Mitogen-activated protein kinase-binding protein 1

Overview
NameMitogen-activated protein kinase-binding protein 1
Smed IDSMED30007126
Length (bp)5132
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitogen-activated protein kinase-binding protein 1 (SMED30007126) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitogen-activated protein kinase-binding protein 1 (SMED30007126) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitogen-activated protein kinase-binding protein 1 (SMED30007126) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitogen-activated protein kinase-binding protein 1 (SMED30007126) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007126

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30007126h1SMcG0003450 dd_Smed_v4_7818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007126h1SMcG0003450 dd_Smed_v4_7818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007126h1SMcG0003450 dd_Smed_v4_7818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007126h1SMcG0003450 dd_Smed_v4_7818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007126h1SMcG0003450 Contig40762newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007126h1SMcG0003450 Contig40762uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Human
Match: MAPKBP1 (mitogen-activated protein kinase binding protein 1 [Source:HGNC Symbol;Acc:HGNC:29536])

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 328/743 (44.15%), Postives = 468/743 (62.99%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSR-SKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPV-SILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPD--LVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELR 2649
            ++LEKV G T+     ++ DP SG+VA+PAGCVVV ++ ++ KQ  I N+ +  ITA+AF+ +GK L TGESG  P VR+W V  HSQ+ E   H Y V  +AFS +++++VSVG Q D  +NVW    N  +AS+KV+S+V A++FSE   +FVT G RH++FWYLD+S+ SK  AT PLLGRS +LG+  NN FTDV C                            T+ I+ +G L +F+++R LDKWVELRT  A C++V +  I  GC+ G + +F+ S+L+ ++TLP PH LG ++ + ++ +   +     RYPD +A  +D  +  ++C YNDHSIYVWDVRD +K  KV S LYHS  VWSVE    +    ++ L  +SFITCS D T+R W+   S +   H  T +      N  S DLIKIIY D   ++L++ +        +++ + +  + GIRS+ +SP+ QHLA+ DR G L+ + L +  E   + AH+ EIL ++Y    S PD  L L  SASRDR+IHV+D  + Y   QT+D+HS +I A K   +  D ++R+ISCG DKS+ FR  Q  +SG   QF    H+V K + YDM + P+ +Y A+ CQDR +RI+N+ SGKQ+K ++GS G+DG L+K   DPSG YIATS SDK +SI +F++GE +A++ GHSE+  G+ F  D KHL+SVS D CIFVW+L  EMT++M +R+ ELR
Sbjct:   39 VTLEKVLGITVSGGRGLACDPRSGLVAYPAGCVVVLFNPRKHKQHHILNSSRKTITALAFSPDGKYLVTGESGHMPAVRVWDVAEHSQVAELQEHKYGVACVAFSPSAKYIVSVGYQHDMIVNVWAWKKNIVVASNKVSSRVTAVSFSEDCSYFVTAGNRHIKFWYLDDSKTSKVNATVPLLGRSGLLGELRNNLFTDVAC--------------------GRGKKADSTFCITSSGLLCEFSDRRLLDKWVELRTTVAHCISVSQDYIFCGCADGTVRLFNPSNLHFLSTLPRPHALGTDIASVTEASRLFSGVANARYPDTIALTFDPTNQWLSCVYNDHSIYVWDVRDPKKVGKVYSALYHSSCVWSVEVYPEVKDSNQACLPPSSFITCSSDNTIRLWNTESSGV---HGSTLH-----RNILSSDLIKIIYVDGNTQALLDTELPGG---DKADASLLDPRVGIRSVCVSPNGQHLASGDRMGTLRVHELQSLSEMLKVEAHDSEILCLEY----SKPDTGLKLLASASRDRLIHVLDAGREYSLQQTLDEHSSSITAVKFAAS--DGQVRMISCGADKSIYFRTAQ--KSGDGVQFTRTHHVVRKTTLYDMDVEPSWKYTAIGCQDRNIRIFNISSGKQKKLFKGSQGEDGTLIKVQTDPSGIYIATSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLISVSGDSCIFVWRLSSEMTISMRQRLAELR 742          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Human
Match: MAPKBP1 (mitogen-activated protein kinase binding protein 1 [Source:HGNC Symbol;Acc:HGNC:29536])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 328/743 (44.15%), Postives = 468/743 (62.99%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSR-SKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPV-SILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPD--LVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELR 2649
            ++LEKV G T+     ++ DP SG+VA+PAGCVVV ++ ++ KQ  I N+ +  ITA+AF+ +GK L TGESG  P VR+W V  HSQ+ E   H Y V  +AFS +++++VSVG Q D  +NVW    N  +AS+KV+S+V A++FSE   +FVT G RH++FWYLD+S+ SK  AT PLLGRS +LG+  NN FTDV C                            T+ I+ +G L +F+++R LDKWVELRT  A C++V +  I  GC+ G + +F+ S+L+ ++TLP PH LG ++ + ++ +   +     RYPD +A  +D  +  ++C YNDHSIYVWDVRD +K  KV S LYHS  VWSVE    +    ++ L  +SFITCS D T+R W+   S +   H  T +      N  S DLIKIIY D   ++L++ +        +++ + +  + GIRS+ +SP+ QHLA+ DR G L+ + L +  E   + AH+ EIL ++Y    S PD  L L  SASRDR+IHV+D  + Y   QT+D+HS +I A K   +  D ++R+ISCG DKS+ FR  Q  +SG   QF    H+V K + YDM + P+ +Y A+ CQDR +RI+N+ SGKQ+K ++GS G+DG L+K   DPSG YIATS SDK +SI +F++GE +A++ GHSE+  G+ F  D KHL+SVS D CIFVW+L  EMT++M +R+ ELR
Sbjct:   39 VTLEKVLGITVSGGRGLACDPRSGLVAYPAGCVVVLFNPRKHKQHHILNSSRKTITALAFSPDGKYLVTGESGHMPAVRVWDVAEHSQVAELQEHKYGVACVAFSPSAKYIVSVGYQHDMIVNVWAWKKNIVVASNKVSSRVTAVSFSEDCSYFVTAGNRHIKFWYLDDSKTSKVNATVPLLGRSGLLGELRNNLFTDVAC--------------------GRGKKADSTFCITSSGLLCEFSDRRLLDKWVELRTTVAHCISVSQDYIFCGCADGTVRLFNPSNLHFLSTLPRPHALGTDIASVTEASRLFSGVANARYPDTIALTFDPTNQWLSCVYNDHSIYVWDVRDPKKVGKVYSALYHSSCVWSVEVYPEVKDSNQACLPPSSFITCSSDNTIRLWNTESSGV---HGSTLH-----RNILSSDLIKIIYVDGNTQALLDTELPGG---DKADASLLDPRVGIRSVCVSPNGQHLASGDRMGTLRVHELQSLSEMLKVEAHDSEILCLEY----SKPDTGLKLLASASRDRLIHVLDAGREYSLQQTLDEHSSSITAVKFAAS--DGQVRMISCGADKSIYFRTAQ--KSGDGVQFTRTHHVVRKTTLYDMDVEPSWKYTAIGCQDRNIRIFNISSGKQKKLFKGSQGEDGTLIKVQTDPSGIYIATSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLISVSGDSCIFVWRLSSEMTISMRQRLAELR 742          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Human
Match: MAPKBP1 (mitogen-activated protein kinase binding protein 1 [Source:HGNC Symbol;Acc:HGNC:29536])

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 328/749 (43.79%), Postives = 468/749 (62.48%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSR-SKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELR------TPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPV-SILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPD--LVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELR 2649
            ++LEKV G T+     ++ DP SG+VA+PAGCVVV ++ ++ KQ  I N+ +  ITA+AF+ +GK L TGESG  P VR+W V  HSQ+ E   H Y V  +AFS +++++VSVG Q D  +NVW    N  +AS+KV+S+V A++FSE   +FVT G RH++FWYLD+S+ SK  AT PLLGRS +LG+  NN FTDV C                            T+ I+ +G L +F+++R LDKWVELR      T  A C++V +  I  GC+ G + +F+ S+L+ ++TLP PH LG ++ + ++ +   +     RYPD +A  +D  +  ++C YNDHSIYVWDVRD +K  KV S LYHS  VWSVE    +    ++ L  +SFITCS D T+R W+   S +   H  T +      N  S DLIKIIY D   ++L++ +        +++ + +  + GIRS+ +SP+ QHLA+ DR G L+ + L +  E   + AH+ EIL ++Y    S PD  L L  SASRDR+IHV+D  + Y   QT+D+HS +I A K   +  D ++R+ISCG DKS+ FR  Q  +SG   QF    H+V K + YDM + P+ +Y A+ CQDR +RI+N+ SGKQ+K ++GS G+DG L+K   DPSG YIATS SDK +SI +F++GE +A++ GHSE+  G+ F  D KHL+SVS D CIFVW+L  EMT++M +R+ ELR
Sbjct:   39 VTLEKVLGITVSGGRGLACDPRSGLVAYPAGCVVVLFNPRKHKQHHILNSSRKTITALAFSPDGKYLVTGESGHMPAVRVWDVAEHSQVAELQEHKYGVACVAFSPSAKYIVSVGYQHDMIVNVWAWKKNIVVASNKVSSRVTAVSFSEDCSYFVTAGNRHIKFWYLDDSKTSKVNATVPLLGRSGLLGELRNNLFTDVAC--------------------GRGKKADSTFCITSSGLLCEFSDRRLLDKWVELRNIDSFTTTVAHCISVSQDYIFCGCADGTVRLFNPSNLHFLSTLPRPHALGTDIASVTEASRLFSGVANARYPDTIALTFDPTNQWLSCVYNDHSIYVWDVRDPKKVGKVYSALYHSSCVWSVEVYPEVKDSNQACLPPSSFITCSSDNTIRLWNTESSGV---HGSTLH-----RNILSSDLIKIIYVDGNTQALLDTELPGG---DKADASLLDPRVGIRSVCVSPNGQHLASGDRMGTLRVHELQSLSEMLKVEAHDSEILCLEY----SKPDTGLKLLASASRDRLIHVLDAGREYSLQQTLDEHSSSITAVKFAAS--DGQVRMISCGADKSIYFRTAQ--KSGDGVQFTRTHHVVRKTTLYDMDVEPSWKYTAIGCQDRNIRIFNISSGKQKKLFKGSQGEDGTLIKVQTDPSGIYIATSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLISVSGDSCIFVWRLSSEMTISMRQRLAELR 748          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Human
Match: WDR62 (WD repeat domain 62 [Source:HGNC Symbol;Acc:HGNC:24502])

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 313/772 (40.54%), Postives = 458/772 (59.33%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLD-NSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDF--NANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWE-NDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRI 2739
            +SLEKV G T QN++ ++ DP +G VA+ AGCVVV    K +KQ  I N  +  ++A+AF+ +GK + TGE+G  P VRIW VE  +Q+ E  GH Y V  +AFS N + +VS+G Q D  +NVW+   +  +AS+KV+ +VIA++FSE   +FVTVG RHVRFW+L+ ++ +K  +T PL+GRS ILG+  NN F  V C                            T+ +S +G L QF E+R L+KW+ L+   ++CL V +  I  GC+ GI+ IF   SL+++A LP PHYLG+++    +  F  +   E V YPD VA  +D +H  ++C Y DHSIY+WDV+D  +  KV S L+HS  VW+VE       +++ L   SF+TCS D T+RFW+L  S             + W+ N +S  L+K++Y +  ++ L   D +   ++   N   + +K G+R +++SPD QHLA+ DR GNL+ + L    E   + AH+ E+L ++Y +  +   L L  SASRDR+IHV++  +NY   QT+DDHS +I A K      +++I++ISCG DKS+ FR  Q    G    F+   H+  K + YDM I    +Y AV CQDR VR+YN V+GKQ+K Y+GS GD+G LLK  +DPSGT++ATS SDK IS+++F +GE +A + GHSE+   + F  D  HL++VS D C+F+W L  E+T  M + + E+        T ND ++   P   T   TP  I
Sbjct:   60 VSLEKVLGITAQNSSGLTCDPGTGHVAYLAGCVVVILDPKENKQQHIFNTARKSLSALAFSPDGKYIVTGENGHRPAVRIWDVEEKNQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMVLNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEVSTETKVTSTVPLVGRSGILGELHNNIFCGVAC--------------------GRGRMAGSTFCVSYSGLLCQFNEKRVLEKWINLKVSLSSCLCVSQELIFCGCTDGIVRIFQAHSLHYLANLPKPHYLGVDVAQGLEPSFLFHRKAEAV-YPDTVALTFDPIHQWLSCVYKDHSIYIWDVKDINRVGKVWSELFHSSYVWNVEVYPEFEDQRACLPSGSFLTCSSDNTIRFWNLDSSP-----------DSHWQKNIFSNTLLKVVYVENDIQHL--QDMSHFPDRGSENGTPMDVKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELVKVEAHDAEVLCLEYSKPETG--LTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFA---GNRDIQMISCGADKSIYFRSAQQGSDG--LHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVNGKQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECIAKMFGHSEIITSMKFTYDCHHLITVSGDSCVFIWHLGPEITNCMKQHLLEIDHRQQQQHT-NDKKRSGHPRQDTYVSTPSEI 789          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Human
Match: WDR62 (WD repeat domain 62 [Source:HGNC Symbol;Acc:HGNC:24502])

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 313/772 (40.54%), Postives = 458/772 (59.33%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLD-NSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDF--NANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWE-NDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRI 2739
            +SLEKV G T QN++ ++ DP +G VA+ AGCVVV    K +KQ  I N  +  ++A+AF+ +GK + TGE+G  P VRIW VE  +Q+ E  GH Y V  +AFS N + +VS+G Q D  +NVW+   +  +AS+KV+ +VIA++FSE   +FVTVG RHVRFW+L+ ++ +K  +T PL+GRS ILG+  NN F  V C                            T+ +S +G L QF E+R L+KW+ L+   ++CL V +  I  GC+ GI+ IF   SL+++A LP PHYLG+++    +  F  +   E V YPD VA  +D +H  ++C Y DHSIY+WDV+D  +  KV S L+HS  VW+VE       +++ L   SF+TCS D T+RFW+L  S             + W+ N +S  L+K++Y +  ++ L   D +   ++   N   + +K G+R +++SPD QHLA+ DR GNL+ + L    E   + AH+ E+L ++Y +  +   L L  SASRDR+IHV++  +NY   QT+DDHS +I A K      +++I++ISCG DKS+ FR  Q    G    F+   H+  K + YDM I    +Y AV CQDR VR+YN V+GKQ+K Y+GS GD+G LLK  +DPSGT++ATS SDK IS+++F +GE +A + GHSE+   + F  D  HL++VS D C+F+W L  E+T  M + + E+        T ND ++   P   T   TP  I
Sbjct:   60 VSLEKVLGITAQNSSGLTCDPGTGHVAYLAGCVVVILDPKENKQQHIFNTARKSLSALAFSPDGKYIVTGENGHRPAVRIWDVEEKNQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMVLNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEVSTETKVTSTVPLVGRSGILGELHNNIFCGVAC--------------------GRGRMAGSTFCVSYSGLLCQFNEKRVLEKWINLKVSLSSCLCVSQELIFCGCTDGIVRIFQAHSLHYLANLPKPHYLGVDVAQGLEPSFLFHRKAEAV-YPDTVALTFDPIHQWLSCVYKDHSIYIWDVKDINRVGKVWSELFHSSYVWNVEVYPEFEDQRACLPSGSFLTCSSDNTIRFWNLDSSP-----------DSHWQKNIFSNTLLKVVYVENDIQHL--QDMSHFPDRGSENGTPMDVKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELVKVEAHDAEVLCLEYSKPETG--LTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFA---GNRDIQMISCGADKSIYFRSAQQGSDG--LHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVNGKQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECIAKMFGHSEIITSMKFTYDCHHLITVSGDSCVFIWHLGPEITNCMKQHLLEIDHRQQQQHT-NDKKRSGHPRQDTYVSTPSEI 789          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Celegans
Match: H24G06.1 (pep chromosome:WBcel235:V:9444050:9460639:1 gene:WBGene00019237.1 transcript:H24G06.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H24G06.1)

HSP 1 Score: 195.282 bits (495), Expect = 9.178e-50
Identity = 191/756 (25.26%), Postives = 315/756 (41.67%), Query Frame = 1
Query:  442 LEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIH--NAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLF------EFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDK---WVELRTPKATCLTVCESCIMVGCSRGIILIF--DTSSLNHIATLPMPHYLGINLQNPSD----NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKE--FHSIMAHNGEILSIDY--FQSPSAPDLVLF-CSASRDRVIHV---MDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGD---DGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTM 2625
            L+ V G +      ++L   S  +   AG  ++  S     +F  H  +  K   T +A    GK  ATGE+G  P VR+W +      F          H   +  + F+ +   ++S+G Q D  I  W+  T   +   K+ S V A+  S      VTVG + V++W+L  +       T L  RSAIL D  N  F D   C                       + +    ++ +G++++F   +   K   W E    KA C+      ++VGCS G++ +F      L+ +A L  P +L    Q+PS+         + E   +P+                Y D S+  +  R+ +  +   + L H+G V  +EP          L + + IT   D T+RFW+ +      S  K E       N     L+K+I+ D     L++  RN       ++E   +   G+   ++S D + L A    G L    LS S       I AH+ ++ SID+    S S+ D  +F  S  RDR +HV   +  +  +     +D H  AI + K     N+ ++ L +   D+SL+   L    S Q  +F   Q +    S  DM    +     V   DR +R ++ ++GK  +  +G+  D    G +LK  ID SG+Y  +  SDK++ + +  +G  LA + G    A    F  D K+++  +S+G IF+W+L   +T  M
Sbjct:   11 LKNVVGRSGVTVNGIALHHASDTLLQVAGSSIIVSSTASHDRFEGHLISQTKQQFTCVAVTSCGKYAATGETGHQPAVRLWQLRDAQGNFVGRLVRSMQSHTVSITIVRFTPDDSTLISIGCQHDAQIFTWDWRTGHDLGVGKLMSPVNALTISFDSSMCVTVGSKSVKYWFLPLASDGMNKRTGLTSRSAILADKRNVNFVDAAFC----------------------DSTNRMVTVTSSGEILEFNGNKKYVKCYTWKESGDFKAICIARVPEGLLVGCSDGLVRLFCLIGDDLDFLADLAPPTHL---FQDPSNVYDPQQLQNHPEDAIFPEPRCLVASSSSPTFVVGYADRSLIEF-ARENKSWSFRRASLGHTGSVNCIEP---FPSSSPCLPIGTLITGGSDGTIRFWNFNGD----SEDKKE-----IANILCPSLLKVIFLDENPDLLVDK-RNLESVGPSNDENQSASSSGVLCTRVSHDGRMLIAGTATGMLYIVDLSFSDTPIIDVINAHDHDVTSIDFSDHASTSSHDHPIFLASGGRDRFVHVFRRIPYSSQFVHCAVLDGHQSAIKSIKFAS--NNGQLHLYTAASDRSLIIWKLS-SFSDQHCEFTRVQMISVASSIGDMNFIKHVDLFVVAGHDRMLRQFD-INGKTVREVKGTDDDVAHSGKILKVAIDHSGSYAISVCSDKFVYVTDLRSGVCLAVLCGFGAPATDATFSDDFKNVIVTTSNGSIFIWQLAKNLTERM 723          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Celegans
Match: H24G06.1 (pep chromosome:WBcel235:V:9444234:9460635:1 gene:WBGene00019237.1 transcript:H24G06.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H24G06.1)

HSP 1 Score: 195.282 bits (495), Expect = 1.225e-49
Identity = 191/756 (25.26%), Postives = 314/756 (41.53%), Query Frame = 1
Query:  442 LEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIH--NAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLF------EFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDK---WVELRTPKATCLTVCESCIMVGCSRGIILIF--DTSSLNHIATLPMPHYLGINLQNPSD----NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKE--FHSIMAHNGEILSIDY--FQSPSAPDLVLF-CSASRDRVIHVMDP---TQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGD---DGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTM 2625
            L+ V G +      ++L   S  +   AG  ++  S     +F  H  +  K   T +A    GK  ATGE+G  P VR+W +      F          H   +  + F+ +   ++S+G Q D  I  W+  T   +   K+ S V A+  S      VTVG + V++W+L  +       T L  RSAIL D  N  F D   C                       + +    ++ +G++++F   +   K   W E    KA C+      ++VGCS G++ +F      L+ +A L  P +L    Q+PS+         + E   +P+                Y D S+  +  R+ +  +   + L H+G V  +EP          L + + IT   D T+RFW+ +      S  K E       N     L+K+I+ D     L++  RN       ++E   +   G+   ++S D + L A    G L    LS S       I AH+ ++ SID+    S S+ D  +F  S  RDR +HV      +  +     +D H  AI + K     N+ ++ L +   D+SL+   L    S Q  +F   Q +    S  DM    +     V   DR +R ++ ++GK  +  +G+  D    G +LK  ID SG+Y  +  SDK++ + +  +G  LA + G    A    F  D K+++  +S+G IF+W+L   +T  M
Sbjct:   11 LKNVVGRSGVTVNGIALHHASDTLLQVAGSSIIVSSTASHDRFEGHLISQTKQQFTCVAVTSCGKYAATGETGHQPAVRLWQLRDAQGNFVGRLVRSMQSHTVSITIVRFTPDDSTLISIGCQHDAQIFTWDWRTGHDLGVGKLMSPVNALTISFDSSMCVTVGSKSVKYWFLPLASDGMNKRTGLTSRSAILADKRNVNFVDAAFC----------------------DSTNRMVTVTSSGEILEFNGNKKYVKCYTWKESGDFKAICIARVPEGLLVGCSDGLVRLFCLIGDDLDFLADLAPPTHL---FQDPSNVYDPQQLQNHPEDAIFPEPRCLVASSSSPTFVVGYADRSLIEF-ARENKSWSFRRASLGHTGSVNCIEP---FPSSSPCLPIGTLITGGSDGTIRFWNFNGD----SEDKKE-----IANILCPSLLKVIFLDENPDLLVDK-RNLESVGPSNDENQSASSSGVLCTRVSHDGRMLIAGTATGMLYIVDLSFSDTPIIDVINAHDHDVTSIDFSDHASTSSHDHPIFLASGGRDRFVHVFRRIPYSSQFVHCAVLDGHQSAIKSIKFAS--NNGQLHLYTAASDRSLIIWKLS-SFSDQHCEFTRVQMISVASSIGDMNFIKHVDLFVVAGHDRMLRQFD-INGKTVREVKGTDDDVAHSGKILKVAIDHSGSYAISVCSDKFVYVTDLRSGVCLAVLCGFGAPATDATFSDDFKNVIVTTSNGSIFIWQLAKNLTERM 723          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Celegans
Match: wdr-5.3 (WD repeat-containing protein wdr-5.3 [Source:UniProtKB/Swiss-Prot;Acc:Q23256])

HSP 1 Score: 64.6994 bits (156), Expect = 3.923e-10
Identity = 31/110 (28.18%), Postives = 59/110 (53.64%), Query Frame = 1
Query: 2266 DMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVW 2595
            D   + N+++ A    D  V+I++++SG   ++ RG T    Y+  C+ +P  + IA++G D+ + + +F TG  +  +  HS+    + +  D   + + S DGCI VW
Sbjct:  260 DFSWSSNSQFIASASDDTTVKIFDVISGACLRTMRGHTN---YVFCCSFNPQSSLIASAGFDETVRVWDFKTGLCVKCIPAHSDPITSISYNHDGNTMATSSYDGCIRVW 366          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Celegans
Match: wdr-5.2 (WD repeat-containing protein wdr-5.2 [Source:UniProtKB/Swiss-Prot;Acc:Q93847])

HSP 1 Score: 59.6918 bits (143), Expect = 9.587e-9
Identity = 36/125 (28.80%), Postives = 63/125 (50.40%), Query Frame = 1
Query: 2224 FLLNQHLVGKQSQYDMVIAPNNRYAAVVCQD-RQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVW 2595
            F+  + L+G +   +     ++    V C D + V+++++ SG+  K+ +G T    Y+  C  +PSGT IA+   D+ I I     G  + S+ GH +    +CF  D  +L S S DG + +W
Sbjct:  138 FVYEKTLMGHRLGINEFSWSSDSKLIVSCSDDKLVKVFDVSSGRCVKTLKGHTN---YVFCCCFNPSGTLIASGSFDETIRIWCARNGNTIFSIPGHEDPVSSVCFNRDGAYLASGSYDGIVRIW 259          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 51.6026 bits (122), Expect = 3.472e-6
Identity = 40/179 (22.35%), Postives = 84/179 (46.93%), Query Frame = 1
Query: 2059 NYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVW 2595
            NYK + T++ H+ +I +AK   +P  + +   S   DK++  +I   D      +  L  H +G     D+  + ++R       D+ ++I+ +V+ +  K+ +G    + Y+  C  +P  + + +   D+ + I +  TG  + ++  HS+    + F  D   + S S DG + +W
Sbjct:   76 NYKLMCTLEGHTKSISSAKF--SPCGKYLGTSS--ADKTV--KIWNMDH--MICERTLTGHKLGVN---DIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKG---HNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIW 240          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Fly
Match: Wdr62 (gene:FBgn0031374 transcript:FBtr0309828)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 322/832 (38.70%), Postives = 479/832 (57.57%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVET----------HSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINL-QNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVE--PVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAP-PSTTGTVTPPRISEEINMESSNTSLINAISNSLQSGENLTADNSSAFRFS-VSALPSWAQKK 2886
            + L+KV G T+ +NAA+ + P SG++A+PAGC VV ++AKR  Q ++ N  +   T++AF+R G+ +ATGE G +P +++W +ET           S + EF  H Y V  +AFS   +++VSVGSQ D  +NV++   N KMAS+K++SKV A+ FSE G +FVTVG RHV++WYL+  R K K   PL+GRSAILGD  +N F  V C                            TY I++ G L++F+ +R LDKWV+ RT  A C+ V E  I+VGC+  II IF++++L ++ TLP  HYLG+++ Q    N   +  +  ++PD +A  +D   S+++C YNDHS+Y+WD+RD  +  K  S LYHS  +W VE  P ++  +    L    F+TCS D+T+R W L             N      N YSK+L+KI+Y+D  L+  I+   +S  +K  +  ++   ++G+R IKISP+ QHLA+ DR GN++ YSL N +   +I AH  E+L ++Y  S    +  L  SASRDR+IHV D  QNY  +QT+DDHS +I + K V        ++ISCG DKS++FR  Q +       F+   +  GK + YDM +  N ++    CQDR VR+Y   + KQ K+++GS  D+G L+K ++DPSG Y+ATS +DK +++ ++ + E +A + GHSE+  GL F  D +HL+S S DGCIF+W++P +M +TM  RM + R           +R   AP P     ++PP   + I +ES  + +             L      A RFS V  LP WA +K
Sbjct:   58 IKLKKVLGLTVCSNAALDVSPVSGLLAYPAGCTVVLFNAKRQTQAYLVNTSRKAFTSVAFSRCGRYVATGECGINPAIKVWELETPNGSLEHCSGGSVVAEFVDHKYAVTCVAFSPTGKYLVSVGSQHDMIVNVFDWRANLKMASNKISSKVAAVCFSEDGSYFVTVGNRHVKYWYLEGGR-KYKDPIPLMGRSAILGDLRDNDFCAVAC--------------------GKGICAESTYAITRQGHLVEFSSRRLLDKWVQCRTTNANCICVNERFILVGCAESIIRIFNSATLEYVTTLPRTHYLGVDVAQGIQINHIMSVPQQAKFPDCIAMVFDEQRSKVSCVYNDHSLYIWDLRDISRVGKSHSFLYHSTCIWGVETVPYNVEREPSQTLPEECFVTCSSDDTIRVWGLDGCT---------NNDIYRRNIYSKELLKIVYSDDELQ-FIKDQGSSLFDK--AGNSSYDGRNGVRCIKISPELQHLASGDRCGNIRVYSLVNLRLLTTIEAHESEVLCLEY--SNEKIERKLLASASRDRLIHVFDVAQNYLLLQTLDDHSSSITSIKFVGA--GLNFQMISCGADKSIMFRSFQGN------IFMRGTNTSGKTTLYDMEVDSNAKHILTACQDRNVRVYGTQNAKQTKTFKGSHSDEGSLIKLSLDPSGIYVATSCTDKTLAVYDYYSNECMARMYGHSELVTGLKFTNDCRHLISASGDGCIFIWQVPHDMIVTMQARMSQQR-----------LRSGHAPLPRPLAPISPP---DGIVLESPTSEIEQP---------QLQPKFGVAERFSDVGQLPQWAMRK 823          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Fly
Match: Wdr62 (gene:FBgn0031374 transcript:FBtr0113012)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 322/832 (38.70%), Postives = 479/832 (57.57%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVET----------HSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINL-QNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVE--PVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAP-PSTTGTVTPPRISEEINMESSNTSLINAISNSLQSGENLTADNSSAFRFS-VSALPSWAQKK 2886
            + L+KV G T+ +NAA+ + P SG++A+PAGC VV ++AKR  Q ++ N  +   T++AF+R G+ +ATGE G +P +++W +ET           S + EF  H Y V  +AFS   +++VSVGSQ D  +NV++   N KMAS+K++SKV A+ FSE G +FVTVG RHV++WYL+  R K K   PL+GRSAILGD  +N F  V C                            TY I++ G L++F+ +R LDKWV+ RT  A C+ V E  I+VGC+  II IF++++L ++ TLP  HYLG+++ Q    N   +  +  ++PD +A  +D   S+++C YNDHS+Y+WD+RD  +  K  S LYHS  +W VE  P ++  +    L    F+TCS D+T+R W L             N      N YSK+L+KI+Y+D  L+  I+   +S  +K  +  ++   ++G+R IKISP+ QHLA+ DR GN++ YSL N +   +I AH  E+L ++Y  S    +  L  SASRDR+IHV D  QNY  +QT+DDHS +I + K V        ++ISCG DKS++FR  Q +       F+   +  GK + YDM +  N ++    CQDR VR+Y   + KQ K+++GS  D+G L+K ++DPSG Y+ATS +DK +++ ++ + E +A + GHSE+  GL F  D +HL+S S DGCIF+W++P +M +TM  RM + R           +R   AP P     ++PP   + I +ES  + +             L      A RFS V  LP WA +K
Sbjct:   27 IKLKKVLGLTVCSNAALDVSPVSGLLAYPAGCTVVLFNAKRQTQAYLVNTSRKAFTSVAFSRCGRYVATGECGINPAIKVWELETPNGSLEHCSGGSVVAEFVDHKYAVTCVAFSPTGKYLVSVGSQHDMIVNVFDWRANLKMASNKISSKVAAVCFSEDGSYFVTVGNRHVKYWYLEGGR-KYKDPIPLMGRSAILGDLRDNDFCAVAC--------------------GKGICAESTYAITRQGHLVEFSSRRLLDKWVQCRTTNANCICVNERFILVGCAESIIRIFNSATLEYVTTLPRTHYLGVDVAQGIQINHIMSVPQQAKFPDCIAMVFDEQRSKVSCVYNDHSLYIWDLRDISRVGKSHSFLYHSTCIWGVETVPYNVEREPSQTLPEECFVTCSSDDTIRVWGLDGCT---------NNDIYRRNIYSKELLKIVYSDDELQ-FIKDQGSSLFDK--AGNSSYDGRNGVRCIKISPELQHLASGDRCGNIRVYSLVNLRLLTTIEAHESEVLCLEY--SNEKIERKLLASASRDRLIHVFDVAQNYLLLQTLDDHSSSITSIKFVGA--GLNFQMISCGADKSIMFRSFQGN------IFMRGTNTSGKTTLYDMEVDSNAKHILTACQDRNVRVYGTQNAKQTKTFKGSHSDEGSLIKLSLDPSGIYVATSCTDKTLAVYDYYSNECMARMYGHSELVTGLKFTNDCRHLISASGDGCIFIWQVPHDMIVTMQARMSQQR-----------LRSGHAPLPRPLAPISPP---DGIVLESPTSEIEQP---------QLQPKFGVAERFSDVGQLPQWAMRK 792          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Fly
Match: Wdr62 (gene:FBgn0031374 transcript:FBtr0077811)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 322/832 (38.70%), Postives = 479/832 (57.57%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVET----------HSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINL-QNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVE--PVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAP-PSTTGTVTPPRISEEINMESSNTSLINAISNSLQSGENLTADNSSAFRFS-VSALPSWAQKK 2886
            + L+KV G T+ +NAA+ + P SG++A+PAGC VV ++AKR  Q ++ N  +   T++AF+R G+ +ATGE G +P +++W +ET           S + EF  H Y V  +AFS   +++VSVGSQ D  +NV++   N KMAS+K++SKV A+ FSE G +FVTVG RHV++WYL+  R K K   PL+GRSAILGD  +N F  V C                            TY I++ G L++F+ +R LDKWV+ RT  A C+ V E  I+VGC+  II IF++++L ++ TLP  HYLG+++ Q    N   +  +  ++PD +A  +D   S+++C YNDHS+Y+WD+RD  +  K  S LYHS  +W VE  P ++  +    L    F+TCS D+T+R W L             N      N YSK+L+KI+Y+D  L+  I+   +S  +K  +  ++   ++G+R IKISP+ QHLA+ DR GN++ YSL N +   +I AH  E+L ++Y  S    +  L  SASRDR+IHV D  QNY  +QT+DDHS +I + K V        ++ISCG DKS++FR  Q +       F+   +  GK + YDM +  N ++    CQDR VR+Y   + KQ K+++GS  D+G L+K ++DPSG Y+ATS +DK +++ ++ + E +A + GHSE+  GL F  D +HL+S S DGCIF+W++P +M +TM  RM + R           +R   AP P     ++PP   + I +ES  + +             L      A RFS V  LP WA +K
Sbjct:   27 IKLKKVLGLTVCSNAALDVSPVSGLLAYPAGCTVVLFNAKRQTQAYLVNTSRKAFTSVAFSRCGRYVATGECGINPAIKVWELETPNGSLEHCSGGSVVAEFVDHKYAVTCVAFSPTGKYLVSVGSQHDMIVNVFDWRANLKMASNKISSKVAAVCFSEDGSYFVTVGNRHVKYWYLEGGR-KYKDPIPLMGRSAILGDLRDNDFCAVAC--------------------GKGICAESTYAITRQGHLVEFSSRRLLDKWVQCRTTNANCICVNERFILVGCAESIIRIFNSATLEYVTTLPRTHYLGVDVAQGIQINHIMSVPQQAKFPDCIAMVFDEQRSKVSCVYNDHSLYIWDLRDISRVGKSHSFLYHSTCIWGVETVPYNVEREPSQTLPEECFVTCSSDDTIRVWGLDGCT---------NNDIYRRNIYSKELLKIVYSDDELQ-FIKDQGSSLFDK--AGNSSYDGRNGVRCIKISPELQHLASGDRCGNIRVYSLVNLRLLTTIEAHESEVLCLEY--SNEKIERKLLASASRDRLIHVFDVAQNYLLLQTLDDHSSSITSIKFVGA--GLNFQMISCGADKSIMFRSFQGN------IFMRGTNTSGKTTLYDMEVDSNAKHILTACQDRNVRVYGTQNAKQTKTFKGSHSDEGSLIKLSLDPSGIYVATSCTDKTLAVYDYYSNECMARMYGHSELVTGLKFTNDCRHLISASGDGCIFIWQVPHDMIVTMQARMSQQR-----------LRSGHAPLPRPLAPISPP---DGIVLESPTSEIEQP---------QLQPKFGVAERFSDVGQLPQWAMRK 792          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Fly
Match: Wdr62 (gene:FBgn0031374 transcript:FBtr0333007)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 322/832 (38.70%), Postives = 479/832 (57.57%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVET----------HSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINL-QNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVE--PVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAP-PSTTGTVTPPRISEEINMESSNTSLINAISNSLQSGENLTADNSSAFRFS-VSALPSWAQKK 2886
            + L+KV G T+ +NAA+ + P SG++A+PAGC VV ++AKR  Q ++ N  +   T++AF+R G+ +ATGE G +P +++W +ET           S + EF  H Y V  +AFS   +++VSVGSQ D  +NV++   N KMAS+K++SKV A+ FSE G +FVTVG RHV++WYL+  R K K   PL+GRSAILGD  +N F  V C                            TY I++ G L++F+ +R LDKWV+ RT  A C+ V E  I+VGC+  II IF++++L ++ TLP  HYLG+++ Q    N   +  +  ++PD +A  +D   S+++C YNDHS+Y+WD+RD  +  K  S LYHS  +W VE  P ++  +    L    F+TCS D+T+R W L             N      N YSK+L+KI+Y+D  L+  I+   +S  +K  +  ++   ++G+R IKISP+ QHLA+ DR GN++ YSL N +   +I AH  E+L ++Y  S    +  L  SASRDR+IHV D  QNY  +QT+DDHS +I + K V        ++ISCG DKS++FR  Q +       F+   +  GK + YDM +  N ++    CQDR VR+Y   + KQ K+++GS  D+G L+K ++DPSG Y+ATS +DK +++ ++ + E +A + GHSE+  GL F  D +HL+S S DGCIF+W++P +M +TM  RM + R           +R   AP P     ++PP   + I +ES  + +             L      A RFS V  LP WA +K
Sbjct:   27 IKLKKVLGLTVCSNAALDVSPVSGLLAYPAGCTVVLFNAKRQTQAYLVNTSRKAFTSVAFSRCGRYVATGECGINPAIKVWELETPNGSLEHCSGGSVVAEFVDHKYAVTCVAFSPTGKYLVSVGSQHDMIVNVFDWRANLKMASNKISSKVAAVCFSEDGSYFVTVGNRHVKYWYLEGGR-KYKDPIPLMGRSAILGDLRDNDFCAVAC--------------------GKGICAESTYAITRQGHLVEFSSRRLLDKWVQCRTTNANCICVNERFILVGCAESIIRIFNSATLEYVTTLPRTHYLGVDVAQGIQINHIMSVPQQAKFPDCIAMVFDEQRSKVSCVYNDHSLYIWDLRDISRVGKSHSFLYHSTCIWGVETVPYNVEREPSQTLPEECFVTCSSDDTIRVWGLDGCT---------NNDIYRRNIYSKELLKIVYSDDELQ-FIKDQGSSLFDK--AGNSSYDGRNGVRCIKISPELQHLASGDRCGNIRVYSLVNLRLLTTIEAHESEVLCLEY--SNEKIERKLLASASRDRLIHVFDVAQNYLLLQTLDDHSSSITSIKFVGA--GLNFQMISCGADKSIMFRSFQGN------IFMRGTNTSGKTTLYDMEVDSNAKHILTACQDRNVRVYGTQNAKQTKTFKGSHSDEGSLIKLSLDPSGIYVATSCTDKTLAVYDYYSNECMARMYGHSELVTGLKFTNDCRHLISASGDGCIFIWQVPHDMIVTMQARMSQQR-----------LRSGHAPLPRPLAPISPP---DGIVLESPTSEI---------EQPQLQPKFGVAERFSDVGQLPQWAMRK 792          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Fly
Match: Wdr62 (gene:FBgn0031374 transcript:FBtr0110882)

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 322/832 (38.70%), Postives = 479/832 (57.57%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVET----------HSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINL-QNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVE--PVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAP-PSTTGTVTPPRISEEINMESSNTSLINAISNSLQSGENLTADNSSAFRFS-VSALPSWAQKK 2886
            + L+KV G T+ +NAA+ + P SG++A+PAGC VV ++AKR  Q ++ N  +   T++AF+R G+ +ATGE G +P +++W +ET           S + EF  H Y V  +AFS   +++VSVGSQ D  +NV++   N KMAS+K++SKV A+ FSE G +FVTVG RHV++WYL+  R K K   PL+GRSAILGD  +N F  V C                            TY I++ G L++F+ +R LDKWV+ RT  A C+ V E  I+VGC+  II IF++++L ++ TLP  HYLG+++ Q    N   +  +  ++PD +A  +D   S+++C YNDHS+Y+WD+RD  +  K  S LYHS  +W VE  P ++  +    L    F+TCS D+T+R W L             N      N YSK+L+KI+Y+D  L+  I+   +S  +K  +  ++   ++G+R IKISP+ QHLA+ DR GN++ YSL N +   +I AH  E+L ++Y  S    +  L  SASRDR+IHV D  QNY  +QT+DDHS +I + K V        ++ISCG DKS++FR  Q +       F+   +  GK + YDM +  N ++    CQDR VR+Y   + KQ K+++GS  D+G L+K ++DPSG Y+ATS +DK +++ ++ + E +A + GHSE+  GL F  D +HL+S S DGCIF+W++P +M +TM  RM + R           +R   AP P     ++PP   + I +ES  + +             L      A RFS V  LP WA +K
Sbjct:   23 IKLKKVLGLTVCSNAALDVSPVSGLLAYPAGCTVVLFNAKRQTQAYLVNTSRKAFTSVAFSRCGRYVATGECGINPAIKVWELETPNGSLEHCSGGSVVAEFVDHKYAVTCVAFSPTGKYLVSVGSQHDMIVNVFDWRANLKMASNKISSKVAAVCFSEDGSYFVTVGNRHVKYWYLEGGR-KYKDPIPLMGRSAILGDLRDNDFCAVAC--------------------GKGICAESTYAITRQGHLVEFSSRRLLDKWVQCRTTNANCICVNERFILVGCAESIIRIFNSATLEYVTTLPRTHYLGVDVAQGIQINHIMSVPQQAKFPDCIAMVFDEQRSKVSCVYNDHSLYIWDLRDISRVGKSHSFLYHSTCIWGVETVPYNVEREPSQTLPEECFVTCSSDDTIRVWGLDGCT---------NNDIYRRNIYSKELLKIVYSDDELQ-FIKDQGSSLFDK--AGNSSYDGRNGVRCIKISPELQHLASGDRCGNIRVYSLVNLRLLTTIEAHESEVLCLEY--SNEKIERKLLASASRDRLIHVFDVAQNYLLLQTLDDHSSSITSIKFVGA--GLNFQMISCGADKSIMFRSFQGN------IFMRGTNTSGKTTLYDMEVDSNAKHILTACQDRNVRVYGTQNAKQTKTFKGSHSDEGSLIKLSLDPSGIYVATSCTDKTLAVYDYYSNECMARMYGHSELVTGLKFTNDCRHLISASGDGCIFIWQVPHDMIVTMQARMSQQR-----------LRSGHAPLPRPLAPISPP---DGIVLESPTSEIEQP---------QLQPKFGVAERFSDVGQLPQWAMRK 788          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Zebrafish
Match: mapkbp1 (mitogen-activated protein kinase binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-120207-1])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 320/748 (42.78%), Postives = 454/748 (60.70%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRS-KSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELR------TPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVE--PVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELR 2649
            ++LEKV G T   + A++ DP SG++A+PAGCVVV  + K++KQ  I N+ +  IT ++F+ +GK + TGESG  P VR+W V   +Q+ E   H Y V  ++FS NS+++VSVG Q D  +NVW    N  +A++KV+SKV A++FS+   +FVT G RHV+FWYLD+++S K  AT PL GRS +LG+  NN F+DV C                          S T+ I+ +G L +F ++R LDKWVELR      T  AT L+VCE  I  GC+ G +  F  + L+ I TLP PH LG ++   ++ +   +  + VRYPD VA  YD     ++C YNDHS+YVWDVRD RK  KV S LYHS  VWSVE  P S    E+  L   SF++CS D T+R WH    N + S            N  S DL KIIY D    +L++ D   + N  + +      + GIR++ +SPD  HLA+ DR G L+ + L + +E   + AH+ EIL ++Y +  +   L L  +ASRDR+IH++D  + Y  +QT+D+HS +I A +     N+ ++R+ISCG DKS+ FR  Q  E G +  F    H+V K + YDM I P  +YA + CQDR +RI+N+ +GKQ+K Y+GS G+DG ++K   DPSG Y+ATS SDK ISI +F TGE +A++ GHSEV  G+ F  D +HL++VS D CIFVW+L  E+T+ M +R+ +L+
Sbjct:   39 VTLEKVLGITSAGSRALACDPHSGLIAYPAGCVVVLLNPKKNKQHHIINSSRKTITTVSFSPDGKYVVTGESGHMPAVRVWDVAERTQVAELQEHKYGVACVSFSPNSKYIVSVGYQHDMIVNVWAWKKNVVVAANKVSSKVTAVSFSDDSSYFVTAGNRHVKFWYLDHTKSSKVNATVPLSGRSGLLGELRNNFFSDVAC--------------------GKGRKASSTFCITTSGLLCEFNDKRMLDKWVELRKNDSFATSMATSLSVCEDLIFCGCADGTVRAFTPTDLHFICTLPHPHSLGTDIATLTEASHLFSYKQNVRYPDAVAVSYDPSSRWLSCVYNDHSLYVWDVRDLRKVGKVYSALYHSSCVWSVEVYPES-RDGEQPRLSPGSFLSCSSDNTIRLWHTDAQNTSLS-----------RNVISNDLQKIIYMDSNTSTLLDTDCTISSNSEKVDPQTSENRTGIRTMCVSPDGLHLASGDRNGTLRIHDLESMEEILDVQAHDSEILCLEYSKPETG--LKLLATASRDRLIHILDADKEYSLLQTLDEHSSSITAVRFAA--NEGKVRMISCGADKSIYFRTAQKTEEGTA--FTRTHHIVRKTTLYDMDIDPTRKYAVIGCQDRSIRIFNIGNGKQKKVYKGSQGEDGTVIKVQTDPSGLYVATSCSDKNISIFDFYTGECVATMFGHSEVVTGMKFTNDCRHLITVSGDSCIFVWRLSPELTINMRQRLSDLK 748          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Zebrafish
Match: mapkbp1 (mitogen-activated protein kinase binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-120207-1])

HSP 1 Score: 608.216 bits (1567), Expect = 0.000e+0
Identity = 320/778 (41.13%), Postives = 454/778 (58.35%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRS-KSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVE--PVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSD------------------------------------GCIFVWKLPVEMTLTMHKRMQELR 2649
            ++LEKV G T   + A++ DP SG++A+PAGCVVV  + K++KQ  I N+ +  IT ++F+ +GK + TGESG  P VR+W V   +Q+ E   H Y V  ++FS NS+++VSVG Q D  +NVW    N  +A++KV+SKV A++FS+   +FVT G RHV+FWYLD+++S K  AT PL GRS +LG+  NN F+DV C                          S T+ I+ +G L +F ++R LDKWVELRT  AT L+VCE  I  GC+ G +  F  + L+ I TLP PH LG ++   ++ +   +  + VRYPD VA  YD     ++C YNDHS+YVWDVRD RK  KV S LYHS  VWSVE  P S    E+  L   SF++CS D T+R WH    N + S            N  S DL KIIY D    +L++ D   + N  + +      + GIR++ +SPD  HLA+ DR G L+ + L + +E   + AH+ EIL ++Y +  +   L L  +ASRDR+IH++D  + Y  +QT+D+HS +I A +     N+ ++R+ISCG DKS+ FR  Q  E G +  F    H+V K + YDM I P  +YA + CQDR +RI+N+ +GKQ+K Y+GS G+DG ++K   DPSG Y+ATS SDK ISI +F TGE +A++ GHSEV  G+ F  D +HL++VS D                                     CIFVW+L  E+T+ M +R+ +L+
Sbjct:   39 VTLEKVLGITSAGSRALACDPHSGLIAYPAGCVVVLLNPKKNKQHHIINSSRKTITTVSFSPDGKYVVTGESGHMPAVRVWDVAERTQVAELQEHKYGVACVSFSPNSKYIVSVGYQHDMIVNVWAWKKNVVVAANKVSSKVTAVSFSDDSSYFVTAGNRHVKFWYLDHTKSSKVNATVPLSGRSGLLGELRNNFFSDVAC--------------------GKGRKASSTFCITTSGLLCEFNDKRMLDKWVELRTSMATSLSVCEDLIFCGCADGTVRAFTPTDLHFICTLPHPHSLGTDIATLTEASHLFSYKQNVRYPDAVAVSYDPSSRWLSCVYNDHSLYVWDVRDLRKVGKVYSALYHSSCVWSVEVYPES-RDGEQPRLSPGSFLSCSSDNTIRLWHTDAQNTSLS-----------RNVISNDLQKIIYMDSNTSTLLDTDCTISSNSEKVDPQTSENRTGIRTMCVSPDGLHLASGDRNGTLRIHDLESMEEILDVQAHDSEILCLEYSKPETG--LKLLATASRDRLIHILDADKEYSLLQTLDEHSSSITAVRFAA--NEGKVRMISCGADKSIYFRTAQKTEEGTA--FTRTHHIVRKTTLYDMDIDPTRKYAVIGCQDRSIRIFNIGNGKQKKVYKGSQGEDGTVIKVQTDPSGLYVATSCSDKNISIFDFYTGECVATMFGHSEVVTGMKFTNDCRHLITVSGDRWVFANHISQLKNQLLYPPYLGHHISMVNMSVLCVFSCIFVWRLSPELTINMRQRLSDLK 778          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Zebrafish
Match: mapkbp1 (mitogen-activated protein kinase binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-120207-1])

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 320/784 (40.82%), Postives = 454/784 (57.91%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRS-KSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELR------TPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVE--PVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSD------------------------------------GCIFVWKLPVEMTLTMHKRMQELR 2649
            ++LEKV G T   + A++ DP SG++A+PAGCVVV  + K++KQ  I N+ +  IT ++F+ +GK + TGESG  P VR+W V   +Q+ E   H Y V  ++FS NS+++VSVG Q D  +NVW    N  +A++KV+SKV A++FS+   +FVT G RHV+FWYLD+++S K  AT PL GRS +LG+  NN F+DV C                          S T+ I+ +G L +F ++R LDKWVELR      T  AT L+VCE  I  GC+ G +  F  + L+ I TLP PH LG ++   ++ +   +  + VRYPD VA  YD     ++C YNDHS+YVWDVRD RK  KV S LYHS  VWSVE  P S    E+  L   SF++CS D T+R WH    N + S            N  S DL KIIY D    +L++ D   + N  + +      + GIR++ +SPD  HLA+ DR G L+ + L + +E   + AH+ EIL ++Y +  +   L L  +ASRDR+IH++D  + Y  +QT+D+HS +I A +     N+ ++R+ISCG DKS+ FR  Q  E G +  F    H+V K + YDM I P  +YA + CQDR +RI+N+ +GKQ+K Y+GS G+DG ++K   DPSG Y+ATS SDK ISI +F TGE +A++ GHSEV  G+ F  D +HL++VS D                                     CIFVW+L  E+T+ M +R+ +L+
Sbjct:   39 VTLEKVLGITSAGSRALACDPHSGLIAYPAGCVVVLLNPKKNKQHHIINSSRKTITTVSFSPDGKYVVTGESGHMPAVRVWDVAERTQVAELQEHKYGVACVSFSPNSKYIVSVGYQHDMIVNVWAWKKNVVVAANKVSSKVTAVSFSDDSSYFVTAGNRHVKFWYLDHTKSSKVNATVPLSGRSGLLGELRNNFFSDVAC--------------------GKGRKASSTFCITTSGLLCEFNDKRMLDKWVELRKNDSFATSMATSLSVCEDLIFCGCADGTVRAFTPTDLHFICTLPHPHSLGTDIATLTEASHLFSYKQNVRYPDAVAVSYDPSSRWLSCVYNDHSLYVWDVRDLRKVGKVYSALYHSSCVWSVEVYPES-RDGEQPRLSPGSFLSCSSDNTIRLWHTDAQNTSLS-----------RNVISNDLQKIIYMDSNTSTLLDTDCTISSNSEKVDPQTSENRTGIRTMCVSPDGLHLASGDRNGTLRIHDLESMEEILDVQAHDSEILCLEYSKPETG--LKLLATASRDRLIHILDADKEYSLLQTLDEHSSSITAVRFAA--NEGKVRMISCGADKSIYFRTAQKTEEGTA--FTRTHHIVRKTTLYDMDIDPTRKYAVIGCQDRSIRIFNIGNGKQKKVYKGSQGEDGTVIKVQTDPSGLYVATSCSDKNISIFDFYTGECVATMFGHSEVVTGMKFTNDCRHLITVSGDRWVFANHISQLKNQLLYPPYLGHHISMVNMSVLCVFSCIFVWRLSPELTINMRQRLSDLK 784          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Zebrafish
Match: wdr62 (WD repeat domain 62 [Source:ZFIN;Acc:ZDB-GENE-060503-291])

