-orf-1 ID=SMED30007138-orf-1|Name=SMED30007138-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=535bp
MESKVCCGLLFCILLHWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWY
VFDYIIDSGNVIDIIINSRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLI
AILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIF
RISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVS
VSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVL
IFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINW
FDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETL
LVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVT
LKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLAE
YPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKG
FDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0071805potassium ion transmembrane transport
GO:0006813potassium ion transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0034220ion transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003938K_chnl_volt-dep_EAG/ELK/ERG
IPR000595cNMP-bd_dom
IPR005821Ion_trans_dom
IPR014710RmlC-like_jellyroll
IPR032406CLZ_dom
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005216ion channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane