Transient receptor potential cation channel subfamily M member

Overview
NameTransient receptor potential cation channel subfamily M member
Smed IDSMED30007120
Length (bp)2595
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel subfamily M member (SMED30007120) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member (SMED30007120) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential cation channel subfamily M member (SMED30007