HSP 1 Score: 584.719 bits (1506), Expect = 2.233e-180
Identity = 308/747 (41.23%), Postives = 435/747 (58.23%), Query Frame = 1
Query:  442 LEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKS-KATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDND--FNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTK-EKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISL 2670
            LEKV G T  +++A++ DP +G+VA+PAGCV+V  S K++KQ  I N  +   +A+AF++ GK L TGESG  P VR+W V   +Q+ E   H Y V  +AFS N  ++VSVG Q D +++VWE    T +AS+KV+S+V+ ++FSE   +FVT G RHV+FWYLD S+ +   +T PL+GRS +LG+  N+ F  + C                       +  S TY I+  G L QF   R LD WV+L+T  A CL+V  + +  GC+ G + +F    L +I TL  PH LG+++   +     F+AN E  +YPD +A  +D V   +TC YNDHS+YVWDVRD R   KV S LYHSG VWSVE    L     + L   SF+TCS D T+R W    S    SHS    +     N YS+D+++I+Y D   + L       A  +     A    K GIR + ISPD QHLAA DR GNL+ + L    E   I AH+ E+L + +  SP+   L L  SASRDR+IH+ D       +QT+ DHS +I A K   T  + E+ ++SCG DKS+ FR  +    G    F  + H+V K + YDM +     + A+ CQDR +R+YN+ SGK +K ++GS  DDG LLK  +DPSG ++ATS SDK I + ++ +GE +A++ GHSE+  G+ F  D +HL++VS D C+FVW+L  +MT +M KR+ E +    + L
Sbjct:   53 LEKVLGITASSSSALTCDPNTGLVAYPAGCVIVILSPKKNKQTHIFNTSRKTFSALAFSQNGKYLVTGESGHMPCVRVWDVAERTQVAEVQCHKYGVSCVAFSPNGSYIVSVGYQHDRTVSVWEWKKGTVIASNKVSSRVLGVSFSEDNSYFVTAGNRHVKFWYLDASKERRVNSTVPLIGRSGLLGEHQNSQFCGLAC--------------------GRGSMASSTYCITHTGLLCQFNSNRQLDSWVDLKTTSAQCLSVSGTFVFCGCADGTVRVFSPQDLRYITTLHRPHCLGVDVSQGTQPGHLFSANPE-AQYPDTLALTFDPVTKHLTCVYNDHSVYVWDVRDIRNVGKVYSALYHSGCVWSVETYPELEDPSAACLSPGSFLTCSSDNTIRLWR---SESPQSHSAALGLR---HNLYSQDIVRIVYVDDDTQYL------KAEAEKAEGGAGQDGKSGIRVLGISPDGQHLAAGDRSGNLRIFGLQFMDELQKIEAHDSEVLCLAF--SPAETGLHLLASASRDRLIHIFDMDSKCNLVQTVYDHSASITAVKF--TGLNSELCMVSCGADKSVYFRSAEKTSDG--LVFSRSHHIVEKTTLYDMDLDATRTHTAIACQDRNIRVYNVKSGKMKKCFKGSMNDDGTLLKVQLDPSGMFLATSCSDKNICVFDYESGECVATLFGHSEIVTGMKFSQDCRHLITVSGDSCVFVWRLDSQMTNSMRKRLAERKQQAGLRL 760          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Zebrafish
Match: wdr62 (WD repeat domain 62 [Source:ZFIN;Acc:ZDB-GENE-060503-291])

HSP 1 Score: 585.104 bits (1507), Expect = 3.183e-180
Identity = 308/747 (41.23%), Postives = 435/747 (58.23%), Query Frame = 1
Query:  442 LEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKS-KATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDND--FNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTK-EKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISL 2670
            LEKV G T  +++A++ DP +G+VA+PAGCV+V  S K++KQ  I N  +   +A+AF++ GK L TGESG  P VR+W V   +Q+ E   H Y V  +AFS N  ++VSVG Q D +++VWE    T +AS+KV+S+V+ ++FSE   +FVT G RHV+FWYLD S+ +   +T PL+GRS +LG+  N+ F  + C                       +  S TY I+  G L QF   R LD WV+L+T  A CL+V  + +  GC+ G + +F    L +I TL  PH LG+++   +     F+AN E  +YPD +A  +D V   +TC YNDHS+YVWDVRD R   KV S LYHSG VWSVE    L     + L   SF+TCS D T+R W    S    SHS    +     N YS+D+++I+Y D   + L       A  +     A    K GIR + ISPD QHLAA DR GNL+ + L    E   I AH+ E+L + +  SP+   L L  SASRDR+IH+ D       +QT+ DHS +I A K   T  + E+ ++SCG DKS+ FR  +    G    F  + H+V K + YDM +     + A+ CQDR +R+YN+ SGK +K ++GS  DDG LLK  +DPSG ++ATS SDK I + ++ +GE +A++ GHSE+  G+ F  D +HL++VS D C+FVW+L  +MT +M KR+ E +    + L
Sbjct:   53 LEKVLGITASSSSALTCDPNTGLVAYPAGCVIVILSPKKNKQTHIFNTSRKTFSALAFSQNGKYLVTGESGHMPCVRVWDVAERTQVAEVQCHKYGVSCVAFSPNGSYIVSVGYQHDRTVSVWEWKKGTVIASNKVSSRVLGVSFSEDNSYFVTAGNRHVKFWYLDASKERRVNSTVPLIGRSGLLGEHQNSQFCGLAC--------------------GRGSMASSTYCITHTGLLCQFNSNRQLDSWVDLKTTSAQCLSVSGTFVFCGCADGTVRVFSPQDLRYITTLHRPHCLGVDVSQGTQPGHLFSANPE-AQYPDTLALTFDPVTKHLTCVYNDHSVYVWDVRDIRNVGKVYSALYHSGCVWSVETYPELEDPSAACLSPGSFLTCSSDNTIRLWR---SESPQSHSAALGLR---HNLYSQDIVRIVYVDDDTQYL------KAEAEKAEGGAGQDGKSGIRVLGISPDGQHLAAGDRSGNLRIFGLQFMDELQKIEAHDSEVLCLAF--SPAETGLHLLASASRDRLIHIFDMDSKCNLVQTVYDHSASITAVKF--TGLNSELCMVSCGADKSVYFRSAEKTSDG--LVFSRSHHIVEKTTLYDMDLDATRTHTAIACQDRNIRVYNVKSGKMKKCFKGSMNDDGTLLKVQLDPSGMFLATSCSDKNICVFDYESGECVATLFGHSEIVTGMKFSQDCRHLITVSGDSCVFVWRLDSQMTNSMRKRLAERKQQAGLRL 760          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000049592.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:54795631:54815051:1 gene:ENSXETG00000021291.1 transcript:ENSXETT00000049592.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 528.48 bits (1360), Expect = 6.831e-168
Identity = 297/736 (40.35%), Postives = 423/736 (57.47%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRS-KSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLS-DSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQ--PDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCI------FVW-KLPV 2607
            + LEKV G T+ +N++++ DP SG++A+PAGCV+V    +++KQ  I N  + P++A++F+  GK + TGESG +P VRIW V     + E  GH Y V  + FS + ++VVSVG Q D  INVW+   N  +A +KV+SKV A++FSE   +FVTVG RHV+FWYL+ S+  +   T PL+GRS +LGD  +N F  V C                       +N   T+ I+ +G L QFT++R L+KW++L+   + CL V E  +  GC  GI+ IF+  +L +I  LP PHYLG+++   +D +          YPD  A  YD  +  + C YNDHS+YVWDV D RK  KV S LYHS  VW++E    L  E+  L    F +CS D T+R W++  ++NL              +N YS DL K+IY D  ++ L   D +S   K    +     K GIR +KI PD QHLA+ DR GN++ Y L    E  +I AH+GE+L ++Y  S  +  + L  SASRDR+IHV++  ++Y   QT+DDHS +I A K     + +EI +ISCG DKS+ FR  Q  PD       F    H V K + YDM +  + +  AV CQD+ +R+Y++ SGKQ K  + S+ + G LLK  IDPSGT+  TS S K IS  +  +GE +A V GHS++   + F  D K L++VS D  +      F+W KLP+
Sbjct:   43 VELEKVLGITVSSNSSITCDPISGLIAYPAGCVIVVLCPRKNKQTHIFNTCRKPLSALSFSPNGKFIVTGESGHNPAVRIWDVAEKVLVSEMLGHKYGVSCVCFSPDMKYVVSVGYQHDMVINVWDWKVNMIVAKNKVSSKVSAVSFSEDSSYFVTVGSRHVKFWYLETSKKIQVNGTVPLVGRSGLLGDLHDNIFCGVAC--------------------GKGSNSRSTFCIAYSGVLCQFTDKRVLEKWIKLKVSASYCLAVTELFVFCGCEDGIVRIFNAQNLQYITDLPKPHYLGVDVSLGTDPSTLFTKQTDSSYPDTSALVYDERNQWLCCVYNDHSLYVWDVNDTRKVGKVYSGLYHSSFVWNIEVFPEL-GERPCLPSGCFFSCSSDNTIRLWNIERNANLYLG-----------KNIYSNDLHKVIYVDNNIEHL--KDTSSMAEKSDVRDT----KSGIRVLKIRPDGQHLASGDRTGNIRIYDLGIFDELLTIEAHDGEVLCLEY--SKPSTGVTLLASASRDRLIHVLNAEKDYILEQTLDDHSSSITAVKF--AGDQEEILMISCGADKSIYFRPAQMLPD----GIHFSRLHHTVEKTAMYDMDVDVSQKTVAVACQDKNIRLYSISSGKQEKILK-SSPNGGALLKVQIDPSGTFFTTSCSSKNISFFDLLSGECIAEVYGHSDLVTDMKFTNDCKRLITVSGDRLVLAILFNFIWQKLPI 731          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000049596.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:54797773:54815051:1 gene:ENSXETG00000021291.1 transcript:ENSXETT00000049596.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 519.235 bits (1336), Expect = 1.253e-164
Identity = 293/734 (39.92%), Postives = 419/734 (57.08%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRS-KSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLS-DSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCI------FVW-KLPV 2607
            + LEKV G T+ +N++++ DP SG++A+PAGCV+V    +++KQ  I N  + P++A++F+  GK + TGESG +P VRIW V     + E  GH Y V  + FS + ++VVSVG Q D  INVW+   N  +A +KV+SKV A++FSE   +FVTVG RHV+FWYL+ S+  +   T PL+GRS +LGD  +N F  V C                       +N   T+ I+ +G L QFT++R L+KW++L+   + CL V E  +  GC  GI+ IF+  +L +I  LP PHYLG+++   +D +          YPD  A  YD  +  + C YNDHS+YVWDV D RK  KV S LYHS  VW++E    L  E+  L    F +CS D T+R W++  ++NL              +N YS     +IY D  ++ L   D +S   K    +     K GIR +KI PD QHLA+ DR GN++ Y L    E  +I AH+GE+L ++Y  S  +  + L  SASRDR+IHV++  ++Y   QT+DDHS +I A K     + +EI +ISCG DKS+ FR  Q    G    F    H V K + YDM +  + +  AV CQD+ +R+Y++ SGKQ K  + S+ + G LLK  IDPSGT+  TS S K IS  +  +GE +A V GHS++   + F  D K L++VS D  +      F+W KLP+
Sbjct:   39 VELEKVLGITVSSNSSITCDPISGLIAYPAGCVIVVLCPRKNKQTHIFNTCRKPLSALSFSPNGKFIVTGESGHNPAVRIWDVAEKVLVSEMLGHKYGVSCVCFSPDMKYVVSVGYQHDMVINVWDWKVNMIVAKNKVSSKVSAVSFSEDSSYFVTVGSRHVKFWYLETSKKIQVNGTVPLVGRSGLLGDLHDNIFCGVAC--------------------GKGSNSRSTFCIAYSGVLCQFTDKRVLEKWIKLKVSASYCLAVTELFVFCGCEDGIVRIFNAQNLQYITDLPKPHYLGVDVSLGTDPSTLFTKQTDSSYPDTSALVYDERNQWLCCVYNDHSLYVWDVNDTRKVGKVYSGLYHSSFVWNIEVFPEL-GERPCLPSGCFFSCSSDNTIRLWNIERNANLYLG-----------KNIYS----NVIYVDNNIEHL--KDTSSMAEKSDVRDT----KSGIRVLKIRPDGQHLASGDRTGNIRIYDLGIFDELLTIEAHDGEVLCLEY--SKPSTGVTLLASASRDRLIHVLNAEKDYILEQTLDDHSSSITAVKF--AGDQEEILMISCGADKSIYFRPAQMLPDG--IHFSRLHHTVEKTAMYDMDVDVSQKTVAVACQDKNIRLYSISSGKQEKILK-SSPNGGALLKVQIDPSGTFFTTSCSSKNISFFDLLSGECIAEVYGHSDLVTDMKFTNDCKRLITVSGDRLVLAILFNFIWQKLPI 723          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Xenopus
Match: gucy1a2 (guanylate cyclase 1, soluble, alpha 2 [Source:Xenbase;Acc:XB-GENE-1011801])

HSP 1 Score: 71.633 bits (174), Expect = 9.452e-12
Identity = 51/191 (26.70%), Postives = 88/191 (46.07%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGE---SGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKM----ASSKVTSKVIAIAFS-EAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGR 984
            L L+ + GF     + +   P    + +P GC V+  +    KQ F+     + ++ +A +R G+ LA+G+    G    + +W         + + H  +V ALAFS N  ++VS+G Q+D S+ VW +     +    ASS  +     I F+  +   F+T G   +R W +D    K + T   LG+
Sbjct:   10 LELQGIIGFNGHVPSGLISHPDREHLIYPLGCTVIIENLSSRKQQFLQGHTNN-VSCVAASRSGRYLASGQVTYMGFKADILLWDYGRREACAKLTLHKVKVEALAFSPNDLYLVSLGGQDDGSVVVWNVAKREAICGSPASSLSSGHATTIIFTNNSDDIFMTGGNGTLRVWDVDLPNRKMRPTECQLGQ 199          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Xenopus
Match: EML6 (echinoderm microtubule associated protein like 6 [Source:NCBI gene;Acc:100498213])

HSP 1 Score: 68.1662 bits (165), Expect = 1.649e-10
Identity = 61/203 (30.05%), Postives = 98/203 (48.28%), Query Frame = 1
Query:  436 LSLEKVFG---FTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGK---LLATGESGKSPKVRIW---SVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIA--FSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMN 1011
            LSL+ VFG   F  ++N    L+  + IV   A   +V   +  S+ F++ +     I  +  N+  K   ++ATG+ G +P + IW   S +T S L  F  H   VG + FS   + +VSVG   + +I VW      K+A     ++ I +A    ++   FV+VGV+H++FW L        A + LL +  I+G   N
Sbjct: 1319 LSLDHVFGYRGFDCRDNLHY-LNDGADIVFHTAAASIVQNLSTGSQSFYLEHT--DDILCLTVNQHPKYKNVIATGQIGATPSIHIWDAMSKQTLSILRCF--HGKGVGCINFSATGKLLVSVGVDPEHTITVWRWQEGAKVAIKGGHAERIFVAQFRPDSDTQFVSVGVKHIKFWTL--------AGSALLYKKGIVGSVDN 1508          

HSP 2 Score: 65.4698 bits (158), Expect = 1.173e-9
Identity = 55/178 (30.90%), Postives = 93/178 (52.25%), Query Frame = 1
Query:  436 LSLEKVFGF---TIQNNAAVSLDPTSG--IVAFPAGCVVVGYSAKRSKQFFI-HNAVKSPITAIAFNREGKLLATGESGKSPKVRIW---SVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTS-KVIAIAFSE-AGQFFVTVGVRHVRFWYL 936
            L LE V+G+     +NN    L  T+G  +V F AG  VV  + + S++FF+ HN     I ++A + +  L+ATG+ GK P + IW   +V+T S L +   H + V  LAF    + + SVG     ++ +W+      +A++   S ++  I++        V+ GV+H++FW L
Sbjct:   11 LRLEWVYGYRGHQCRNN----LYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHN---DDIISLALHPDRTLVATGQVGKDPYICIWDSYTVQTVSILKDV--HTHGVAGLAFDSEGQRLASVGLDAKNTVCIWDWQKGKVLATATGHSDRIFDISWDPYQPNRLVSCGVKHIKFWTL 179          

HSP 3 Score: 57.7658 bits (138), Expect = 2.028e-7
Identity = 41/162 (25.31%), Postives = 78/162 (48.15%), Query Frame = 1
Query:  457 GFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSA-KRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYR-VGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQF--FVTVGVRHVRFW 930
            G+  +NN   +    +G V +    + V Y   + S++F++ +     I ++A +     +ATG+ G+   + +W  +T   L    G + R V AL FS + + +VSVG  ++ +I  W+     K+A ++     I +           VTVG++H++FW
Sbjct:  687 GYDCRNNLFYT---QAGEVVYHVAAIAVVYDRLQHSQRFYLGH--DDDILSLAIHPVKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVSALDFSADGKCLVSVGLDDNHTIVYWDWKKGEKIACTRGHKDKIFVVKCNPHHTDKLVTVGMKHIKFW 843          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Xenopus
Match: EML6 (echinoderm microtubule associated protein like 6 [Source:NCBI gene;Acc:100498213])

HSP 1 Score: 68.1662 bits (165), Expect = 1.683e-10
Identity = 61/203 (30.05%), Postives = 98/203 (48.28%), Query Frame = 1
Query:  436 LSLEKVFG---FTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGK---LLATGESGKSPKVRIW---SVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIA--FSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMN 1011
            LSL+ VFG   F  ++N    L+  + IV   A   +V   +  S+ F++ +     I  +  N+  K   ++ATG+ G +P + IW   S +T S L  F  H   VG + FS   + +VSVG   + +I VW      K+A     ++ I +A    ++   FV+VGV+H++FW L        A + LL +  I+G   N
Sbjct: 1363 LSLDHVFGYRGFDCRDNLHY-LNDGADIVFHTAAASIVQNLSTGSQSFYLEHT--DDILCLTVNQHPKYKNVIATGQIGATPSIHIWDAMSKQTLSILRCF--HGKGVGCINFSATGKLLVSVGVDPEHTITVWRWQEGAKVAIKGGHAERIFVAQFRPDSDTQFVSVGVKHIKFWTL--------AGSALLYKKGIVGSVDN 1552          

HSP 2 Score: 65.4698 bits (158), Expect = 1.177e-9
Identity = 55/178 (30.90%), Postives = 93/178 (52.25%), Query Frame = 1
Query:  436 LSLEKVFGF---TIQNNAAVSLDPTSG--IVAFPAGCVVVGYSAKRSKQFFI-HNAVKSPITAIAFNREGKLLATGESGKSPKVRIW---SVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTS-KVIAIAFSE-AGQFFVTVGVRHVRFWYL 936
            L LE V+G+     +NN    L  T+G  +V F AG  VV  + + S++FF+ HN     I ++A + +  L+ATG+ GK P + IW   +V+T S L +   H + V  LAF    + + SVG     ++ +W+      +A++   S ++  I++        V+ GV+H++FW L
Sbjct:   11 LRLEWVYGYRGHQCRNN----LYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHN---DDIISLALHPDRTLVATGQVGKDPYICIWDSYTVQTVSILKDV--HTHGVAGLAFDSEGQRLASVGLDAKNTVCIWDWQKGKVLATATGHSDRIFDISWDPYQPNRLVSCGVKHIKFWTL 179          

HSP 3 Score: 57.7658 bits (138), Expect = 2.122e-7
Identity = 41/162 (25.31%), Postives = 78/162 (48.15%), Query Frame = 1
Query:  457 GFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSA-KRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYR-VGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQF--FVTVGVRHVRFW 930
            G+  +NN   +    +G V +    + V Y   + S++F++ +     I ++A +     +ATG+ G+   + +W  +T   L    G + R V AL FS + + +VSVG  ++ +I  W+     K+A ++     I +           VTVG++H++FW
Sbjct:  687 GYDCRNNLFYT---QAGEVVYHVAAIAVVYDRLQHSQRFYLGH--DDDILSLAIHPVKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVSALDFSADGKCLVSVGLDDNHTIVYWDWKKGEKIACTRGHKDKIFVVKCNPHHTDKLVTVGMKHIKFW 843          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Mouse
Match: Mapkbp1 (mitogen-activated protein kinase binding protein 1 [Source:MGI Symbol;Acc:MGI:1347004])

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 329/743 (44.28%), Postives = 468/743 (62.99%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSR-SKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPV-SILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPD--LVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELR 2649
            ++LEKV G T+     ++ DP SG+VA+PAGCVVV ++ ++ KQ  I N+ +  ITA+AF+ +GK L TGESG  P VR+W V   SQ+ E   H Y V  +AFS +++++VSVG Q D  +NVW    N  +AS+KV+S+V A++FSE   +FVT G RH++FWYLD+S+ SK  AT PLLGRS +LG+  NN FTDV C                            T+ I+ +G L +F+++R LDKWVELRT  A C++V +  I  GC+ G + +F+ S+L+ ++TLP PH LG ++ + ++ +   +     RYPD +A  +D  +  ++C YNDHSIYVWDVRD +K  KV S LYHS  VWSVE    I    ++ L  +SFITCS D T+R W+   S +   H  T +      N  S DLIKIIY D   ++L++ +        +++ + +  + GIRS+ ISP+ QHLA+ DR G L+ + L +  E   + AH+ EIL ++Y    S PD  L L  SASRDR+IHV+D  + Y   QT+D+HS +I A K   +  D ++R+ISCG DKS+ FR  Q  +SG+  QF    H+V K + YDM + P+ +Y A+ CQDR +RI+N+ SGKQ+K ++GS G+DG L+K   DPSG YIATS SDK +SI +F++GE +A++ GHSE+  G+ F  D KHL+SVS D CIFVW+L  EMT++M +R+ ELR
Sbjct:   40 VTLEKVLGVTVSGGRGLACDPRSGLVAYPAGCVVVLFNPRKHKQHHILNSSRKTITALAFSPDGKYLVTGESGHMPAVRVWDVAERSQVAELQEHKYGVACVAFSPSAKYIVSVGYQHDMIVNVWAWKKNIVVASNKVSSRVTAVSFSEDCSYFVTAGNRHIKFWYLDDSKTSKVNATVPLLGRSGLLGELRNNLFTDVAC--------------------GRGEKADSTFCITSSGLLCEFSDRRLLDKWVELRTTVAHCISVTQEYIFCGCADGTVRLFNPSNLHFLSTLPRPHALGTDIASITEASRLFSGGVNARYPDTIALTFDPTNQWLSCVYNDHSIYVWDVRDPKKVGKVYSALYHSSCVWSVEVYPEIKDSHQACLPPSSFITCSSDNTIRLWNTESSGV---HGSTLH-----RNILSNDLIKIIYVDGNTQALLDTELPGG---DKADGSLMDPRVGIRSVCISPNGQHLASGDRMGTLRIHELQSLSEMLKVEAHDSEILCLEY----SKPDTGLKLLASASRDRLIHVLDAGREYSLQQTLDEHSSSITAVKFAAS--DGQVRMISCGADKSIYFRTAQ--KSGEGVQFTRTHHVVRKTTLYDMDVEPSWKYTAIGCQDRNIRIFNISSGKQKKLFKGSQGEDGTLIKVQTDPSGIYIATSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLISVSGDSCIFVWRLSSEMTISMRQRLAELR 743          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Mouse
Match: Mapkbp1 (mitogen-activated protein kinase binding protein 1 [Source:MGI Symbol;Acc:MGI:1347004])

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 329/749 (43.93%), Postives = 468/749 (62.48%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSR-SKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELR------TPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPV-SILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPD--LVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELR 2649
            ++LEKV G T+     ++ DP SG+VA+PAGCVVV ++ ++ KQ  I N+ +  ITA+AF+ +GK L TGESG  P VR+W V   SQ+ E   H Y V  +AFS +++++VSVG Q D  +NVW    N  +AS+KV+S+V A++FSE   +FVT G RH++FWYLD+S+ SK  AT PLLGRS +LG+  NN FTDV C                            T+ I+ +G L +F+++R LDKWVELR      T  A C++V +  I  GC+ G + +F+ S+L+ ++TLP PH LG ++ + ++ +   +     RYPD +A  +D  +  ++C YNDHSIYVWDVRD +K  KV S LYHS  VWSVE    I    ++ L  +SFITCS D T+R W+   S +   H  T +      N  S DLIKIIY D   ++L++ +        +++ + +  + GIRS+ ISP+ QHLA+ DR G L+ + L +  E   + AH+ EIL ++Y    S PD  L L  SASRDR+IHV+D  + Y   QT+D+HS +I A K   +  D ++R+ISCG DKS+ FR  Q  +SG+  QF    H+V K + YDM + P+ +Y A+ CQDR +RI+N+ SGKQ+K ++GS G+DG L+K   DPSG YIATS SDK +SI +F++GE +A++ GHSE+  G+ F  D KHL+SVS D CIFVW+L  EMT++M +R+ ELR
Sbjct:   40 VTLEKVLGVTVSGGRGLACDPRSGLVAYPAGCVVVLFNPRKHKQHHILNSSRKTITALAFSPDGKYLVTGESGHMPAVRVWDVAERSQVAELQEHKYGVACVAFSPSAKYIVSVGYQHDMIVNVWAWKKNIVVASNKVSSRVTAVSFSEDCSYFVTAGNRHIKFWYLDDSKTSKVNATVPLLGRSGLLGELRNNLFTDVAC--------------------GRGEKADSTFCITSSGLLCEFSDRRLLDKWVELRNTDSFTTTVAHCISVTQEYIFCGCADGTVRLFNPSNLHFLSTLPRPHALGTDIASITEASRLFSGGVNARYPDTIALTFDPTNQWLSCVYNDHSIYVWDVRDPKKVGKVYSALYHSSCVWSVEVYPEIKDSHQACLPPSSFITCSSDNTIRLWNTESSGV---HGSTLH-----RNILSNDLIKIIYVDGNTQALLDTELPGG---DKADGSLMDPRVGIRSVCISPNGQHLASGDRMGTLRIHELQSLSEMLKVEAHDSEILCLEY----SKPDTGLKLLASASRDRLIHVLDAGREYSLQQTLDEHSSSITAVKFAAS--DGQVRMISCGADKSIYFRTAQ--KSGEGVQFTRTHHVVRKTTLYDMDVEPSWKYTAIGCQDRNIRIFNISSGKQKKLFKGSQGEDGTLIKVQTDPSGIYIATSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLISVSGDSCIFVWRLSSEMTISMRQRLAELR 749          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Mouse
Match: Wdr62 (WD repeat domain 62 [Source:MGI Symbol;Acc:MGI:1923696])

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 313/773 (40.49%), Postives = 466/773 (60.28%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNS-RSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDF--NANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWE-NDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPST-TGTVTPPRI 2739
            ++LEKV G T QN++ ++ DP +G VA+ AGCVVV  + K +KQ  I N  +  ++A+AF+ +GK + TGE+G  P VRIW VE  +Q+ E  GH Y V  +AFS N + +VS+G Q D  +NVW+   +  +AS+KV+ +VIA++FSE   +FVTVG RHVRFW+L+ S  +K  +T PL+GRS ILG+  NN F  V C                            T+ +S +G L QF E+R LDKW+ L+   ++CL V +  I  GC+ GI+ IF   SL ++  LP PHYLG+++ +  D+ F  +   E V YPD VA  +D VH  ++C Y DHSIY+WDV+D  + +K+ S L+HS  VW+VE       +++ L   +F+TCS D T+RFW+L  ++ T           +W+ N +S  L+K++Y +  ++ L   D +   ++   N   + +K G+R +++SPD QHLA+ DR GNL+ + L    E   + AH+ E+L ++Y +  +   + L  SASRDR+IHV++  +NY   QT+DDHS +I A K   T   +++++ISCG DKS+ FR  Q  ++     F+   H+  K + YDM I    +Y AV CQDR VR+YN VSGKQ+K Y+GS GD+G LLK  +DPSGT++ATS SDK IS+++F +GE +A + GHSE+  G+ F  D +HL++VS D C+F+W L  E+T  M + + E+         ++  +K + PPS  T   TP  I
Sbjct:   61 VTLEKVLGITAQNSSGLTCDPGTGHVAYLAGCVVVVLNPKENKQQHIFNTTRKSLSALAFSPDGKYIVTGENGHRPAVRIWDVEEKTQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMVLNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEASTEAKVTSTVPLVGRSGILGELHNNIFCGVAC--------------------GRGRMAGNTFCVSYSGLLCQFNEKRVLDKWINLKVSLSSCLCVSDELIFCGCTDGIVRIFQAHSLLYLTNLPKPHYLGVDVAHGLDSSFLFHRKAEAV-YPDTVALTFDPVHQWLSCVYKDHSIYIWDVKDIDEVSKIWSELFHSSFVWNVEVYPEFEDQRACLPSGTFLTCSSDNTIRFWNLDSASDT-----------RWQKNIFSDSLLKVVYVENDIQHL--QDLSHFPDRGSENGTPMDMKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELIKVEAHDAEVLCLEYSKPETG--VTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGT---RDVQMISCGADKSIYFRSAQ--QASDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVSGKQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISLIDFYSGECVAKMFGHSEIVTGMKFTYDCRHLITVSGDSCVFIWHLGPEITTCMKQHLLEINHQEQQQQPKD--QKWSGPPSQETYASTPSEI 790          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Mouse
Match: Wdr62 (WD repeat domain 62 [Source:MGI Symbol;Acc:MGI:1923696])

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 313/773 (40.49%), Postives = 466/773 (60.28%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNS-RSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDF--NANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWE-NDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPST-TGTVTPPRI 2739
            ++LEKV G T QN++ ++ DP +G VA+ AGCVVV  + K +KQ  I N  +  ++A+AF+ +GK + TGE+G  P VRIW VE  +Q+ E  GH Y V  +AFS N + +VS+G Q D  +NVW+   +  +AS+KV+ +VIA++FSE   +FVTVG RHVRFW+L+ S  +K  +T PL+GRS ILG+  NN F  V C                            T+ +S +G L QF E+R LDKW+ L+   ++CL V +  I  GC+ GI+ IF   SL ++  LP PHYLG+++ +  D+ F  +   E V YPD VA  +D VH  ++C Y DHSIY+WDV+D  + +K+ S L+HS  VW+VE       +++ L   +F+TCS D T+RFW+L  ++ T           +W+ N +S  L+K++Y +  ++ L   D +   ++   N   + +K G+R +++SPD QHLA+ DR GNL+ + L    E   + AH+ E+L ++Y +  +   + L  SASRDR+IHV++  +NY   QT+DDHS +I A K   T   +++++ISCG DKS+ FR  Q  ++     F+   H+  K + YDM I    +Y AV CQDR VR+YN VSGKQ+K Y+GS GD+G LLK  +DPSGT++ATS SDK IS+++F +GE +A + GHSE+  G+ F  D +HL++VS D C+F+W L  E+T  M + + E+         ++  +K + PPS  T   TP  I
Sbjct:   61 VTLEKVLGITAQNSSGLTCDPGTGHVAYLAGCVVVVLNPKENKQQHIFNTTRKSLSALAFSPDGKYIVTGENGHRPAVRIWDVEEKTQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMVLNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEASTEAKVTSTVPLVGRSGILGELHNNIFCGVAC--------------------GRGRMAGNTFCVSYSGLLCQFNEKRVLDKWINLKVSLSSCLCVSDELIFCGCTDGIVRIFQAHSLLYLTNLPKPHYLGVDVAHGLDSSFLFHRKAEAV-YPDTVALTFDPVHQWLSCVYKDHSIYIWDVKDIDEVSKIWSELFHSSFVWNVEVYPEFEDQRACLPSGTFLTCSSDNTIRFWNLDSASDT-----------RWQKNIFSDSLLKVVYVENDIQHL--QDLSHFPDRGSENGTPMDMKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELIKVEAHDAEVLCLEYSKPETG--VTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGT---RDVQMISCGADKSIYFRSAQ--QASDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVSGKQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISLIDFYSGECVAKMFGHSEIVTGMKFTYDCRHLITVSGDSCVFIWHLGPEITTCMKQHLLEINHQEQQQQPKD--QKWSGPPSQETYASTPSEI 790          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Mouse
Match: Wdr62 (WD repeat domain 62 [Source:MGI Symbol;Acc:MGI:1923696])

HSP 1 Score: 269.24 bits (687), Expect = 1.775e-73
Identity = 137/341 (40.18%), Postives = 212/341 (62.17%), Query Frame = 1
Query: 1690 QWE-NDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPS 2709
            +W+ N +S  L+K++Y +  ++ L   D +   ++   N   + +K G+R +++SPD QHLA+ DR GNL+ + L    E   + AH+ E+L ++Y +  +   + L  SASRDR+IHV++  +NY   QT+DDHS +I A K   T   +++++ISCG DKS+ FR  Q  ++     F+   H+  K + YDM I    +Y AV CQDR VR+YN VSGKQ+K Y+GS GD+G LLK  +DPSGT++ATS SDK IS+++F +GE +A + GHSE+  G+ F  D +HL++VS D C+F+W L  E+T  M + + E+         ++  +K + PPS
Sbjct:    4 RWQKNIFSDSLLKVVYVENDIQHL--QDLSHFPDRGSENGTPMDMKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELIKVEAHDAEVLCLEYSKPETG--VTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGT---RDVQMISCGADKSIYFRSAQ--QASDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVSGKQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISLIDFYSGECVAKMFGHSEIVTGMKFTYDCRHLITVSGDSCVFIWHLGPEITTCMKQHLLEINHQEQQQQPKD--QKWSGPPS 333          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q6DFF9|MABP1_XENLA (Mitogen-activated protein kinase-binding protein 1 OS=Xenopus laevis OX=8355 GN=mapkbp1 PE=2 SV=1)

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 327/744 (43.95%), Postives = 467/744 (62.77%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRS-KSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPV-SILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPD--LVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSA-QFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELR 2649
            ++LEKV G T+     +S DP +G+VA+PAGCVVV  + +++KQ  I N+ +  ITA+AF+ +GK L TGESG  P VR+W V   +Q+ E   H Y V  +AFS  S+++VSVG Q D  +NVW    N  +A++KV+SKV A++FSE   +FVT G RHV+FWYLD ++S K  +T PLLGRS +LG+  NN FTDV C                      S   S T+ I+ +G L +F +QR LDKWVELRT  A C+ V    I  GC+ G + IF+ ++L+ ++T+P PH LG+++   ++ +   ++    +YPD +A  +D  +  ++C YNDHS+YVWDV+D +K  KV S LYHS  VWS+E    I    ++ L   SFITCS D T+R W++  SN+  +        A   N  S DL+KII  D   ++L++ + NSA    +++  A+  K GIRS+ +SP+ QHLA+ DR G L+ + L +  E   + AH+ EIL ++Y    S PD  L L  SASRDR+IHV+D +++Y   QT+DDHS +I A K     ND ++++ISCG DKS+ FR    D+ G +A  F    H+V K + YDM + P+ +YAA+ CQDR +RI+N+ SGKQ+K Y+GS  +DG L+K   DPSG YIATS SDK +SI +F +GE +A++ GHSEV  G+ F  D KHL+SVS D C+F+W+L  EMT+ M +R+ E+R
Sbjct:   41 VTLEKVLGITVSAGRGLSCDPKTGLVAYPAGCVVVLLNPRKNKQQHILNSSRKTITALAFSPDGKFLVTGESGHMPAVRVWDVAERTQVAELQEHKYGVACVAFSPTSKYIVSVGYQHDMIVNVWSWKKNVVVAANKVSSKVTAVSFSEDSSYFVTAGNRHVKFWYLDEAKSSKVNSTIPLLGRSGLLGELRNNFFTDVAC--------------------GKSKKSSSTFCITSSGLLCEFNDQRLLDKWVELRTTVANCILVNHDYIFCGCADGTVRIFNPNNLHFLSTMPKPHCLGVDIATVTEASRLFSSAADAKYPDTIAMTFDPTNQWLSCVYNDHSLYVWDVKDLKKVGKVYSSLYHSSCVWSIEIYPEIKDSNQACLPPNSFITCSSDSTIRLWNMETSNIHGT--------ALHRNILSNDLMKIILIDDNTQALLDTEYNSAGLGDKADHQALDTKVGIRSVCVSPNGQHLASGDRTGTLRVHELQSMTELLKVEAHDSEILCLEY----SKPDTGLNLLASASRDRLIHVLDASKDYSLQQTLDDHSSSITAVKFA--ANDGKVQMISCGADKSIYFRT--ADKVGDAAVHFTRTHHIVRKTTLYDMDVDPSLKYAAIGCQDRNIRIFNISSGKQKKLYKGSQSEDGTLIKVQTDPSGLYIATSCSDKNLSIFDFYSGECVATMFGHSEVVTGMKFTNDCKHLISVSGDSCVFIWRLSSEMTINMRQRLAEVR 748          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q6NS57|MABP1_MOUSE (Mitogen-activated protein kinase-binding protein 1 OS=Mus musculus OX=10090 GN=Mapkbp1 PE=1 SV=1)

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 328/743 (44.15%), Postives = 467/743 (62.85%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSR-SKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPV-SILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPD--LVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELR 2649
            ++LEKV G T+     ++ DP SG+VA+ AGCVVV ++ ++ KQ  I N+ +  ITA+AF+ +GK L TGESG  P VR+W V   SQ+ E   H Y V  +AFS +++++VSVG Q D  +NVW    N  +AS+KV+S+V A++FSE   +FVT G RH++FWYLD+S+ SK  AT PLLGRS +LG+  NN FTDV C                            T+ I+ +G L +F+++R LDKWVELRT  A C++V +  I  GC+ G + +F+ S+L+ ++TLP PH LG ++ + ++ +   +     RYPD +A  +D  +  ++C YNDHSIYVWDVRD +K  KV S LYHS  VWSVE    I    ++ L  +SFITCS D T+R W+   S +   H  T +      N  S DLIKIIY D   ++L++ +        +++ + +  + GIRS+ ISP+ QHLA+ DR G L+ + L +  E   + AH+ EIL ++Y    S PD  L L  SASRDR+IHV+D  + Y   QT+D+HS +I A K   +  D ++R+ISCG DKS+ FR  Q  +SG+  QF    H+V K + YDM + P+ +Y A+ CQDR +RI+N+ SGKQ+K ++GS G+DG L+K   DPSG YIATS SDK +SI +F++GE +A++ GHSE+  G+ F  D KHL+SVS D CIFVW+L  EMT++M +R+ ELR
Sbjct:   40 VTLEKVLGVTVSGGRGLACDPRSGLVAYSAGCVVVLFNPRKHKQHHILNSSRKTITALAFSPDGKYLVTGESGHMPAVRVWDVAERSQVAELQEHKYGVACVAFSPSAKYIVSVGYQHDMIVNVWAWKKNIVVASNKVSSRVTAVSFSEDCSYFVTAGNRHIKFWYLDDSKTSKVNATVPLLGRSGLLGELRNNLFTDVAC--------------------GRGEKADSTFCITSSGLLCEFSDRRLLDKWVELRTTVAHCISVTQEYIFCGCADGTVRLFNPSNLHFLSTLPRPHALGTDIASITEASRLFSGGVNARYPDTIALTFDPTNQWLSCVYNDHSIYVWDVRDPKKVGKVYSALYHSSCVWSVEVYPEIKDSHQACLPPSSFITCSSDNTIRLWNTESSGV---HGSTLH-----RNILSNDLIKIIYVDGNTQALLDTELPGG---DKADGSLMDPRVGIRSVCISPNGQHLASGDRMGTLRIHELQSLSEMLKVEAHDSEILCLEY----SKPDTGLKLLASASRDRLIHVLDAGREYSLQQTLDEHSSSITAVKFAAS--DGQVRMISCGADKSIYFRTAQ--KSGEGVQFTRTHHVVRKTTLYDMDVEPSWKYTAIGCQDRNIRIFNISSGKQKKLFKGSQGEDGTLIKVQTDPSGIYIATSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLISVSGDSCIFVWRLSSEMTISMRQRLAELR 743          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. UniProt/SwissProt
Match: sp|O60336|MABP1_HUMAN (Mitogen-activated protein kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=MAPKBP1 PE=1 SV=4)

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 328/749 (43.79%), Postives = 468/749 (62.48%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSR-SKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELR------TPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPV-SILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPD--LVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELR 2649
            ++LEKV G T+     ++ DP SG+VA+PAGCVVV ++ ++ KQ  I N+ +  ITA+AF+ +GK L TGESG  P VR+W V  HSQ+ E   H Y V  +AFS +++++VSVG Q D  +NVW    N  +AS+KV+S+V A++FSE   +FVT G RH++FWYLD+S+ SK  AT PLLGRS +LG+  NN FTDV C                            T+ I+ +G L +F+++R LDKWVELR      T  A C++V +  I  GC+ G + +F+ S+L+ ++TLP PH LG ++ + ++ +   +     RYPD +A  +D  +  ++C YNDHSIYVWDVRD +K  KV S LYHS  VWSVE    +    ++ L  +SFITCS D T+R W+   S +   H  T +      N  S DLIKIIY D   ++L++ +        +++ + +  + GIRS+ +SP+ QHLA+ DR G L+ + L +  E   + AH+ EIL ++Y    S PD  L L  SASRDR+IHV+D  + Y   QT+D+HS +I A K   +  D ++R+ISCG DKS+ FR  Q  +SG   QF    H+V K + YDM + P+ +Y A+ CQDR +RI+N+ SGKQ+K ++GS G+DG L+K   DPSG YIATS SDK +SI +F++GE +A++ GHSE+  G+ F  D KHL+SVS D CIFVW+L  EMT++M +R+ ELR
Sbjct:   39 VTLEKVLGITVSGGRGLACDPRSGLVAYPAGCVVVLFNPRKHKQHHILNSSRKTITALAFSPDGKYLVTGESGHMPAVRVWDVAEHSQVAELQEHKYGVACVAFSPSAKYIVSVGYQHDMIVNVWAWKKNIVVASNKVSSRVTAVSFSEDCSYFVTAGNRHIKFWYLDDSKTSKVNATVPLLGRSGLLGELRNNLFTDVAC--------------------GRGKKADSTFCITSSGLLCEFSDRRLLDKWVELRNIDSFTTTVAHCISVSQDYIFCGCADGTVRLFNPSNLHFLSTLPRPHALGTDIASVTEASRLFSGVANARYPDTIALTFDPTNQWLSCVYNDHSIYVWDVRDPKKVGKVYSALYHSSCVWSVEVYPEVKDSNQACLPPSSFITCSSDNTIRLWNTESSGV---HGSTLH-----RNILSSDLIKIIYVDGNTQALLDTELPGG---DKADASLLDPRVGIRSVCVSPNGQHLASGDRMGTLRVHELQSLSEMLKVEAHDSEILCLEY----SKPDTGLKLLASASRDRLIHVLDAGREYSLQQTLDEHSSSITAVKFAAS--DGQVRMISCGADKSIYFRTAQ--KSGDGVQFTRTHHVVRKTTLYDMDVEPSWKYTAIGCQDRNIRIFNISSGKQKKLFKGSQGEDGTLIKVQTDPSGIYIATSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLISVSGDSCIFVWRLSSEMTISMRQRLAELR 748          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q8HXL3|WDR62_PIG (WD repeat-containing protein 62 OS=Sus scrofa OX=9823 GN=WDR62 PE=3 SV=1)

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 313/773 (40.49%), Postives = 458/773 (59.25%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLD-NSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDF--NANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWE-NDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRIS 2742
            +SLEKV G T QN++ ++ DP +G VA+ AGCVVV  + K +KQ  I N  +  ++A+AF+ +GK + TGE+G  P VRIW VE  +Q+ E  GH Y V  +AFS N + +VS+G Q D  +NVW+   +  +AS+KV+ +VIA++FSE   +FVTVG RHVRFW+L+ ++ +K   T PL+GRS ILG+  +N F  V C                            T+ +S +G L QF E+R L+KW+ L+   ++CL V +  I  GC+ GI+ IF   SL+++A LP PHYLG+++    +  F  +   E V YPD VA  +D  H  ++C Y DHSIY+WDV+D  K  K+ S L+HS  VW+VE       +++ L   SF+TCS D T+RFW+L             N  + W+ N +S  L+K++Y +  ++ L   D +   ++   N  AV +K G+R +++SPD QHLA+ DR GNL+ + L    E   + AH+ E+L ++Y +  +   L L  SASRDR+IHV++  +NY   QT+DDHS +I A K       ++I++ISCG DKS+ FR  Q  ++     F+   H+  K + YDM I    +Y AV CQDR VR+YN V+GKQ+K Y+GS GD+G LLK  +DPSGT++ATS SDK IS+++F +GE +A + GHSE+  G+ F  D +HL++VS D C+F+W L  E+T  M + + E+           D +    P   T T  P  IS
Sbjct:   60 VSLEKVLGITAQNSSGLTCDPGTGHVAYLAGCVVVILNPKENKQQHILNTARKSLSALAFSPDGKYIVTGENGHRPAVRIWDVEEKNQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMVLNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEVSTEAKVTGTVPLVGRSGILGELHDNVFCGVAC--------------------GRGQMAGSTFCVSYSGLLCQFNEKRVLEKWINLKVSLSSCLCVSQELIFCGCTDGIVRIFQAHSLHYLANLPKPHYLGVDVAQGLEPSFLFHRKAEAV-YPDTVALTFDPNHQWLSCVYKDHSIYIWDVKDINKVGKMWSELFHSSYVWNVEVYPEFEDQRACLPSGSFLTCSSDNTIRFWNLDS-----------NPDSHWQKNIFSDTLLKVVYVESDIQHL--QDMSHFPDRGSENGMAVDMKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELVRVEAHDAEVLCLEYSKPETG--LTLLASASRDRLIHVLNVEKNYSLEQTLDDHSSSITAVKFT---GSRDIQMISCGADKSIYFRSAQ--QASDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVNGKQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECVAKMFGHSEIITGMKFTYDCRHLITVSGDSCVFIWHLGPEITNCMKQHLLEIDQREQPQQNTKDGKWSRDPRQETCTSMPSEIS 791          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q3U3T8|WDR62_MOUSE (WD repeat-containing protein 62 OS=Mus musculus OX=10090 GN=Wdr62 PE=1 SV=2)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 313/773 (40.49%), Postives = 466/773 (60.28%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNS-RSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDF--NANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWE-NDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPST-TGTVTPPRI 2739
            ++LEKV G T QN++ ++ DP +G VA+ AGCVVV  + K +KQ  I N  +  ++A+AF+ +GK + TGE+G  P VRIW VE  +Q+ E  GH Y V  +AFS N + +VS+G Q D  +NVW+   +  +AS+KV+ +VIA++FSE   +FVTVG RHVRFW+L+ S  +K  +T PL+GRS ILG+  NN F  V C                            T+ +S +G L QF E+R LDKW+ L+   ++CL V +  I  GC+ GI+ IF   SL ++  LP PHYLG+++ +  D+ F  +   E V YPD VA  +D VH  ++C Y DHSIY+WDV+D  + +K+ S L+HS  VW+VE       +++ L   +F+TCS D T+RFW+L  ++ T           +W+ N +S  L+K++Y +  ++ L   D +   ++   N   + +K G+R +++SPD QHLA+ DR GNL+ + L    E   + AH+ E+L ++Y +  +   + L  SASRDR+IHV++  +NY   QT+DDHS +I A K   T   +++++ISCG DKS+ FR  Q  ++     F+   H+  K + YDM I    +Y AV CQDR VR+YN VSGKQ+K Y+GS GD+G LLK  +DPSGT++ATS SDK IS+++F +GE +A + GHSE+  G+ F  D +HL++VS D C+F+W L  E+T  M + + E+         ++  +K + PPS  T   TP  I
Sbjct:   60 VTLEKVLGITAQNSSGLTCDPGTGHVAYLAGCVVVVLNPKENKQQHIFNTTRKSLSALAFSPDGKYIVTGENGHRPTVRIWDVEEKTQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMVLNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEASTEAKVTSTVPLVGRSGILGELHNNIFCGVAC--------------------GRGRMAGNTFCVSYSGLLCQFNEKRVLDKWINLKVSLSSCLCVSDELIFCGCTDGIVRIFQAHSLLYLTNLPKPHYLGVDVAHGLDSSFLFHRKAEAV-YPDTVALTFDPVHQWLSCVYKDHSIYIWDVKDIDEVSKIWSELFHSSFVWNVEVYPEFEDQRACLPSGTFLTCSSDNTIRFWNLDSASDT-----------RWQKNIFSDSLLKVVYVENDIQHL--QDLSHFPDRGSENGTPMDMKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELIKVEAHDAEVLCLEYSKPETG--VTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGT---RDVQMISCGADKSIYFRSAQ--QASDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVSGKQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISLIDFYSGECVAKMFGHSEIVTGMKFTYDCRHLITVSGDSCVFIWHLGPEITTCMKQHLLEINHQEQQQQPKD--QKWSGPPSQETYASTPSEI 789          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. TrEMBL
Match: A0A1S3IB05 (WD repeat-containing protein 62 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106162032 PE=4 SV=1)

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 356/825 (43.15%), Postives = 510/825 (61.82%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSK-ATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINL---QNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQ--PDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEINMESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFN 2892
            ++LE+V G T+  NAA+++D  +G++A+PAGCVVV ++A++ KQ  I N  K  IT +AF  +GK LATGESG  P VR+W +E   Q+ EF GH + + ++ FS N +++VSVG+Q D  INVW   TNTK+AS+KV+SKV A+ FSE G  FVTVG RHV+FWYLD S+SK K  T PLLGRSAI+GD  NN F  V   C                           Y I+Q+G+L +F  +R LDKWVELRT KA CL+     I VGC+ G + IF   SL+ + ++P PHYLG+++   Q+PS      +N   RYPD +A +YD ++ ++TC Y+DHS+Y+WDVRD RK  K  S L+HS  +W +E   +       L   SF+TCS D+T+R W++ D ++T       N +    N YS +L+K++Y D  L  L + + N      ++ +     K+G+R++++SPD QHLA+ DR GN++ ++L N KE   I AH+GE+L ++Y   P+ P   L  SASRDR+IHV D    Y  +QT+DDHS +I A K  E  ND +I+++SC  DKS+LFR     PD      QF+L+ HLVGK + YDM + P N++A   CQDR VRIYN+ +GK +K Y+G+TGDDG L+K  +DPSGTY  TS SDK ++I +F TGE + S+ GHSE+A G+ F+ DLKH+++VS DGCIF+WK+  ++T  M++R+ +L  + +  +   D R   +P      + P R  +E +        ++   NS  +G      N   +RFSV  LP+WA+K+ +
Sbjct:   27 VTLERVLGLTVTTNAALAVDSKTGLIAYPAGCVVVLFNARKHKQSHIFNTCKKTITCLAFAGDGKHLATGESGHQPHVRVWDIEEKVQVAEFHGHKFGLQSVVFSPNLKYLVSVGTQHDMIINVWNWRTNTKVASNKVSSKVNAVGFSEDGSMFVTVGNRHVKFWYLDASKSKIKNETLPLLGRSAIIGDQKNNFFCGVAMGC--------------------GAMAGSVYAITQSGRLCEFNAKRLLDKWVELRTTKANCLSAGADYIFVGCADGTVRIFSAQSLHFVCSMPKPHYLGVDVTAGQDPSHMGVKPDN--ARYPDCIALEYDEMNKKVTCIYSDHSLYMWDVRDIRKIGKAWSALFHSSCIWGLEVYPVCN--NPALPPGSFMTCSSDDTIRVWNI-DPHMT-------NDTLYKRNIYSHELLKVLYVDKNLSFLCDKEYNPTGGADKT-DTTYDGKNGVRAVRVSPDGQHLASGDRTGNIRVHNLQNLKELCIIEAHDGEVLCLEYSTLPAGPR--LLASASRDRLIHVFDTRDQYNLVQTLDDHSSSITAVKFAE--NDGQIKMLSCAADKSVLFRTATQGPD---HELQFVLDHHLVGKTTLYDMDVDPCNKFAITACQDRNVRIYNIKTGKNKKCYKGATGDDGTLIKVQLDPSGTYACTSSSDKSLAIFDFYTGECMGSMFGHSEIATGVRFMNDLKHIITVSGDGCIFIWKVSSDLTQQMYQRLIDLGQLTTKYIPNGDNRSPASPRVEIENI-PER--DEGDFGPPPPEFLHPNVNSKTNG------NGVDYRFSVGQLPAWAKKQMS 802          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. TrEMBL
Match: A0A1S3I8T0 (mitogen-activated protein kinase-binding protein 1 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106162032 PE=4 SV=1)

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 356/825 (43.15%), Postives = 510/825 (61.82%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSK-ATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINL---QNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQ--PDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEINMESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFN 2892
            ++LE+V G T+  NAA+++D  +G++A+PAGCVVV ++A++ KQ  I N  K  IT +AF  +GK LATGESG  P VR+W +E   Q+ EF GH + + ++ FS N +++VSVG+Q D  INVW   TNTK+AS+KV+SKV A+ FSE G  FVTVG RHV+FWYLD S+SK K  T PLLGRSAI+GD  NN F  V   C                           Y I+Q+G+L +F  +R LDKWVELRT KA CL+     I VGC+ G + IF   SL+ + ++P PHYLG+++   Q+PS      +N   RYPD +A +YD ++ ++TC Y+DHS+Y+WDVRD RK  K  S L+HS  +W +E   +       L   SF+TCS D+T+R W++ D ++T       N +    N YS +L+K++Y D  L  L + + N      ++ +     K+G+R++++SPD QHLA+ DR GN++ ++L N KE   I AH+GE+L ++Y   P+ P   L  SASRDR+IHV D    Y  +QT+DDHS +I A K  E  ND +I+++SC  DKS+LFR     PD      QF+L+ HLVGK + YDM + P N++A   CQDR VRIYN+ +GK +K Y+G+TGDDG L+K  +DPSGTY  TS SDK ++I +F TGE + S+ GHSE+A G+ F+ DLKH+++VS DGCIF+WK+  ++T  M++R+ +L  + +  +   D R   +P      + P R  +E +        ++   NS  +G      N   +RFSV  LP+WA+K+ +
Sbjct:   27 VTLERVLGLTVTTNAALAVDSKTGLIAYPAGCVVVLFNARKHKQSHIFNTCKKTITCLAFAGDGKHLATGESGHQPHVRVWDIEEKVQVAEFHGHKFGLQSVVFSPNLKYLVSVGTQHDMIINVWNWRTNTKVASNKVSSKVNAVGFSEDGSMFVTVGNRHVKFWYLDASKSKIKNETLPLLGRSAIIGDQKNNFFCGVAMGC--------------------GAMAGSVYAITQSGRLCEFNAKRLLDKWVELRTTKANCLSAGADYIFVGCADGTVRIFSAQSLHFVCSMPKPHYLGVDVTAGQDPSHMGVKPDN--ARYPDCIALEYDEMNKKVTCIYSDHSLYMWDVRDIRKIGKAWSALFHSSCIWGLEVYPVCN--NPALPPGSFMTCSSDDTIRVWNI-DPHMT-------NDTLYKRNIYSHELLKVLYVDKNLSFLCDKEYNPTGGADKT-DTTYDGKNGVRAVRVSPDGQHLASGDRTGNIRVHNLQNLKELCIIEAHDGEVLCLEYSTLPAGPR--LLASASRDRLIHVFDTRDQYNLVQTLDDHSSSITAVKFAE--NDGQIKMLSCAADKSVLFRTATQGPD---HELQFVLDHHLVGKTTLYDMDVDPCNKFAITACQDRNVRIYNIKTGKNKKCYKGATGDDGTLIKVQLDPSGTYACTSSSDKSLAIFDFYTGECMGSMFGHSEIATGVRFMNDLKHIITVSGDGCIFIWKVSSDLTQQMYQRLIDLGQLTTKYIPNGDNRSPASPRVEIENI-PER--DEGDFGPPPPEFLHPNVNSKTNG------NGVDYRFSVGQLPAWAKKQMS 802          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. TrEMBL
Match: A0A1S3I9Q9 (mitogen-activated protein kinase-binding protein 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106162032 PE=4 SV=1)

HSP 1 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 356/825 (43.15%), Postives = 510/825 (61.82%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSK-ATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINL---QNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQ--PDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEINMESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFN 2892
            ++LE+V G T+  NAA+++D  +G++A+PAGCVVV ++A++ KQ  I N  K  IT +AF  +GK LATGESG  P VR+W +E   Q+ EF GH + + ++ FS N +++VSVG+Q D  INVW   TNTK+AS+KV+SKV A+ FSE G  FVTVG RHV+FWYLD S+SK K  T PLLGRSAI+GD  NN F  V   C                           Y I+Q+G+L +F  +R LDKWVELRT KA CL+     I VGC+ G + IF   SL+ + ++P PHYLG+++   Q+PS      +N   RYPD +A +YD ++ ++TC Y+DHS+Y+WDVRD RK  K  S L+HS  +W +E   +       L   SF+TCS D+T+R W++ D ++T       N +    N YS +L+K++Y D  L  L + + N      ++ +     K+G+R++++SPD QHLA+ DR GN++ ++L N KE   I AH+GE+L ++Y   P+ P   L  SASRDR+IHV D    Y  +QT+DDHS +I A K  E  ND +I+++SC  DKS+LFR     PD      QF+L+ HLVGK + YDM + P N++A   CQDR VRIYN+ +GK +K Y+G+TGDDG L+K  +DPSGTY  TS SDK ++I +F TGE + S+ GHSE+A G+ F+ DLKH+++VS DGCIF+WK+  ++T  M++R+ +L  + +  +   D R   +P      + P R  +E +        ++   NS  +G      N   +RFSV  LP+WA+K+ +
Sbjct:   27 VTLERVLGLTVTTNAALAVDSKTGLIAYPAGCVVVLFNARKHKQSHIFNTCKKTITCLAFAGDGKHLATGESGHQPHVRVWDIEEKVQVAEFHGHKFGLQSVVFSPNLKYLVSVGTQHDMIINVWNWRTNTKVASNKVSSKVNAVGFSEDGSMFVTVGNRHVKFWYLDASKSKIKNETLPLLGRSAIIGDQKNNFFCGVAMGC--------------------GAMAGSVYAITQSGRLCEFNAKRLLDKWVELRTTKANCLSAGADYIFVGCADGTVRIFSAQSLHFVCSMPKPHYLGVDVTAGQDPSHMGVKPDN--ARYPDCIALEYDEMNKKVTCIYSDHSLYMWDVRDIRKIGKAWSALFHSSCIWGLEVYPVCN--NPALPPGSFMTCSSDDTIRVWNI-DPHMT-------NDTLYKRNIYSHELLKVLYVDKNLSFLCDKEYNPTGGADKT-DTTYDGKNGVRAVRVSPDGQHLASGDRTGNIRVHNLQNLKELCIIEAHDGEVLCLEYSTLPAGPR--LLASASRDRLIHVFDTRDQYNLVQTLDDHSSSITAVKFAE--NDGQIKMLSCAADKSVLFRTATQGPD---HELQFVLDHHLVGKTTLYDMDVDPCNKFAITACQDRNVRIYNIKTGKNKKCYKGATGDDGTLIKVQLDPSGTYACTSSSDKSLAIFDFYTGECMGSMFGHSEIATGVRFMNDLKHIITVSGDGCIFIWKVSSDLTQQMYQRLIDLGQLTTKYIPNGDNRSPASPRVEIENI-PER--DEGDFGPPPPEFLHPNVNSKTNG------NGVDYRFSVGQLPAWAKKQMS 802          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. TrEMBL
Match: A0A3R7G709 (Mitogen-activated protein kinase-binding protein 1 (Fragment) OS=Clonorchis sinensis OX=79923 GN=mapkbp1 PE=4 SV=1)

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 364/831 (43.80%), Postives = 508/831 (61.13%), Query Frame = 1
Query:  442 LEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQ------NPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVS----ILTKEK---------------SLLDVTSFITCSDDETVRFWHLS------DSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHG---------------------------------------------IRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPN-------------NRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSIS 2667
            LE+V GFT  NN A+SLD  SG +A+ AGCV+V  +    +Q FI +A K  ITA+ F+ +GK +ATGESG  P VR+W+V   S L EF+GH++RV A+ FS +SR++VS+GSQ+D ++ VW+     ++AS+KVT+K+  +AFS  GQFFVTVGVRHVRFWYL+  R+++K T PL GR+AILGD ++N F DV  CC++  S      S   SS      +  T V+S+AG LMQF++QRYLDKWVELRT +A+CL+V  S + VGC+ G  L+FDT SL  +A LP+PH LG           P+       + P  YPD++A K D   SR+TCFY DHS+Y+WDV D     +  ++ YHS GVWSV+ +S       KE+               +    ++F+TC+DD T+RFW+++      DS++T S     ++         + L++II+TDP  K L  +DR +A       EA V    G                                             +R++ ISPD +HLAA DR+G L+ YSL+N ++   I AH+ EILS+++F+S S P+L L CSASRDR+IH+ DP Q Y  +QT+ DHS AIFAA+++ET +D EIRLISCGMDKSLL R+L+PDE+G +A F L  HLVG+ SQ D    P               RY AV CQDR++RIYN+ +G+Q + YRGS  +DG L++C IDP+G+ +ATSGSDK +++    +GE +A + GHSE+A+GL FL DL+HLV+VS+D C+F+W+L  ++T  +  R    R  +S S
Sbjct:  123 LERVLGFTSANNCALSLDQASGAIAYAAGCVIVLRTLDPDRQRFIQSASKKAITAVDFSPDGKFIATGESGHHPMVRLWNVSDGSHLAEFAGHHFRVIAVRFSPSSRYLVSLGSQDDNTVYVWDRTGGQRVASAKVTNKINGVAFSPNGQFFVTVGVRHVRFWYLEIKRTRNKETIPLNGRNAILGDLLHNAFMDV--CCVS-RSSCSAQRSDAASSGCPEGGEILTLVVSKAGHLMQFSDQRYLDKWVELRTSRASCLSVHRSWVTVGCANGTCLLFDTESLQFLAQLPLPHQLGSEAHLSFSPVTPAPVSSEQTDSPT-YPDLLAIKLDCTRSRVTCFYADHSVYIWDVTDLSDVQRAAAYFYHSRGVWSVDCLSESCQRTGKERIPQFNSKSVGPSSPPTWWSDSTFVTCADDGTIRFWNVTDELDQNDSDMTTSLIGEADLVKSGVPRSKEQLMRIIFTDPTHKLLCVSDRPTAELTFAKFEAGVGPIGGPSPTSSFGGQLDSAAPSPSSPTAPSLSEASLVNRSNCTLAPSGCCVRAVCISPDCRHLAAGDRDGILRIYSLANLEQQCQITAHDSEILSLNFFRSDSVPELTLLCSASRDRLIHIFDPNQEYSLVQTVADHSAAIFAARIIETEDDGEIRLISCGMDKSLLIRVLEPDEAGLTAHFALEHHLVGRCSQLDAAFTPTVTTYTSDNKPGKRKRYLAVACQDRRLRIYNIATGRQIRCYRGSFNEDGCLVRCAIDPTGSVVATSGSDKQLNLFYLLSGESIAPLFGHSELALGLRFLPDLRHLVTVSADSCVFIWRLATDLTQHLSDRSAVTRRTSSCS 949          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. TrEMBL
Match: A0A4S2M9D0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001704 PE=4 SV=1)

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 360/831 (43.32%), Postives = 505/831 (60.77%), Query Frame = 1
Query:  442 LEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQ------NPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVS----ILTKEK---------------SLLDVTSFITCSDDETVRFWHLS------DSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHG---------------------------------------------IRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPN-------------NRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSIS 2667
            LE+V GFT  NN A+SLD  SG +A+ AGCV+V  +    +Q FI +A K  ITA+ F+ +GK +ATGESG  P VR+W+V   S L EF+GH++RV A+ FS ++R++VS+GSQ+D ++ VW+     ++AS+KVT+K+  +AFS  GQFFVTVGVRHVRFWYL+  R+++K T PL GR+AILGD ++N F DV  CC++  S      S   S       +  T V+S+AG LMQF++QRYLDKWVELRT +A+CL+V  S + VGC+ G  L+FDT SL  +A LP+PH LG           P+       +  + YPD++A K D   SR+TCFY DHS+YVWDV D     +  ++ YHS GVWSV+ +S       KE+               +    ++F+TC+DD T+RFW+++      DS++T S     ++         + L++II+ DP  K L  +DR +A       EA V    G                                             +R++ ISPD +HLAA DR+G L+ YSL+N ++   I AH+ EILS+++F+S S P+L L CSASRDR+IH+ DP Q Y  +QT+ DHS AIFAA+++ET  D EIRLISCGMDKSLL R+L+PDE+G +A F L  HLVG+ SQ D    P               RY AV CQDR++RIYN+ +G+Q + YRGS  +DG L++C IDP+G+ +ATSGSDK +++    +GE +A + GHSE+A+GL FL DL+H V+VS+D C+F+W+L  ++T  + +R    R  +S S
Sbjct:   25 LERVLGFTSANNCALSLDQASGAIAYAAGCVIVLRTLDPDRQRFIQSASKKAITAVDFSPDGKFIATGESGHHPMVRLWNVSDGSHLAEFAGHHFRVIAVRFSPSARYLVSLGSQDDNTVYVWDRTGGQRVASAKVTNKINGVAFSPNGQFFVTVGVRHVRFWYLEIKRTRNKETIPLNGRNAILGDLLHNAFMDV--CCVS-RSSCSAHRSDAASLGCPEGGEILTLVVSKAGHLMQFSDQRYLDKWVELRTSRASCLSVHRSWVTVGCANGTCLLFDTESLQFLAQLPLPHQLGSEAHLSFYPVTPAPVSSEQTDSSM-YPDLLAIKLDCTRSRVTCFYADHSVYVWDVTDLSDVQRAAAYFYHSRGVWSVDCLSESCQRTGKERIPQFNSKLVGPSYPPTWWSDSTFVTCADDGTIRFWNVTEELGQNDSDMTTSLIGEADLVKSGVPRAKEQLMRIIFADPTHKLLCVSDRPTAELTFAKFEAGVGPIGGPSPSSSFGGQLDSAAPSPSSPTAPSLSEASLVNRSNCTLTPSGCCVRAVCISPDCRHLAAGDRDGILRIYSLANLEQQCQITAHDSEILSLNFFRSDSVPELTLLCSASRDRLIHIFDPNQEYSLVQTVADHSAAIFAARIIETEYDGEIRLISCGMDKSLLIRVLEPDEAGLTAHFALEHHLVGRCSQLDAAFTPTVTTYTSDNKPGKRKRYLAVACQDRRLRIYNIATGRQIRCYRGSFNEDGCLVRCAIDPTGSVVATSGSDKQLNLFYLLSGESIAPLFGHSELALGLRFLPDLRHFVTVSADSCVFIWRLATDLTQHLSERSAVTRRTSSCS 851          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Cavefish
Match: mapkbp1 (mitogen-activated protein kinase-binding protein 1 [Source:NCBI gene;Acc:103030470])

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 333/771 (43.19%), Postives = 471/771 (61.09%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRS-KSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSL-LDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSI----SLTENDIRKDTAPPSTTGTVT 2727
            ++LEKV G T   N  ++ DP SG+VA+PAGCVVV  + K++KQ  I N+ K  IT +AF+ +GK + TGESG  P VR+W V   +Q+ E   H Y V  +AFS NS+++VSVG Q D  +NVW    N  +A++KV+SKV A++FS+   +FVT G RHV+FWYLD+ +S K  AT PLLGRS +LG+  NN F+DV C                          + T+ I+ +G L +F ++R LDKWVELRT  AT L+V E  I  GC+ G +  F   +L+ I TLP PH LG ++   ++ +   A N   RYPD VA  YD  +  ++C YNDHS+YVWD RD RK  KV S LYHS  VWSVE     ++++ L L   SF++CS D T+R W+      T  HS T N      N  S DL KIIY +  + +L++ D   + N  +++      + GIR++ +SPD QHLA+ DR G L+ + + + +E  ++ AH+ EIL ++Y +  +   L L  +ASRDR+IHV+D  + Y  +QT+D+HS +I A +     ND +IR+ISCG DKS+ FR  Q  + G +  F    H+V K + YDM I P   YAA+ CQDR +RI+N+ +GKQ+K Y+GS G+DG L+K  +DPSG Y+ATS SDK ISI +F +GE +A++ GHSE+  G+ F  D KHL+SVS D CIFVW+L  E+T+ M +R+ EL+  N        +++ IRK+       GT++
Sbjct:   39 VTLEKVLGITSAGNRGLACDPRSGLVAYPAGCVVVLLNPKKNKQHHILNSSKKTITTVAFSPDGKYVVTGESGHMPAVRVWDVAERTQVAELQEHKYGVACVAFSPNSKYIVSVGYQHDMIVNVWAWKKNVVVAANKVSSKVTAVSFSDDSSYFVTAGNRHVKFWYLDHDKSSKVNATVPLLGRSGLLGELRNNFFSDVAC--------------------GKGRKAASTFCITSSGLLCEFNDKRLLDKWVELRTGLATSLSVTEDLIFCGCADGTVRAFSPINLHFICTLPRPHSLGTDIATVTEASHLFAYNVDARYPDTVAVSYDPTNRWLSCVYNDHSLYVWDARDLRKVGKVYSALYHSSCVWSVEMYPENSEQEQLCLSPGSFLSCSSDNTIRLWN------TDMHSTTIN-----RNVISNDLQKIIYMEDYITTLLDTDCTISSNSEKADPQTSDNRTGIRTMCVSPDGQHLASGDRNGTLRIHEMQSMEEILNVQAHDSEILCLEYSKPETG--LRLLATASRDRLIHVLDAEREYGLLQTLDEHSSSITAVRFAA--NDGKIRMISCGADKSIYFRTAQKTDEGTT--FTRTHHIVRKTTLYDMDIDPTRNYAAIGCQDRSIRIFNISNGKQKKLYKGSQGEDGTLIKVQMDPSGLYVATSCSDKNISIFDFYSGECVATMFGHSELVTGMKFTNDCKHLISVSGDSCIFVWRLNPELTIKMRQRLSELKQKNKPVQKSPPSKHHIRKEVYSAPAIGTMS 772          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Cavefish
Match: mapkbp1 (mitogen-activated protein kinase-binding protein 1 [Source:NCBI gene;Acc:103030470])

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 333/777 (42.86%), Postives = 471/777 (60.62%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRS-KSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELR------TPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSL-LDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSI----SLTENDIRKDTAPPSTTGTVT 2727
            ++LEKV G T   N  ++ DP SG+VA+PAGCVVV  + K++KQ  I N+ K  IT +AF+ +GK + TGESG  P VR+W V   +Q+ E   H Y V  +AFS NS+++VSVG Q D  +NVW    N  +A++KV+SKV A++FS+   +FVT G RHV+FWYLD+ +S K  AT PLLGRS +LG+  NN F+DV C                          + T+ I+ +G L +F ++R LDKWVELR      T  AT L+V E  I  GC+ G +  F   +L+ I TLP PH LG ++   ++ +   A N   RYPD VA  YD  +  ++C YNDHS+YVWD RD RK  KV S LYHS  VWSVE     ++++ L L   SF++CS D T+R W+      T  HS T N      N  S DL KIIY +  + +L++ D   + N  +++      + GIR++ +SPD QHLA+ DR G L+ + + + +E  ++ AH+ EIL ++Y +  +   L L  +ASRDR+IHV+D  + Y  +QT+D+HS +I A +     ND +IR+ISCG DKS+ FR  Q  + G +  F    H+V K + YDM I P   YAA+ CQDR +RI+N+ +GKQ+K Y+GS G+DG L+K  +DPSG Y+ATS SDK ISI +F +GE +A++ GHSE+  G+ F  D KHL+SVS D CIFVW+L  E+T+ M +R+ EL+  N        +++ IRK+       GT++
Sbjct:   39 VTLEKVLGITSAGNRGLACDPRSGLVAYPAGCVVVLLNPKKNKQHHILNSSKKTITTVAFSPDGKYVVTGESGHMPAVRVWDVAERTQVAELQEHKYGVACVAFSPNSKYIVSVGYQHDMIVNVWAWKKNVVVAANKVSSKVTAVSFSDDSSYFVTAGNRHVKFWYLDHDKSSKVNATVPLLGRSGLLGELRNNFFSDVAC--------------------GKGRKAASTFCITSSGLLCEFNDKRLLDKWVELRKNDSITTGLATSLSVTEDLIFCGCADGTVRAFSPINLHFICTLPRPHSLGTDIATVTEASHLFAYNVDARYPDTVAVSYDPTNRWLSCVYNDHSLYVWDARDLRKVGKVYSALYHSSCVWSVEMYPENSEQEQLCLSPGSFLSCSSDNTIRLWN------TDMHSTTIN-----RNVISNDLQKIIYMEDYITTLLDTDCTISSNSEKADPQTSDNRTGIRTMCVSPDGQHLASGDRNGTLRIHEMQSMEEILNVQAHDSEILCLEYSKPETG--LRLLATASRDRLIHVLDAEREYGLLQTLDEHSSSITAVRFAA--NDGKIRMISCGADKSIYFRTAQKTDEGTT--FTRTHHIVRKTTLYDMDIDPTRNYAAIGCQDRSIRIFNISNGKQKKLYKGSQGEDGTLIKVQMDPSGLYVATSCSDKNISIFDFYSGECVATMFGHSELVTGMKFTNDCKHLISVSGDSCIFVWRLNPELTIKMRQRLSELKQKNKPVQKSPPSKHHIRKEVYSAPAIGTMS 778          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000006286.2 (mitogen-activated protein kinase-binding protein 1-like [Source:NCBI gene;Acc:103025404])

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 316/755 (41.85%), Postives = 457/755 (60.53%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLD--NSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEP-VRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVE--PVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDI 2685
            ++LE+V G T   ++ ++ DP SG VA+PAGCVVV  + K+++Q  I N  +  IT +AF+ +GK L TGESG  P VR+W     SQ+ E   H Y V  +AFS NS+++VSVG Q D S+NVW    NT +A++KV+SKV A++FSE   +FVT G RHVRFWYL+  NS  +  A  PLLGRS +LG+  NN F DV C                            T+ I+ +G L +F  +R LDKW++LRT +A  L+V E  I   C+ G + +F    LN I TLP PH+LG ++   +      +++P  RYPD VA  YD V+  ++C YNDHS+YVW+VRD ++  +V S LYHS  VW ++  P S   +        +F +CS D TVR W       T +HS   +      N  S DL+K+IY D   ++ +E + + +    +    A   + GIRSI +SPD +HLA+ DR G L+ + LSN +E   + AH+ EIL ++Y +  +   + LF +A RDR+IHV+D  ++YK +QT+D+HS +I A +   T N+ ++R+ISCG DKSL FR      + +  +F    H+V K + YDM + P  +YAAV CQDR +R++N+ SGKQ+KS++GS  +DG LLK  +DPSG Y+ATS SDK IS+L+F+TGE LA++ GHSE+   + F  D +HL+SVS D CIF+W+L  E+T+ M  R+++L+   S   + N +
Sbjct:   41 VTLERVLGITTSGSSGLTCDPYSGTVAYPAGCVVVLLNPKKNRQQHIINTSRKTITTLAFSSDGKYLVTGESGHLPAVRVWDAAEGSQVVELQEHKYGVACVAFSPNSKYIVSVGYQHDMSVNVWAWKKNTLVATNKVSSKVTAVSFSEDSSYFVTAGNRHVRFWYLEPCNSNKQPTAPVPLLGRSGLLGELQNNFFCDVAC--------------------GHGKKSESTFCITSSGLLCEFNAKRMLDKWIDLRTSRACSLSVTEGLIFCACADGTVRVFSPFDLNFICTLPHPHHLGTDVAAVTQASHVFSSKPDSRYPDPVALTYDPVNLWLSCVYNDHSLYVWNVRDLQRVGRVHSALYHSDCVWDLQIYPKSQDRQPTEHTPAGAFFSCSADNTVRMWS------TEAHSIPTSA-----NALSSDLLKVIYIDNNTETSLETEGSVSNGTEKPEGLASESRTGIRSICVSPDGKHLASGDRAGTLRVHDLSNMEEILKVEAHDSEILCLEYSKPETG--IQLFATAGRDRLIHVLDVEEDYKLLQTLDEHSSSITAVRF--TANEGKVRMISCGADKSLYFRTAH--RAFRGVKFKRTHHVVRKSTLYDMDVDPTCKYAAVACQDRSIRVFNISSGKQKKSFKGSQAEDGGLLKVQVDPSGLYVATSCSDKNISLLDFSTGECLATMFGHSEIITSIKFTSDCRHLISVSGDSCIFIWRLAPELTINMRHRLEQLKHCQSSPASTNSV 758          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Cavefish
Match: wdr62 (WD repeat domain 62 [Source:ZFIN;Acc:ZDB-GENE-060503-291])

HSP 1 Score: 570.466 bits (1469), Expect = 4.435e-175
Identity = 308/773 (39.84%), Postives = 444/773 (57.44%), Query Frame = 1
Query:  442 LEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKS-KATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEP-VRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPG---LKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDG----------CIFVWKLPVEMTLTMHKRMQEL------RSINSISLTENDIRKDT 2697
            LEKV G T  +++ ++ DP +G VA+PAGCV+V  + K++KQ  I N  +   +A+AF+  GK L TGESG  P VR+W V   +Q+ E   H Y V  +AFS    ++VSVG Q D +++VWE    T +AS+KV+S+V+A++FSE   +FVT G RHV+FWYLD S+ +   +T PL+GRS +LG+  N+ F D+ C                       T  S TY I+  G L QF   R LD WV+L+T  A CL+V E+ I  GC+ G + +F   +L+++ TL  PH LG+++           + P   YPD +A  +D V   +TC YNDHS+YVWDV D     KV S LYHSG VWSVE    L    + L   SF+TCS D T+R W     N     S+ +N S    + YS+DL++I+Y D     LK+L E             E ++  K GIR + ISPD QHLAA DR GNL+ + L    E   I AH+ E+L + +  SP+     L  SASRDR+IH+ +   NY  +QT+ DHS ++ A K   T    ++ ++SCG DKS+ FR    ++S  S  F  + H+V K + YDM +   + + A+ CQDR +R+YN+ SGK +K ++GS  DDG L K  +DPSGT++ATS SDK I I ++ +GE +A++ GHSE+  G+ F  D +HL++V  D           C+FVW+L  +MT +M KR+ +       R++N ++  +  IR++T
Sbjct:   55 LEKVLGITTSSSSGLACDPHTGSVAYPAGCVIVILNPKKNKQTHIFNTSRKTFSALAFSHNGKYLVTGESGHMPCVRVWDVAERTQVAEVQCHKYGVACVAFSTTGSYIVSVGYQHDRTVSVWEWKRGTVIASNKVSSRVLAVSFSEDSSYFVTAGNRHVKFWYLDASKERRVNSTVPLIGRSGLLGEHQNSEFCDLAC--------------------GRGTMASSTYCITHTGLLCQFNSNRQLDLWVDLKTTSARCLSVSEAFIFCGCADGTVRVFSPQNLHYVTTLHRPHCLGVDVSQSIQTGHLFKSLPDAEYPDTLALTHDPVSGHLTCVYNDHSVYVWDVHDISNVGKVYSALYHSGCVWSVETYPELENSAATLLPGSFLTCSSDNTIRLW-----NSEFQQSRNQN-SDLRHSLYSQDLVRIVYVDKDTGHLKALAE-----------RGEGSMDGKFGIRVLGISPDGQHLAAGDRSGNLRIFDLQFMDEVLKIEAHDSEVLCLAF--SPAETGFQLLASASRDRLIHIFNMESNYSLVQTVYDHSASVTAMKF--TGVGSKVCMVSCGADKSIYFR--SAEKSSNSVAFSRSHHVVEKSTLYDMDLDATSTHTAIACQDRNIRVYNVKSGKMKKCFKGSATDDGTLFKVQLDPSGTFLATSCSDKSICIFDYESGECVATLFGHSEIVTGMKFSQDCRHLITVCGDRYTSHSLFMKFCVFVWRLCSQMTNSMKKRLADRKRRAGQRNMNRVTSKDQVIRRET 784          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Cavefish
Match: cfap52 (cilia and flagella associated protein 52 [Source:NCBI gene;Acc:103047323])

HSP 1 Score: 81.2629 bits (199), Expect = 5.331e-15
Identity = 52/191 (27.23%), Postives = 91/191 (47.64%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGE---SGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKM----ASSKVTSKVIAIAF-SEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGR 984
            L LE V GF     + +   P    V +P GC ++  +    KQ F+H    + ++ +  ++ G+ +A+G+    G    V +W         +   H  +V ALAFS N +F+V++G Q+D SI VW++     +    AS+ +    + +AF S +   F++ G   +R W LD++  K   T    G+
Sbjct:   11 LELEAVIGFNGHVLSGLQSHPDREHVIYPLGCTLIIKNLNSGKQSFLHGHTNN-VSCLTVSKSGRYIASGQVTFMGFKADVIVWDYSKREIYAQLILHKVKVEALAFSPNEKFLVTLGGQDDGSIVVWDVEKKEAICGSPASTDMAGHCLTVAFSSHSDNIFISAGNNTLRVWELDHTNRKIHPTQCQTGK 200          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Sea Lamprey
Match: mapkbp1 (mitogen-activated protein kinase binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-120207-1])

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 314/745 (42.15%), Postives = 448/745 (60.13%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSR-SKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQ---NPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFR---KPAKVVSHLYHSGGVWSVEPVSILTKEK-SLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQEL 2646
            L+LEKV G T+ +++ +  DP +G+VA+PAGC VV ++ K+ KQ  I NA + PIT +AF+ +GK L TGESG  P VR+W +   +Q+ EF  H Y +  +AFS N ++VVSVG Q D  +NVW+      +A +KV+SKV A++FS    +FVTVG RHVRFWYLD S+ SK+  T PLLGRS +LG   NN F DV C                          S TY I+ +G L +F ++R L+K+V+L+TP A+C+ V E  I  GC+ G++ +F    L ++A LP PH LG+++     PS      +    R+PD VA  YD  ++ +TC YNDHS+Y WDVRD R   +  KV S LYHS  +W VE   +L +   + L   SF+TCS D T+R W +     T +     N+       YS +L+K++Y D  L+SL + D N A +  +++      K GIR++ +SPD QHLA+ DR G ++ + L    E   I AH+ E+L ++Y Q  +   + L  SASRDR+IHV+D   NY   QT+DDHS +I A K +     +++ ++SCG DKS+ FR       G   +F    H+V K + YDM +    +YA V CQDR VRI+++ SGKQ+K Y+GS G DG L+K  +DPSG Y+ATS SDK +++ +F TGE +AS  GHSE+  G+ F  D KHL+SVS D C+F+W+LP ++T  M +R+ E+
Sbjct:    1 LALEKVLGITLSSSSGLCCDPKTGLVAYPAGCTVVIFNPKKGKQTHIFNASRKPITTLAFSPDGKYLVTGESGHMPAVRVWDLADRTQVSEFQRHKYGISCVAFSPNVKYVVSVGYQHDMMVNVWDWRKGALIAFNKVSSKVTAVSFSSDNSYFVTVGNRHVRFWYLDASKASKANLTVPLLGRSGLLGVQRNNFFCDVAC--------------------GRGRMSSSTYCITFSGLLCEFNDKRMLEKFVDLKTPMASCIYVSEELIFCGCANGVVCVFGAEDLRNVAILPRPHCLGVDVALGVQPSH--LFGSKLDARFPDTVALTYDSSNAWLTCVYNDHSLYTWDVRDARHGKRFGKVYSALYHSSCIWGVEVYPVLEESSPACLPPGSFLTCSSDSTIRVWSIDAPAATHAPPFHRNV-------YSNELLKVMYCDESLQSLQDLDYNPAGSTDKTDHTLTEAKLGIRALCVSPDGQHLASGDRIGTVRIHDLQFLDEVMQIDAHDSEVLCLEYSQPETG--VKLLASASRDRLIHVLDVEDNYDLTQTLDDHSSSITAVKFIG--GAEQLNMVSCGADKSIYFRTAMKSPDG--LRFSRVHHVVAKATLYDMDVDATGKYAVVGCQDRNVRIFDVSSGKQKKCYKGSQGKDGSLIKLQMDPSGMYVATSCSDKNLTLFDFYTGECVASAFGHSEIVTGMKFSHDCKHLISVSGDSCMFLWRLPSDLTSVMQRRLGEM 710          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007278.1 (pep scaffold:Pmarinus_7.0:GL476503:8:51230:-1 gene:ENSPMAG00000006561.1 transcript:ENSPMAT00000007278.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 464.151 bits (1193), Expect = 2.215e-146
Identity = 253/619 (40.87%), Postives = 364/619 (58.80%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSR-SKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQ-NPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVE--PVSILTKEKSLLDVTSFITCSDDETVRFWHLS-DSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPD--LVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDM 2271
            ++LEKV G T+ +++ ++ +P SG++A+PAGCVVV  + K++KQ  I NA +  ITA+AF+ +GK L TGESG  P VR+W V   SQ++EF GH Y V  + FS N +++VSVG   D  +NVW+       A++KV+SKV A++FS     FVTVG RHV+FWY+D S+ SK   T PL GRS +LG+  NN F  V C                            T+ I+++G L QF E+R L+KWV+L    A+CL+V E  I  GCS G++ +F+  +LN +AT+P PH LG+++             E  RYPD VA  +D  +  ++C YNDHS+YVWD RD RK  KV S LYH   VW VE  P        + L   +F TCS D TVR W+L  D +   + +  +NI       YS DL+K++Y D  L+SL +++ N A +  +++ A+   K GIR++ +SPD QHLA+ DR GNL+ Y L    E   I AH  E++ ++Y    S PD  + L  +ASRDR+IHV++  + Y   QT+D+HS A+ A K     +  +++L+SCG DKS+ FR    +++    QF    H+VGK ++YDM
Sbjct:   41 VTLEKVLGITVTSSSGLACEPKSGLLAYPAGCVVVLLNPKKNKQSHILNASRKTITAVAFSPDGKYLVTGESGHMPAVRVWDVAEGSQVYEFQGHKYGVACVVFSPNMKYIVSVGHHHDMIVNVWDWKRRVLAATNKVSSKVSAVSFSADSSTFVTVGNRHVKFWYIDASKTSKVNWTVPLNGRSGLLGEQQNNLFLAVAC--------------------GRGRKADATFCITRSGLLCQFNERRLLEKWVDLGASSASCLSVSEELIFCGCSDGLVRVFNPENLNIVATIPRPHCLGVDVALGVEPGHLFTRREDARYPDTVALTFDPTNRWLSCVYNDHSLYVWDARDVRKVGKVFSALYHGTCVWGVEVYPEVDRGPVAACLPPGTFATCSSDNTVRLWNLQRDPSPLGTAALPQNI-------YSSDLLKVLYVDGNLQSLQDSENNPAGSSDKADPASADAKTGIRTLCVSPDGQHLASGDRTGNLRIYDLHFLAEQMKIEAHETEVMCLEY----STPDTGVKLLATASRDRLIHVLNAERGYSLEQTLDEHSSAVTAVKFSGIGD--QLQLVSCGSDKSIYFR--NAEKTADGVQF-SRHHVVGKTTKYDM 623          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009467.1 (pep scaffold:Pmarinus_7.0:GL478507:38111:45670:1 gene:ENSPMAG00000008564.1 transcript:ENSPMAT00000009467.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.853 bits (551), Expect = 1.515e-62
Identity = 138/374 (36.90%), Postives = 192/374 (51.34%), Query Frame = 1
Query:  442 LEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSV----ETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKAT-TPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVV-SHLYHSGGVWSVE 1545
            LE V G T    AA   DPTSGIVA+ AGCVVV       +Q  I N  + PITA+AF+ +G  LATGE+G +P + +W +    E  S      GH + V   AFS + R +VSVG + D ++N+W+  +   +A++KV+S V+A+AFS  G   VT GVRHVRFWYL   R ++     PL GR+A+LG      F  V C                         Q+ TY ++ +G L  F EQR L   V+L+   A CL V E  +  G + G+++     SL  + TLP P +L   L+ P  +     +EP   P  VA   D   + + C Y D S+YVW      +PA+ + +  YH+GGV  VE
Sbjct:    1 LEVVLGVT-AGPAAFGCDPTSGIVAYAAGCVVVLLDPSTGEQRHIINPARKPITALAFSPDGAHLATGEAGAAPCICVWRLLLQGEWSSAAVLGVGHQHGVACTAFSPDGRLLVSVGRRHDQAVNLWDWKSGHLVATNKVSSHVLALAFSSCGSRLVTAGVRHVRFWYLPPPRDQAAINGAPLPGRAALLGLQREAVFCAVAC-------------------GQGPACQNLTYCLTLSGCLCVFDEQRILCHCVDLQVSVAKCLCVDEELVFCGGANGLVVGLCARSLRPVCTLPRPSHLD-GLKRPWQSGEQQQDEPA--PCAVAVCRDARRTWLGCLYGDRSVYVWADASPGQPARPLHAAHYHAGGVRGVE 351          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Sea Lamprey
Match: cfap52 (cilia and flagella associated protein 52 [Source:ZFIN;Acc:ZDB-GENE-050522-296])

HSP 1 Score: 74.7146 bits (182), Expect = 1.162e-13
Identity = 51/185 (27.57%), Postives = 85/185 (45.95%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGE---SGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIA----IAFSEAGQF-FVTVGVRHVRFWYLDNSRSKSKAT 966
            L LE V GF  Q  + +   P    + +P GC VV  S K ++Q F+H    + ++ +A +  G  +A+G+    G    V +W+ E        + H  +V ALAFS N  ++ S+G Q+D S+ +W +     +  + V+         + F+      F+T G   +R W LD    K + T
Sbjct:   14 LELESVIGFNGQVPSGLVSHPDCEHLLYPLGCTVVIRSLKGARQSFLHGHTNN-VSCLAVSNSGHYVASGQVTYMGFKADVILWNFEKRELHARLTLHKVKVEALAFSPNDLYLASLGGQDDGSVVIWNVTKKEAVCGNAVSLPTAGTTNTVRFTNTSDLSFITAGNDTIRVWQLDIPNRKIRPT 197          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Sea Lamprey
Match: taf5l (TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor [Source:ZFIN;Acc:ZDB-GENE-030131-5987])

HSP 1 Score: 63.5438 bits (153), Expect = 3.186e-10
Identity = 74/309 (23.95%), Postives = 119/309 (38.51%), Query Frame = 1
Query: 1801 NEAAVSLKHGIRSI-------KISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLF-----------------RILQPDESGQSAQFLLNQH-----------------LVGKQSQYDMV-IAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKL 2601
            N A V L +G +S+       +++P    LAA   +  +  +SL   K       HN ++  I+           L C    D+V+     +     ++T+  HSG ++A + +  P      L+SC  D S+ F                  +   D S     F    H                   G  S  ++V   PN  Y A    DR VR++   S +Q  + R  TG  G +L     P G  +A+ G D+ + + +  +G ++  + GHS+    L F  D   L S SSDG + VW +
Sbjct:  257 NAATVCL-YGFKSVPAPPCAAEVAPGMGMLAAGYEDSRVMLWSLGPRKL--RTARHNVDVARIN-----------LACDILDDKVVEDSKGSD----VKTLRAHSGPVYAVRFL--PGGAG--LLSCSEDASVRFWDPRTFTNTAVYQGHAYPVWDVDVSALGLYFCSGSHDRTARLWVPERAFPLRVYAGHVSDVNVVRFHPNGSYVATGSADRTVRLW---SAQQGSAARLFTGHRGAVLALAFSPGGRLLASGGEDQRVRLWDIGSGAIVKELRGHSDDITCLSFSPDGSALASGSSDGSVRVWDV 540          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 55.4546 bits (132), Expect = 7.228e-8
Identity = 42/149 (28.19%), Postives = 74/149 (49.66%), Query Frame = 1
Query:  598 ITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSK--VIAIAFSEAGQFFVTVGVRH-VRFWYLDNSRSKSKAT--TPLLGRSAILGDFMNNTFTDV 1029
            +  ++F+  G  + TG S K+   R+W V T   +  F GH   V ++A   + R++ S GS ED  INVW++ T  ++   +   K  + ++++S+ G   ++ G  H VR W L  + ++  A    P +G    LGD   +   D+
Sbjct:  612 VDCVSFHPNGCYVFTGSSDKT--CRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWL-STGS-EDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKATTEPSAEPDEPFIG---YLGDVTASINQDI 753          

HSP 2 Score: 51.6026 bits (122), Expect = 1.046e-6
Identity = 47/202 (23.27%), Postives = 90/202 (44.55%), Query Frame = 1
Query: 2047 DPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKC-TIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELR 2649
            DPT      +T+  HSG +++     +P+++   L+S   DK++  R+   D       +  + H V     +D+  +P   Y A    D+  R+++       + + G   D    + C +  P+G Y+ T  SDK   + + +TG+ +    GH+   + +    D + L + S DG I VW       +   KR++++R
Sbjct:  515 DPT-----CKTLVGHSGTVYSTSF--SPDNK--YLLSGSEDKTV--RLWSMDTHTALVSYKGHNHPV-----WDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLND----VDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWD------IGTGKRLKQMR 690          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Yeast
Match: UTP13 (Nucleolar protein; component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA [Source:SGD;Acc:S000004212])

HSP 1 Score: 53.5286 bits (127), Expect = 2.738e-7
Identity = 55/225 (24.44%), Postives = 98/225 (43.56%), Query Frame = 1
Query: 2044 MDPTQNYKWIQTIDDHSGAIFAA------KLVETPNDQEIRLISCG-MDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKH----LVSVSSDGCIFVWKLPVEMTL-TMHKRMQELRSINSISLTEND 2682
            MD   +YK I     ++G+   A      K++ TP   EI +I      + +L +I   DE   +A                + + P+ +Y   V Q + ++I+++ +GK  +S + S+    Y+L    D + T +A  G+D  I +++   G +  S  GH      L F G L      L S  ++G + VW L     L T+ +    +R ++ I + +ND
Sbjct:    1 MDLKTSYKGISLNPIYAGSSAVATVSENGKILATPVLDEINIIDLTPGSRKILHKISNEDEQEITA----------------LKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISS--PSYILDA--DSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDND 205          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Nematostella
Match: EDO48644 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJA6])

HSP 1 Score: 317.775 bits (813), Expect = 1.946e-96
Identity = 183/448 (40.85%), Postives = 255/448 (56.92%), Query Frame = 1
Query:  589 KSPITAIAFNREGKLLATGESGKSPKVRIWSVE--THSQLFEFS-GHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSK--ATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSD-NDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEK-SLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSL 1911
            +  ITA+AF+R+GK LATGESG  P VR+WS+E  T+ Q+ E + GH + V  +AFS N +++VSVG Q D  IN+W     +K A +KV++KV AI FSE   FFVT G+RHV+FWY D   +KSK   T P++GRSA+LG+  NN F DV C                     +  N  YTY ++ +G L  F  +R LDKWVELR  KA C+ V E  I  GC+ GII +F+ S+L  + TLP PH+LG+N+ +  D +        V Y D VA   D  + R+TC YNDHS+YVWD++D +K  K+ S LYHS  VW VE    ++  K + L   +F+TCS D+TVR W++ +  L          S     D   D + I         LI    +S  +K+  N+ +   + G+R+I  SPD Q LA  DR GN++++ +
Sbjct:    6 RKTITAVAFSRDGKYLATGESGHLPSVRVWSMEDPTNPQVSEMAKGHKHGVACVAFSPNLKYLVSVGYQHDMLINIWNWKDGSKAACNKVSTKVFAICFSETANFFVTCGIRHVKFWYFDTETNKSKHNKTLPIMGRSALLGELRNNAFCDVAC--------------------GTGENSDYTYCVTNSGMLCSFGAKRVLDKWVELRASKAQCIAVSEKYIFCGCTDGIIRVFNPSTLEFVNTLPKPHFLGVNIADGIDPSHLIPKTGNVSYADTVALALDTCNYRLTCVYNDHSLYVWDLKDIKKIGKIWSSLYHSACVWGVEVYPEVSDNKHAALPPGTFLTCSADDTVRVWNVVEEWLD---------SGPELRDSGSDFLII--------KLITLCSSSPASKNV-NDVSSDGRTGVRTICASPDGQTLAVGDRSGNVRYHPI 415          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Nematostella
Match: EDO28888 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T576])

HSP 1 Score: 248.825 bits (634), Expect = 2.203e-73
Identity = 138/372 (37.10%), Postives = 208/372 (55.91%), Query Frame = 1
Query:  442 LEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVET--HSQLFEF-SGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATT-PLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVE 1545
            L+ VFG T   NA++S +  +G+VA+PAGCV V ++     Q FIHN ++  I+ ++F+++GK L  GESG  P VR WS++   + Q+ E  +GH + V  + FS  + F V   +     + ++  ++   +A +KV++K+  I FSE+  FFVT GVRH++FWY + + +K K  + PL GRSA+LG+  N+ F DV C                           YTY ++  G+L  F   R L+K  ELR  +A CL V E  I  GC+ GI+ + D  +L  I TLP PH+LG++++   D       E   YPD +A   D  H+++TC YND S+YVW++ D  K  K  S LYHS G+W ++
Sbjct:    3 LDTVFGLTAGTNASLSCNAVTGVVAYPAGCVTVLFNPLTGAQDFIHNTLRKTISCLSFSKDGKYLVIGESGHKPSVRAWSIDEPGYPQISEMVNGHKHGVACVKFS--ALFDVK-WAYSKRHVMIFR-HSGKIVACNKVSTKIYGICFSESTSFFVTCGVRHLKFWYFEEALNKPKDNSIPLSGRSALLGEERNSAFCDVVC--------------------GIGKTADYTYSVTSNGKLCAFGASRSLEKSFELRASRALCLAVSEQFICCGCTNGIVRVCDPVTLEIIRTLPRPHFLGVDVEKVVDGSCEDEKESDLYPDAIALSMDPKHNKVTCLYNDRSLYVWEMLDIDKIVKSFSSLYHSSGIWGIK 350          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Nematostella
Match: EDO32369 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV90])

HSP 1 Score: 253.832 bits (647), Expect = 1.758e-72
Identity = 176/606 (29.04%), Postives = 281/606 (46.37%), Query Frame = 1
Query:  868 IAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATT-PLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVE-PVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLT-ASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDY------FQSPSA---------------PDLV-----------LFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDG 2580
            +   E+  FFVT GVRH++FWY + + +K K  + PL GRSA+LG+  N+ F DV C                           YTY ++  G+L  F   R L+K  ELR  +A CL V E  I  GC+ GI+     SS N++        L  + ++  ++D         YPD +A   D  H+++TC YND S+YVW++ D  K  K  S LYHS G+W ++  V +     S     +F+TCS D+TVRFW +    L    +++   I          D+ +++Y+   +K++ +A +   R              GI+++ IS D + LA  D+ GN++ Y   + KE + I AH  E+L +++        +P                 P +            L  SA RDR+IHV + ++++  +QT+DDHS +I + K     ++ E +L+SCG D+++ FR+ + +       F+   ++V K    DM I  +   AAV CQDR +                                      S SDK +S L+  +GE +A+++GHSE +  + F  D   L++VS+DG
Sbjct:   67 LVIGESTSFFVTCGVRHLKFWYFEEALNKPKDNSIPLSGRSALLGEERNSAFCDVVC--------------------GIGKTADYTYSVTSNGKLCAFGASRSLEKSFELRASRALCLAVSEQFICCGCTNGIV-----SSPNNMLNFE----LCFSCEDEKESDL--------YPDAIALSMDPKHNKVTCLYNDRSLYVWEMLDIDKIVKSFSSLYHSSGIWGIKAAVKLAELNGSTSPYGTFLTCSSDDTVRFWDMDRGTLLWPVYNRLSVI---------DDIPRLVYSSLTVKNVRQASKEDQR-------------RGIKTVAISADGKLLAVGDKIGNVRIYDTVHMKERYKISAHESEVLCVEFSPLKSGIHNPQCREPGFSKFYKSKLNLPGVFFFFFFFFSGYNLLVSAGRDRLIHVYNASEDFTLLQTLDDHSASIASIKF--HGSNGEFQLLSCGADRTIYFRVARKEP---QLMFVRTTNVVNKTGLRDMAIDCSRNLAAVACQDRTI--------------------------------------SCSDKTLSFLDLDSGECVATLSGHSEQSTDMLFSSDCSRLITVSADG 570          

HSP 2 Score: 70.0922 bits (170), Expect = 5.601e-12
Identity = 30/70 (42.86%), Postives = 47/70 (67.14%), Query Frame = 1
Query:  442 LEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGES 651
            L+ VFG T   NA++S +  +G+VA+PAGCV V ++     Q FIHN ++  I+ ++F+++GK L  GES
Sbjct:    3 LDTVFGLTAGTNASLSCNAVTGVVAYPAGCVTVLFNPLTGAQDFIHNTLRKTISCLSFSKDGKYLVIGES 72          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Nematostella
Match: EDO48645 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJA9])

HSP 1 Score: 132.88 bits (333), Expect = 9.036e-33
Identity = 71/172 (41.28%), Postives = 105/172 (61.05%), Query Frame = 1
Query: 1894 LKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQ--PDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLK 2403
            ++ Y +    E   I AH  E+L +++  SP      L  SA RDR+IH+ D  +++  IQT+DDHS +I + K     ++ + +L+SC  DKS++FR  Q  PD      QF+ N + VGK + YDMV+  +   AA  CQDR VRIY+ V+GKQ +S++G+TGDDG L+K
Sbjct:  222 VRVYDMMFLDELLKIEAHESEVLCVEF--SPPQSGHKLLASAGRDRLIHIFDMNKDFSLIQTLDDHSASITSIKF-NVDDNGDFQLLSCSADKSIIFRSAQQNPD-----LQFVRNTNYVGKTTFYDMVVDTSRHVAATACQDRNVRIYDTVNGKQTRSFKGATGDDGTLVK 385          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Nematostella
Match: EDO48010 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKM0])

HSP 1 Score: 77.0258 bits (188), Expect = 4.287e-14
Identity = 54/191 (28.27%), Postives = 87/191 (45.55%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGES---GKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKV----TSKVIAIAFSEAGQ-FFVTVGVRHVRFWYLDNSRSKSKATTPLLGR 984
            L LE V GF       + + P    + +P G  VV    K  KQ  +     + +T +A ++ G+ LA+G+    G    V +W        ++ + H  +V ALAFS N  ++VS+G Q+D S+ VW+L     +  S           A+AF+      F+T G + +R W LD    K + T   +G+
Sbjct:   12 LELESVIGFAGAVPNGLLVHPDRDHLIYPLGNTVVIEQIKTGKQSCLSGHTDN-VTCVAVSKSGRYLASGQQAHMGFKASVIVWDYAEKKLKYQLTLHKVKVEALAFSPNDEYLVSLGGQDDGSVVVWDLQAGEAVCGSPAAVPSAGTTNAVAFANHNDNLFITGGNKTLRVWELDRPNRKIRPTECNMGQ 201          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Medaka
Match: mapkbp1 (mitogen-activated protein kinase-binding protein 1 [Source:NCBI gene;Acc:105356884])

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 325/763 (42.60%), Postives = 470/763 (61.60%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLD-NSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDND--FNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDF---RKPAKVVSHLYHSGGVWSVEPVSILTKE-KSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADR------NSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPD--LVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTEN 2679
            ++LEKV G T + N A++ +P +G++A+PAGCVVV  + +++KQ  I N+ +  IT +AF+ +GK + TGESG  P VR+W V    Q+ E   H Y V  +AFS N ++++SVG + D  +NVW    N  +A++KV+SKV A++FS+   +FVT G RHV+FWYLD N  SK  AT PLLGRS +LG+  NN F+DV C                          S T+ I+ +G L +F E+R LDKWVELRT +ATCL+V E  I  GCS G +  F   +L+ + TLP PH LG ++ +  D    F+   +  RYPD VA  YD  +  ++C YNDHS+YVWDVRD    R+  K+ S LYHS  VWS+E  +  T E + LL   SF++CS D T+R W++            +  SA   N  S DL K+IY +  + SL +AD       N+ +      +    ++ GIR++++SPD +HLA+ DR G L+ + L + +E  ++ AH+ EIL +++    S PD  L L  +ASRDR+IH++D  ++Y  +QT+D+HS +I A +     N+ ++R+ISCG DKS+ FR  Q  E G   +F+   H+V K + YDM + P  +YAAV CQDR +RI+N+ + KQ+K+Y+GS G+DG ++K  IDPSG YIATS SDK ISI +F +GE +A++ GHSE+  GL F GD KHL++VS D CIFVW+L  EMT+ M +R+ +L+   S+   +N
Sbjct:   46 VTLEKVLGITAEGNRALACEPRTGLLAYPAGCVVVLLNPRKNKQHHIFNSSRKAITTLAFSPDGKYVVTGESGHMPAVRVWDVSERLQVSELQEHKYGVACVAFSPNGKYIISVGYEHDMMVNVWNWKKNVVVAANKVSSKVTAVSFSDDSSYFVTAGNRHVKFWYLDHNKTSKVNATVPLLGRSGLLGELRNNFFSDVAC--------------------GRGRRSSSTFCITSSGLLCEFNERRLLDKWVELRTSQATCLSVTEEFIFCGCSDGTVRAFSPVNLHFLCTLPRPHSLGADIASMVDASQLFSCGAD-ARYPDSVAVTYDPTNHWLSCVYNDHSVYVWDVRDLQDLRRAGKLYSALYHSSCVWSLEVSTGGTGEGERLLPPGSFLSCSSDNTIRLWNM------------DGHSALHRNILSHDLKKVIYVEDNVSSLPDADSITVAGGNAEKAGPPEGQQTDQIRTGIRALRVSPDGRHLASGDRMGVLRIHDLDSMEEILNVQAHDSEILCLEF----SKPDTGLQLLATASRDRLIHILDAGRDYSLVQTLDEHSSSITAVRFAA--NEGKVRMISCGADKSVYFRSAQQTEEG--LEFIRTHHVVRKTTLYDMDVEPTRKYAAVGCQDRNIRIFNVSNAKQKKAYKGSQGEDGTIIKVHIDPSGLYIATSCSDKNISIFDFFSGECVATMFGHSEIITGLKFSGDCKHLITVSGDSCIFVWRLSPEMTIRMRQRLADLKPRRSVPHRQN 767          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Medaka
Match: mapkbp1 (mitogen-activated protein kinase-binding protein 1 [Source:NCBI gene;Acc:105356884])

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 325/763 (42.60%), Postives = 470/763 (61.60%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLD-NSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDND--FNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDF---RKPAKVVSHLYHSGGVWSVEPVSILTKE-KSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADR------NSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPD--LVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTEN 2679
            ++LEKV G T + N A++ +P +G++A+PAGCVVV  + +++KQ  I N+ +  IT +AF+ +GK + TGESG  P VR+W V    Q+ E   H Y V  +AFS N ++++SVG + D  +NVW    N  +A++KV+SKV A++FS+   +FVT G RHV+FWYLD N  SK  AT PLLGRS +LG+  NN F+DV C                          S T+ I+ +G L +F E+R LDKWVELRT +ATCL+V E  I  GCS G +  F   +L+ + TLP PH LG ++ +  D    F+   +  RYPD VA  YD  +  ++C YNDHS+YVWDVRD    R+  K+ S LYHS  VWS+E  +  T E + LL   SF++CS D T+R W++            +  SA   N  S DL K+IY +  + SL +AD       N+ +      +    ++ GIR++++SPD +HLA+ DR G L+ + L + +E  ++ AH+ EIL +++    S PD  L L  +ASRDR+IH++D  ++Y  +QT+D+HS +I A +     N+ ++R+ISCG DKS+ FR  Q  E G   +F+   H+V K + YDM + P  +YAAV CQDR +RI+N+ + KQ+K+Y+GS G+DG ++K  IDPSG YIATS SDK ISI +F +GE +A++ GHSE+  GL F GD KHL++VS D CIFVW+L  EMT+ M +R+ +L+   S+   +N
Sbjct:   38 VTLEKVLGITAEGNRALACEPRTGLLAYPAGCVVVLLNPRKNKQHHIFNSSRKAITTLAFSPDGKYVVTGESGHMPAVRVWDVSERLQVSELQEHKYGVACVAFSPNGKYIISVGYEHDMMVNVWNWKKNVVVAANKVSSKVTAVSFSDDSSYFVTAGNRHVKFWYLDHNKTSKVNATVPLLGRSGLLGELRNNFFSDVAC--------------------GRGRRSSSTFCITSSGLLCEFNERRLLDKWVELRTSQATCLSVTEEFIFCGCSDGTVRAFSPVNLHFLCTLPRPHSLGADIASMVDASQLFSCGAD-ARYPDSVAVTYDPTNHWLSCVYNDHSVYVWDVRDLQDLRRAGKLYSALYHSSCVWSLEVSTGGTGEGERLLPPGSFLSCSSDNTIRLWNM------------DGHSALHRNILSHDLKKVIYVEDNVSSLPDADSITVAGGNAEKAGPPEGQQTDQIRTGIRALRVSPDGRHLASGDRMGVLRIHDLDSMEEILNVQAHDSEILCLEF----SKPDTGLQLLATASRDRLIHILDAGRDYSLVQTLDEHSSSITAVRFAA--NEGKVRMISCGADKSVYFRSAQQTEEG--LEFIRTHHVVRKTTLYDMDVEPTRKYAAVGCQDRNIRIFNVSNAKQKKAYKGSQGEDGTIIKVHIDPSGLYIATSCSDKNISIFDFFSGECVATMFGHSEIITGLKFSGDCKHLITVSGDSCIFVWRLSPEMTIRMRQRLADLKPRRSVPHRQN 759          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Medaka
Match: mapkbp1 (mitogen-activated protein kinase-binding protein 1 [Source:NCBI gene;Acc:105356884])

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 325/763 (42.60%), Postives = 470/763 (61.60%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLD-NSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDND--FNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDF---RKPAKVVSHLYHSGGVWSVEPVSILTKE-KSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADR------NSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPD--LVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTEN 2679
            ++LEKV G T + N A++ +P +G++A+PAGCVVV  + +++KQ  I N+ +  IT +AF+ +GK + TGESG  P VR+W V    Q+ E   H Y V  +AFS N ++++SVG + D  +NVW    N  +A++KV+SKV A++FS+   +FVT G RHV+FWYLD N  SK  AT PLLGRS +LG+  NN F+DV C                          S T+ I+ +G L +F E+R LDKWVELRT +ATCL+V E  I  GCS G +  F   +L+ + TLP PH LG ++ +  D    F+   +  RYPD VA  YD  +  ++C YNDHS+YVWDVRD    R+  K+ S LYHS  VWS+E  +  T E + LL   SF++CS D T+R W++            +  SA   N  S DL K+IY +  + SL +AD       N+ +      +    ++ GIR++++SPD +HLA+ DR G L+ + L + +E  ++ AH+ EIL +++    S PD  L L  +ASRDR+IH++D  ++Y  +QT+D+HS +I A +     N+ ++R+ISCG DKS+ FR  Q  E G   +F+   H+V K + YDM + P  +YAAV CQDR +RI+N+ + KQ+K+Y+GS G+DG ++K  IDPSG YIATS SDK ISI +F +GE +A++ GHSE+  GL F GD KHL++VS D CIFVW+L  EMT+ M +R+ +L+   S+   +N
Sbjct:   38 VTLEKVLGITAEGNRALACEPRTGLLAYPAGCVVVLLNPRKNKQHHIFNSSRKAITTLAFSPDGKYVVTGESGHMPAVRVWDVSERLQVSELQEHKYGVACVAFSPNGKYIISVGYEHDMMVNVWNWKKNVVVAANKVSSKVTAVSFSDDSSYFVTAGNRHVKFWYLDHNKTSKVNATVPLLGRSGLLGELRNNFFSDVAC--------------------GRGRRSSSTFCITSSGLLCEFNERRLLDKWVELRTSQATCLSVTEEFIFCGCSDGTVRAFSPVNLHFLCTLPRPHSLGADIASMVDASQLFSCGAD-ARYPDSVAVTYDPTNHWLSCVYNDHSVYVWDVRDLQDLRRAGKLYSALYHSSCVWSLEVSTGGTGEGERLLPPGSFLSCSSDNTIRLWNM------------DGHSALHRNILSHDLKKVIYVEDNVSSLPDADSITVAGGNAEKAGPPEGQQTDQIRTGIRALRVSPDGRHLASGDRMGVLRIHDLDSMEEILNVQAHDSEILCLEF----SKPDTGLQLLATASRDRLIHILDAGRDYSLVQTLDEHSSSITAVRFAA--NEGKVRMISCGADKSVYFRSAQQTEEG--LEFIRTHHVVRKTTLYDMDVEPTRKYAAVGCQDRNIRIFNVSNAKQKKAYKGSQGEDGTIIKVHIDPSGLYIATSCSDKNISIFDFFSGECVATMFGHSEIITGLKFSGDCKHLITVSGDSCIFVWRLSPEMTIRMRQRLADLKPRRSVPHRQN 759          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Medaka
Match: mapkbp1 (mitogen-activated protein kinase-binding protein 1 [Source:NCBI gene;Acc:105356884])

HSP 1 Score: 619.002 bits (1595), Expect = 0.000e+0
Identity = 325/769 (42.26%), Postives = 470/769 (61.12%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLD-NSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELR------TPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDND--FNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDF---RKPAKVVSHLYHSGGVWSVEPVSILTKE-KSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADR------NSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPD--LVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTEN 2679
            ++LEKV G T + N A++ +P +G++A+PAGCVVV  + +++KQ  I N+ +  IT +AF+ +GK + TGESG  P VR+W V    Q+ E   H Y V  +AFS N ++++SVG + D  +NVW    N  +A++KV+SKV A++FS+   +FVT G RHV+FWYLD N  SK  AT PLLGRS +LG+  NN F+DV C                          S T+ I+ +G L +F E+R LDKWVELR      T +ATCL+V E  I  GCS G +  F   +L+ + TLP PH LG ++ +  D    F+   +  RYPD VA  YD  +  ++C YNDHS+YVWDVRD    R+  K+ S LYHS  VWS+E  +  T E + LL   SF++CS D T+R W++            +  SA   N  S DL K+IY +  + SL +AD       N+ +      +    ++ GIR++++SPD +HLA+ DR G L+ + L + +E  ++ AH+ EIL +++    S PD  L L  +ASRDR+IH++D  ++Y  +QT+D+HS +I A +     N+ ++R+ISCG DKS+ FR  Q  E G   +F+   H+V K + YDM + P  +YAAV CQDR +RI+N+ + KQ+K+Y+GS G+DG ++K  IDPSG YIATS SDK ISI +F +GE +A++ GHSE+  GL F GD KHL++VS D CIFVW+L  EMT+ M +R+ +L+   S+   +N
Sbjct:   38 VTLEKVLGITAEGNRALACEPRTGLLAYPAGCVVVLLNPRKNKQHHIFNSSRKAITTLAFSPDGKYVVTGESGHMPAVRVWDVSERLQVSELQEHKYGVACVAFSPNGKYIISVGYEHDMMVNVWNWKKNVVVAANKVSSKVTAVSFSDDSSYFVTAGNRHVKFWYLDHNKTSKVNATVPLLGRSGLLGELRNNFFSDVAC--------------------GRGRRSSSTFCITSSGLLCEFNERRLLDKWVELRRVDSASTSQATCLSVTEEFIFCGCSDGTVRAFSPVNLHFLCTLPRPHSLGADIASMVDASQLFSCGAD-ARYPDSVAVTYDPTNHWLSCVYNDHSVYVWDVRDLQDLRRAGKLYSALYHSSCVWSLEVSTGGTGEGERLLPPGSFLSCSSDNTIRLWNM------------DGHSALHRNILSHDLKKVIYVEDNVSSLPDADSITVAGGNAEKAGPPEGQQTDQIRTGIRALRVSPDGRHLASGDRMGVLRIHDLDSMEEILNVQAHDSEILCLEF----SKPDTGLQLLATASRDRLIHILDAGRDYSLVQTLDEHSSSITAVRFAA--NEGKVRMISCGADKSVYFRSAQQTEEG--LEFIRTHHVVRKTTLYDMDVEPTRKYAAVGCQDRNIRIFNVSNAKQKKAYKGSQGEDGTIIKVHIDPSGLYIATSCSDKNISIFDFFSGECVATMFGHSEIITGLKFSGDCKHLITVSGDSCIFVWRLSPEMTIRMRQRLADLKPRRSVPHRQN 765          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Medaka
Match: wdr62 (WD repeat-containing protein 62 [Source:NCBI gene;Acc:101162822])

HSP 1 Score: 493.041 bits (1268), Expect = 9.988e-149
Identity = 288/737 (39.08%), Postives = 405/737 (54.95%), Query Frame = 1
Query:  442 LEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKS-KATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEK-----SLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLV-ETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHK 2631
            LEKV G T  +++ ++ DP +G++A+PAG VVV     R++Q  I N  K   TA+AF+ +GK LATGESG  P VR+W V   SQ+ E   H +RV  +AFS NS ++VSVG Q D +++VW+    + +AS+KV+S V++++FS+   +FVT G RHV+FWYLD SR +    T PL+GRS +L D     F  V C                          S TY ++ +G L  F   RYL+ WV+L+T  A+CLTV E  I  GC+ G+I +F    L ++ TL  PH LG      ++    A+     YP  +A   D  +  +TC Y DHSIYVWDV D     K+    YHS  VWS+E    +  E+     + L  +SF++CS D TVRFW+       ASH           N    DL++I+                     Q  EA V  K G+R + +SPD QHLA  DR G+L+ + L    +   I AH+ E+L ++Y  SP++  + L  SA RDR+IHV DP +NY  +QT++DHS +I A +   E+P   E+ L++C +DKS+ F+  +  ++     F     +V K S YDM  +     A V CQDR +R+Y + SGK ++  +GST D G LLK  +DPSG++ ATS S+K I + ++ TGE +AS+ GHSE    L F  D   LVS S+D CIFVWKL   MT  M K
Sbjct:   82 LEKVLGITTVSSSGLTSDPNTGLIAYPAGSVVVLLHPLRNQQNHILNWSKKLFTAVAFSHDGKHLATGESGHRPCVRVWEV-GGSQVAEVQSHKHRVSCVAFSSNSGYIVSVGYQHDMTVSVWDWRKGSIVASNKVSSGVLSVSFSQDSSYFVTAGNRHVKFWYLDASREQRVYGTVPLIGRSGLLNDHKTRVFCGVAC--------------------GRGLMASNTYCVTSSGLLCLFNRVRYLEAWVDLKTSSASCLTVSEDFIFCGCADGVIRVFSPDRLQYLTTLQRPHLLG------AEQGLQASVSDALYPPTLALTLDPCNQLLTCVYGDHSIYVWDVHDVHSVEKIYWARYHSSSVWSLE----VYPERPYPSHAPLPASSFLSCSSDNTVRFWN------AASH----------RNLCGDDLLRILNL----------------GAAQQGEA-VDGKPGVRVLAVSPDGQHLAVGDRSGDLRVFGLQFLDQLVKIEAHDLEVLCLEY--SPASTGVRLLASAGRDRLIHVFDPDRNYSLLQTLNDHSASISAVRFTGESP---EVHLVTCSVDKSINFQTAE--QTADGPGFSRRHCVVEKTSLYDMDCS--RTQAVVACQDRNIRVYGVDSGKLQRCLKGSTSDRGALLKVRMDPSGSFFATSCSNKNIEVFDYETGECVASLFGHSEAVTCLRFSWDCTRLVSASADSCIFVWKLDGHMTGNMRK 745          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Planmine SMEST
Match: SMESG000080852.1 (SMESG000080852.1)

HSP 1 Score: 2671.34 bits (6923), Expect = 0.000e+0
Identity = 1337/1340 (99.78%), Postives = 1338/1340 (99.85%), Query Frame = 1
Query:   52 IPFVIRSISSYDCGVLMQNTNKKPIVNRPKFLRGKSHHLEISETVFAFDEEIELTLPLTPIAPSFFSKYFKMNKTGTRSLIGSPKIQRNSIEIKSGISKNLRARSTNCVMPPHLSXXXXXXXXXXXXXLSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEINMESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSSNICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEAEDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVRSMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKAEGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTKYLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAKSNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRSDSREPKPEVMKTRKPSGPSLSSRPAISKAXXXXXXXXXGRPSDSKLRSLTDCQTSRSSDSKILPTKPTIKPTNR 4071
            IPFVIRSISSYDCGVLMQNTNKKPI NRPKFLRGKSHHLEISETVFAFDEEIELTLPLTPIAPSFFSKYFKMNKTGTRSLIGSP IQRNSIEIKSGISKNLRARSTNCVMPPHLSNHNDNHCKNQNNQLSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNSGSGSGQMTSSMCSSFTSSTNQSYTYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEIN+ESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSSNICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEAEDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVRSMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKAEGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTKYLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAKSNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRSDSREPKPEVMKTRKPSGPSLSSRPAISKATSTSSVSTVGRPSDSKLRSLTDCQTSRSSDSKILPTKPTIKPTNR
Sbjct:  334 IPFVIRSISSYDCGVLMQNTNKKPIANRPKFLRGKSHHLEISETVFAFDEEIELTLPLTPIAPSFFSKYFKMNKTGTRSLIGSPNIQRNSIEIKSGISKNLRARSTNCVMPPHLSNHNDNHCKNQNNQLSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNSGSGSGQMTSSMCSSFTSSTNQSYTYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEINIESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSSNICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEAEDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVRSMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKAEGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTKYLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAKSNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRSDSREPKPEVMKTRKPSGPSLSSRPAISKATSTSSVSTVGRPSDSKLRSLTDCQTSRSSDSKILPTKPTIKPTNR 1673          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Planmine SMEST
Match: SMESG000080852.1 (SMESG000080852.1)

HSP 1 Score: 2670.96 bits (6922), Expect = 0.000e+0
Identity = 1337/1340 (99.78%), Postives = 1338/1340 (99.85%), Query Frame = 1
Query:   52 IPFVIRSISSYDCGVLMQNTNKKPIVNRPKFLRGKSHHLEISETVFAFDEEIELTLPLTPIAPSFFSKYFKMNKTGTRSLIGSPKIQRNSIEIKSGISKNLRARSTNCVMPPHLSXXXXXXXXXXXXXLSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEINMESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSSNICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEAEDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVRSMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKAEGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTKYLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAKSNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRSDSREPKPEVMKTRKPSGPSLSSRPAISKAXXXXXXXXXGRPSDSKLRSLTDCQTSRSSDSKILPTKPTIKPTNR 4071
            IPFVIRSISSYDCGVLMQNTNKKPI NRPKFLRGKSHHLEISETVFAFDEEIELTLPLTPIAPSFFSKYFKMNKTGTRSLIGSP IQRNSIEIKSGISKNLRARSTNCVMPPHLSNHNDNHCKNQNNQLSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNSGSGSGQMTSSMCSSFTSSTNQSYTYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEIN+ESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSSNICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEAEDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVRSMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKAEGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTKYLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAKSNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRSDSREPKPEVMKTRKPSGPSLSSRPAISKATSTSSVSTVGRPSDSKLRSLTDCQTSRSSDSKILPTKPTIKPTNR
Sbjct:  371 IPFVIRSISSYDCGVLMQNTNKKPIANRPKFLRGKSHHLEISETVFAFDEEIELTLPLTPIAPSFFSKYFKMNKTGTRSLIGSPNIQRNSIEIKSGISKNLRARSTNCVMPPHLSNHNDNHCKNQNNQLSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNSGSGSGQMTSSMCSSFTSSTNQSYTYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEINIESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSSNICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEAEDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVRSMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKAEGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTKYLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAKSNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRSDSREPKPEVMKTRKPSGPSLSSRPAISKATSTSSVSTVGRPSDSKLRSLTDCQTSRSSDSKILPTKPTIKPTNR 1710          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Planmine SMEST
Match: SMESG000080852.1 (SMESG000080852.1)

HSP 1 Score: 2670.96 bits (6922), Expect = 0.000e+0
Identity = 1337/1340 (99.78%), Postives = 1338/1340 (99.85%), Query Frame = 1
Query:   52 IPFVIRSISSYDCGVLMQNTNKKPIVNRPKFLRGKSHHLEISETVFAFDEEIELTLPLTPIAPSFFSKYFKMNKTGTRSLIGSPKIQRNSIEIKSGISKNLRARSTNCVMPPHLSXXXXXXXXXXXXXLSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEINMESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSSNICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEAEDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVRSMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKAEGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTKYLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAKSNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRSDSREPKPEVMKTRKPSGPSLSSRPAISKAXXXXXXXXXGRPSDSKLRSLTDCQTSRSSDSKILPTKPTIKPTNR 4071
            IPFVIRSISSYDCGVLMQNTNKKPI NRPKFLRGKSHHLEISETVFAFDEEIELTLPLTPIAPSFFSKYFKMNKTGTRSLIGSP IQRNSIEIKSGISKNLRARSTNCVMPPHLSNHNDNHCKNQNNQLSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNSGSGSGQMTSSMCSSFTSSTNQSYTYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEIN+ESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSSNICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEAEDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVRSMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKAEGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTKYLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAKSNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRSDSREPKPEVMKTRKPSGPSLSSRPAISKATSTSSVSTVGRPSDSKLRSLTDCQTSRSSDSKILPTKPTIKPTNR
Sbjct:  303 IPFVIRSISSYDCGVLMQNTNKKPIANRPKFLRGKSHHLEISETVFAFDEEIELTLPLTPIAPSFFSKYFKMNKTGTRSLIGSPNIQRNSIEIKSGISKNLRARSTNCVMPPHLSNHNDNHCKNQNNQLSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNSGSGSGQMTSSMCSSFTSSTNQSYTYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEINIESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSSNICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEAEDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVRSMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKAEGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTKYLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAKSNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRSDSREPKPEVMKTRKPSGPSLSSRPAISKATSTSSVSTVGRPSDSKLRSLTDCQTSRSSDSKILPTKPTIKPTNR 1642          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Planmine SMEST
Match: SMESG000080852.1 (SMESG000080852.1)

HSP 1 Score: 2641.3 bits (6845), Expect = 0.000e+0
Identity = 1321/1324 (99.77%), Postives = 1322/1324 (99.85%), Query Frame = 1
Query:  100 MQNTNKKPIVNRPKFLRGKSHHLEISETVFAFDEEIELTLPLTPIAPSFFSKYFKMNKTGTRSLIGSPKIQRNSIEIKSGISKNLRARSTNCVMPPHLSXXXXXXXXXXXXXLSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEINMESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSSNICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEAEDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVRSMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKAEGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTKYLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAKSNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRSDSREPKPEVMKTRKPSGPSLSSRPAISKAXXXXXXXXXGRPSDSKLRSLTDCQTSRSSDSKILPTKPTIKPTNR 4071
            MQNTNKKPI NRPKFLRGKSHHLEISETVFAFDEEIELTLPLTPIAPSFFSKYFKMNKTGTRSLIGSP IQRNSIEIKSGISKNLRARSTNCVMPPHLSNHNDNHCKNQNNQLSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNSGSGSGQMTSSMCSSFTSSTNQSYTYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEIN+ESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSSNICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEAEDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVRSMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKAEGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTKYLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAKSNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRSDSREPKPEVMKTRKPSGPSLSSRPAISKATSTSSVSTVGRPSDSKLRSLTDCQTSRSSDSKILPTKPTIKPTNR
Sbjct:    1 MQNTNKKPIANRPKFLRGKSHHLEISETVFAFDEEIELTLPLTPIAPSFFSKYFKMNKTGTRSLIGSPNIQRNSIEIKSGISKNLRARSTNCVMPPHLSNHNDNHCKNQNNQLSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNSGSGSGQMTSSMCSSFTSSTNQSYTYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEINIESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSSNICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEAEDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVRSMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKAEGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTKYLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAKSNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRSDSREPKPEVMKTRKPSGPSLSSRPAISKATSTSSVSTVGRPSDSKLRSLTDCQTSRSSDSKILPTKPTIKPTNR 1324          
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Planmine SMEST
Match: SMESG000080852.1 (SMESG000080852.1)

HSP 1 Score: 2448.7 bits (6345), Expect = 0.000e+0
Identity = 1211/1212 (99.92%), Postives = 1212/1212 (100.00%), Query Frame = 1
Query:  436 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNXXXXXXXXXXXXXXXXXXXXXXXXXYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEINMESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSSNICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEAEDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVRSMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKAEGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTKYLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAKSNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRSDSREPKPEVMKTRKPSGPSLSSRPAISKAXXXXXXXXXGRPSDSKLRSLTDCQTSRSSDSKILPTKPTIKPTNR 4071
            LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNSGSGSGQMTSSMCSSFTSSTNQSYTYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEIN+ESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSSNICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEAEDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVRSMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKAEGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTKYLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAKSNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRSDSREPKPEVMKTRKPSGPSLSSRPAISKATSTSSVSTVGRPSDSKLRSLTDCQTSRSSDSKILPTKPTIKPTNR
Sbjct:   23 LSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILGDFMNNTFTDVGCCCLNSGSGSGQMTSSMCSSFTSSTNQSYTYVISQAGQLMQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHIATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYNDHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFITCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGLKSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLKFYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMDPTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQPDESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSGKQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLASVAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELRSINSISLTENDIRKDTAPPSTTGTVTPPRISEEINIESSNTSLINAISNSLQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSSNICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEAEDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVRSMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKAEGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTKYLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAKSNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRSDSREPKPEVMKTRKPSGPSLSSRPAISKATSTSSVSTVGRPSDSKLRSLTDCQTSRSSDSKILPTKPTIKPTNR 1234          
The following BLAST results are available for this feature:
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAPKBP10.000e+044.15mitogen-activated protein kinase binding protein 1... [more]
MAPKBP10.000e+044.15mitogen-activated protein kinase binding protein 1... [more]
MAPKBP10.000e+043.79mitogen-activated protein kinase binding protein 1... [more]
WDR620.000e+040.54WD repeat domain 62 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR620.000e+040.54WD repeat domain 62 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H24G06.19.178e-5025.26pep chromosome:WBcel235:V:9444050:9460639:1 gene:W... [more]
H24G06.11.225e-4925.26pep chromosome:WBcel235:V:9444234:9460635:1 gene:W... [more]
wdr-5.33.923e-1028.18WD repeat-containing protein wdr-5.3 [Source:UniP... [more]
wdr-5.29.587e-928.80WD repeat-containing protein wdr-5.2 [Source:UniP... [more]
wdr-5.13.472e-622.35WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
back to top
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr620.000e+038.70gene:FBgn0031374 transcript:FBtr0309828[more]
Wdr620.000e+038.70gene:FBgn0031374 transcript:FBtr0113012[more]
Wdr620.000e+038.70gene:FBgn0031374 transcript:FBtr0077811[more]
Wdr620.000e+038.70gene:FBgn0031374 transcript:FBtr0333007[more]
Wdr620.000e+038.70gene:FBgn0031374 transcript:FBtr0110882[more]
back to top
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapkbp10.000e+042.78mitogen-activated protein kinase binding protein 1... [more]
mapkbp10.000e+041.13mitogen-activated protein kinase binding protein 1... [more]
mapkbp10.000e+040.82mitogen-activated protein kinase binding protein 1... [more]
wdr622.233e-18041.23WD repeat domain 62 [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
wdr623.183e-18041.23WD repeat domain 62 [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
back to top
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000049592.16.831e-16840.35pep primary_assembly:Xenopus_tropicalis_v9.1:8:547... [more]
ENSXETT00000049596.11.253e-16439.92pep primary_assembly:Xenopus_tropicalis_v9.1:8:547... [more]
gucy1a29.452e-1226.70guanylate cyclase 1, soluble, alpha 2 [Source:Xenb... [more]
EML61.649e-1030.05echinoderm microtubule associated protein like 6 [... [more]
EML61.683e-1030.05echinoderm microtubule associated protein like 6 [... [more]
back to top
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mapkbp10.000e+044.28mitogen-activated protein kinase binding protein 1... [more]
Mapkbp10.000e+043.93mitogen-activated protein kinase binding protein 1... [more]
Wdr620.000e+040.49WD repeat domain 62 [Source:MGI Symbol;Acc:MGI:192... [more]
Wdr620.000e+040.49WD repeat domain 62 [Source:MGI Symbol;Acc:MGI:192... [more]
Wdr621.775e-7340.18WD repeat domain 62 [Source:MGI Symbol;Acc:MGI:192... [more]
back to top
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DFF9|MABP1_XENLA0.000e+043.95Mitogen-activated protein kinase-binding protein 1... [more]
sp|Q6NS57|MABP1_MOUSE0.000e+044.15Mitogen-activated protein kinase-binding protein 1... [more]
sp|O60336|MABP1_HUMAN0.000e+043.79Mitogen-activated protein kinase-binding protein 1... [more]
sp|Q8HXL3|WDR62_PIG0.000e+040.49WD repeat-containing protein 62 OS=Sus scrofa OX=9... [more]
sp|Q3U3T8|WDR62_MOUSE0.000e+040.49WD repeat-containing protein 62 OS=Mus musculus OX... [more]
back to top
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IB050.000e+043.15WD repeat-containing protein 62 isoform X1 OS=Ling... [more]
A0A1S3I8T00.000e+043.15mitogen-activated protein kinase-binding protein 1... [more]
A0A1S3I9Q90.000e+043.15mitogen-activated protein kinase-binding protein 1... [more]
A0A3R7G7090.000e+043.80Mitogen-activated protein kinase-binding protein 1... [more]
A0A4S2M9D00.000e+043.32Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapkbp10.000e+043.19mitogen-activated protein kinase-binding protein 1... [more]
mapkbp10.000e+042.86mitogen-activated protein kinase-binding protein 1... [more]
ENSAMXT00000006286.20.000e+041.85mitogen-activated protein kinase-binding protein 1... [more]
wdr624.435e-17539.84WD repeat domain 62 [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
cfap525.331e-1527.23cilia and flagella associated protein 52 [Source:N... [more]
back to top
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapkbp10.000e+042.15mitogen-activated protein kinase binding protein 1... [more]
ENSPMAT00000007278.12.215e-14640.87pep scaffold:Pmarinus_7.0:GL476503:8:51230:-1 gene... [more]
ENSPMAT00000009467.11.515e-6236.90pep scaffold:Pmarinus_7.0:GL478507:38111:45670:1 g... [more]
cfap521.162e-1327.57cilia and flagella associated protein 52 [Source:Z... [more]
taf5l3.186e-1023.95TAF5-like RNA polymerase II, p300/CBP-associated f... [more]
back to top
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
TAF57.228e-828.19Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
UTP132.738e-724.44Nucleolar protein; component of the small subunit ... [more]
back to top
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO486441.946e-9640.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288882.203e-7337.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323691.758e-7229.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486459.036e-3341.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480104.287e-1428.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapkbp10.000e+042.60mitogen-activated protein kinase-binding protein 1... [more]
mapkbp10.000e+042.60mitogen-activated protein kinase-binding protein 1... [more]
mapkbp10.000e+042.60mitogen-activated protein kinase-binding protein 1... [more]
mapkbp10.000e+042.26mitogen-activated protein kinase-binding protein 1... [more]
wdr629.988e-14939.08WD repeat-containing protein 62 [Source:NCBI gene;... [more]
back to top
BLAST of Mitogen-activated protein kinase-binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080852.10.000e+099.78SMESG000080852.1[more]
SMESG000080852.10.000e+099.78SMESG000080852.1[more]
SMESG000080852.10.000e+099.78SMESG000080852.1[more]
SMESG000080852.10.000e+099.77SMESG000080852.1[more]
SMESG000080852.10.000e+099.92SMESG000080852.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007126 ID=SMED30007126|Name=Mitogen-activated protein kinase-binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5132bp
ATTTCTATTGGACCATCGTTTAATTTGTAGTTTAAGACATGTCTAAAATA
GATTCCATTTGTTATTCGTTCAATTTCAAGTTACGACTGTGGAGTTTTAA
TGCAAAATACTAATAAAAAACCAATAGTTAATCGTCCAAAATTTCTCAGA
GGAAAATCACATCATCTAGAAATATCGGAAACCGTTTTTGCATTTGATGA
GGAAATTGAACTAACTTTACCATTAACTCCAATTGCTCCTAGTTTTTTTA
GTAAATATTTTAAAATGAATAAAACCGGCACTCGAAGCCTTATCGGATCT
CCAAAAATACAACGAAACTCTATTGAAATAAAATCAGGAATTAGTAAAAA
TCTACGCGCAAGAAGCACAAACTGTGTGATGCCTCCTCATTTGTCAAATC
ATAATGATAATCATTGTAAAAATCAGAATAATCAATTATCATTGGAAAAA
GTATTTGGTTTCACTATTCAAAACAATGCAGCGGTTTCATTAGATCCGAC
ATCAGGCATTGTCGCTTTTCCCGCAGGTTGTGTTGTTGTTGGTTACAGTG
CCAAAAGAAGTAAACAATTCTTCATACACAATGCTGTAAAGAGTCCTATT
ACTGCTATCGCTTTCAATAGAGAAGGCAAACTCTTAGCAACTGGAGAAAG
TGGGAAATCTCCAAAAGTTCGAATTTGGAGTGTTGAAACTCACAGTCAGT
TATTCGAATTTAGCGGCCATAATTATCGAGTTGGAGCATTGGCATTTAGT
CACAATTCTCGTTTTGTTGTCAGCGTTGGTAGCCAAGAAGATACGTCAAT
AAACGTATGGGAACTTAACACAAACACGAAAATGGCAAGTAGTAAAGTCA
CAAGCAAGGTTATAGCGATTGCCTTCAGCGAAGCTGGCCAATTTTTTGTG
ACTGTAGGAGTTCGCCACGTTCGATTCTGGTATCTCGATAACAGTCGTTC
AAAGTCTAAAGCGACTACGCCTCTTCTTGGGAGAAGTGCAATTCTCGGCG
ATTTTATGAATAACACATTCACTGACGTGGGATGTTGTTGTCTGAACTCA
GGTTCCGGATCCGGTCAAATGACAAGCAGTATGTGCTCCAGTTTCACAAG
CAGTACAAATCAATCCTATACTTACGTAATCAGTCAAGCAGGTCAACTGA
TGCAGTTCACTGAACAAAGATATCTTGATAAATGGGTTGAATTACGCACT
CCCAAAGCTACCTGCCTTACAGTGTGTGAATCGTGCATTATGGTCGGTTG
TTCGAGGGGTATCATTCTCATTTTTGATACATCATCTTTGAATCATATCG
CAACTCTTCCAATGCCTCATTACCTTGGAATCAATCTGCAAAATCCTTCT
GATAATGATTTCAATGCGAACAATGAACCAGTGCGATATCCGGATGTAGT
AGCCGGAAAATATGATCATGTTCATTCAAGAATCACATGTTTTTATAATG
ATCACAGTATTTATGTATGGGACGTACGGGATTTTCGAAAGCCAGCAAAA
GTAGTTTCTCATCTTTATCATTCCGGAGGTGTCTGGTCAGTTGAGCCAGT
GTCCATACTGACCAAAGAAAAATCTCTTTTAGACGTTACTTCATTCATAA
CTTGTTCCGACGATGAAACTGTTCGTTTTTGGCATTTGTCCGACTCTAAT
TTAACAGCATCTCATTCCAAAACAGAAAATATTTCAGCTCAATGGGAAAA
TGATTATAGTAAAGATCTCATCAAAATAATTTATACAGATCCGGGCTTGA
AAAGTCTCATAGAAGCTGATAGAAATTCTGCGCGCAATAAACATCAAAGC
AATGAAGCGGCTGTCTCATTAAAACATGGGATAAGGTCAATAAAAATTAG
CCCCGACCGTCAGCATTTAGCTGCTGCCGACAGAGAGGGTAACTTAAAAT
TTTATTCATTGTCAAATTCTAAAGAGTTCCATTCTATCATGGCGCACAAT
GGAGAAATTCTTTCGATTGATTACTTTCAGTCTCCGTCGGCTCCTGATCT
TGTATTGTTTTGTTCGGCATCCAGAGATAGAGTTATTCATGTCATGGATC
CTACTCAGAATTACAAGTGGATTCAAACGATCGATGACCATTCAGGTGCA
ATATTTGCTGCTAAACTTGTAGAAACTCCAAATGATCAGGAGATTCGACT
TATTTCCTGTGGAATGGACAAGTCATTGTTGTTTAGAATTTTGCAACCGG
ATGAAAGTGGACAATCTGCACAATTTCTTCTTAATCAACATTTGGTGGGA
AAACAATCTCAATACGATATGGTTATTGCACCGAATAATCGTTATGCAGC
GGTTGTTTGTCAGGATCGACAAGTCAGAATATACAATATGGTGTCTGGCA
AACAACGCAAAAGTTATCGGGGTTCAACCGGGGACGATGGATACTTATTG
AAGTGCACAATCGACCCATCGGGAACTTACATTGCTACATCGGGTTCAGA
TAAATATATCTCCATTCTGAATTTTGCAACTGGAGAACTTTTAGCTTCAG
TAGCCGGTCATTCTGAGGTTGCGGTTGGATTATGTTTTTTGGGTGACTTG
AAACATTTGGTCTCTGTCAGTTCTGATGGTTGCATATTTGTGTGGAAATT
ACCTGTTGAGATGACTCTTACTATGCATAAACGAATGCAGGAACTGCGTT
CTATTAATAGCATCAGTCTAACTGAAAATGATATAAGAAAAGATACAGCG
CCTCCATCTACAACAGGAACAGTAACACCACCAAGAATATCTGAAGAAAT
CAACATGGAATCGTCAAATACATCTTTAATTAATGCCATAAGTAACAGCT
TACAATCTGGGGAAAATTTAACAGCTGATAATAGTAGTGCTTTCCGATTC
AGTGTCAGTGCTTTGCCGAGTTGGGCACAAAAAAAGTTCAATAGAAGAGA
TTCTGTGACATTCGTCCAGGTAAACATGATGAATGAATTCTGCAGTAGCA
ATATCTGCTCAGTACCTGAGTCCAACACTGAGCATAGTCCACAGCATAAT
ACAAATTATCAACAGCCTGTTGACAAGTTATCACGACGAGTTTCCTACAT
CGCCACTGAAAATGTGATCAGAGATGACGATTCGGATAATCTGGAAGCTG
AGGATGAATCGGAATGGTTTAATCCAGTAGATAAGGCAGAACCAGTTCCA
CCGCTTGATTTGGAATCTTTAATCCAAAGAATAAGCACTGGAGAAGAGGA
CGATGACGAGGATGAAAATATGAAAACCATTAAGGCATTCCCGGTTCGAT
CGATGTCCCTGGAAAATGAAGACTCACATAAAGTGCATTGTGAGTATATA
ATAAGCCAAATCAACGACATTTCCAACAAAGAAGAAGAAGAAAATATTAT
GTCGACCTCAGCCCCCTCTACTCTGGCTACCTGGCTCAACAACAAGGCTG
AAGGTTCCAGTAGTGATGAGCCAATTTCAGGGCATTTAACAGACTCCGAT
GAGCCGCAAAATATGAATATGTTTTCATTTGACAACTGTTTTACCCTGGA
CCCGGGTTCCAGTCATCCCAGTGGATTTCGAAGCAGTCTTACGACGAAAT
ATTTATCCAAAAACTCATACGAACCCTCAATTCTGCAATTTCCATATAAA
CCCGATCAGGATAATAGTGGAAAACACCCAAATCAAAAAGTGACAGATGC
ACCAGCCCCAGTCCAGAAATCTAGTCATATAGTACCGACGACTGCCAAAT
CAAACCTGGCGAAGAAAGCTTTGAGTGAAGTCAATGTCAATCAAACTAAC
GTATTACATAAAAAACCCGAACTAGTCGGAAAGAAATTACTATACACCGC
AAACATAAAATCAACTACATGTTTTGCACAACACACTAAAAATAGATCTG
ACAGCCGTGAACCAAAACCTGAAGTTATGAAAACCAGAAAACCGAGTGGG
CCTTCTTTGTCCAGTCGGCCTGCTATTAGCAAAGCAACTTCAACATCCTC
AGTGTCTACCGTTGGAAGACCTTCAGATTCAAAACTCCGAAGTCTGACTG
ATTGTCAGACAAGTAGATCATCCGATTCAAAGATTTTACCTACAAAACCA
ACCATCAAACCAACCAATCGAGCTCGATGGAGTGAACCAAAAAGGCAGAG
AGAAATGAGAAAAACATGTCCGGTAGATCTAAGAGATATTAAGTCAGCAC
AAAATAGAAGAAATACCAAAGTTGAAACTACTGAAATGACTGTGAATTTT
GACTGCTGTCAAACCACCGGTCCAAGTGAAATTCCAACTGCCGTTAAAAT
AGATTCAAACATTGAAAAACCTATTGACATGAAAAATCATAATGTTGATA
AACATACTGATCGAATAAAATCTCCCAATCCATTATCGAAAGGTGCTTCA
TTTGATATATCCTCTAGGAGAAGTAAAGAGCACGTAATAGATGAGATTGA
AGAAGTTTCATCTCTAAGTCCAAAAAATGATAGAAGTATAGAAATTATTC
CGTCGGCTTTGGACGATATGTTCAAATTTCTTTCAGACCAGAGACAAATT
CCTGACAGTCAAAGAAATTCTGAGTTATCCGTCATCAACCGTGCTATTGC
CAGTAGTGGAGGCGAATGCGTTATAGATAAACCAATATCCTCAGCCGATT
CTTCCACACAATCTGCATTTGATGAGTGGATTGACGAAGTTTGTCGGACA
AACAATGTGGAATTTCTAACGAATATTGTTTTGAAAATCGTCCAGAGATT
TCTTGACAACACCGATTGGAAAACTGAATCAGAAATCGAAGCTGCTCGTC
GACTTTACCCGGAAATCGAGCGAATGTTTCGGCATCTTCGAATGATTTGT
GAGCCTAATTCATTAACCGAAGAAACCGAAGAAACCGATATTTCTGCTTC
AATCATTCGCGATATTGGCGAACGAATTGTCGAAGAAGTCCGGCGGAGAT
TATCGGATTCTCTTTAAATATTTTAGATTGCATTTTTGTTTTTACAGAGT
TCCTAAACTATGAACAAATTCAATTCGATATTTTTTCATTATTTGCCAGT
TTAGACAATCGTATTGTTTAAATTTTTGTAAATTTCTGTTAGTTTTTTTT
TGGGTTTTCAGCCTTGCAATTTTTTAATCTTTCATGAAATTGTACACTAG
ATTGTAATTCGGCAGATTTGTCAAGTTCACCT
back to top

protein sequence of SMED30007126-orf-1

>SMED30007126-orf-1 ID=SMED30007126-orf-1|Name=SMED30007126-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1606bp
MQNTNKKPIVNRPKFLRGKSHHLEISETVFAFDEEIELTLPLTPIAPSFF
SKYFKMNKTGTRSLIGSPKIQRNSIEIKSGISKNLRARSTNCVMPPHLSN
HNDNHCKNQNNQLSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYS
AKRSKQFFIHNAVKSPITAIAFNREGKLLATGESGKSPKVRIWSVETHSQ
LFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKV
TSKVIAIAFSEAGQFFVTVGVRHVRFWYLDNSRSKSKATTPLLGRSAILG
DFMNNTFTDVGCCCLNSGSGSGQMTSSMCSSFTSSTNQSYTYVISQAGQL
MQFTEQRYLDKWVELRTPKATCLTVCESCIMVGCSRGIILIFDTSSLNHI
ATLPMPHYLGINLQNPSDNDFNANNEPVRYPDVVAGKYDHVHSRITCFYN
DHSIYVWDVRDFRKPAKVVSHLYHSGGVWSVEPVSILTKEKSLLDVTSFI
TCSDDETVRFWHLSDSNLTASHSKTENISAQWENDYSKDLIKIIYTDPGL
KSLIEADRNSARNKHQSNEAAVSLKHGIRSIKISPDRQHLAAADREGNLK
FYSLSNSKEFHSIMAHNGEILSIDYFQSPSAPDLVLFCSASRDRVIHVMD
PTQNYKWIQTIDDHSGAIFAAKLVETPNDQEIRLISCGMDKSLLFRILQP
DESGQSAQFLLNQHLVGKQSQYDMVIAPNNRYAAVVCQDRQVRIYNMVSG
KQRKSYRGSTGDDGYLLKCTIDPSGTYIATSGSDKYISILNFATGELLAS
VAGHSEVAVGLCFLGDLKHLVSVSSDGCIFVWKLPVEMTLTMHKRMQELR
SINSISLTENDIRKDTAPPSTTGTVTPPRISEEINMESSNTSLINAISNS
LQSGENLTADNSSAFRFSVSALPSWAQKKFNRRDSVTFVQVNMMNEFCSS
NICSVPESNTEHSPQHNTNYQQPVDKLSRRVSYIATENVIRDDDSDNLEA
EDESEWFNPVDKAEPVPPLDLESLIQRISTGEEDDDEDENMKTIKAFPVR
SMSLENEDSHKVHCEYIISQINDISNKEEEENIMSTSAPSTLATWLNNKA
EGSSSDEPISGHLTDSDEPQNMNMFSFDNCFTLDPGSSHPSGFRSSLTTK
YLSKNSYEPSILQFPYKPDQDNSGKHPNQKVTDAPAPVQKSSHIVPTTAK
SNLAKKALSEVNVNQTNVLHKKPELVGKKLLYTANIKSTTCFAQHTKNRS
DSREPKPEVMKTRKPSGPSLSSRPAISKATSTSSVSTVGRPSDSKLRSLT
DCQTSRSSDSKILPTKPTIKPTNRARWSEPKRQREMRKTCPVDLRDIKSA
QNRRNTKVETTEMTVNFDCCQTTGPSEIPTAVKIDSNIEKPIDMKNHNVD
KHTDRIKSPNPLSKGASFDISSRRSKEHVIDEIEEVSSLSPKNDRSIEII
PSALDDMFKFLSDQRQIPDSQRNSELSVINRAIASSGGECVIDKPISSAD
SSTQSAFDEWIDEVCRTNNVEFLTNIVLKIVQRFLDNTDWKTESEIEAAR
RLYPEIERMFRHLRMICEPNSLTEETEETDISASIIRDIGERIVEEVRRR
LSDSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000535MSP_dom
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
IPR011047Quinoprotein_ADH-like_supfam
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation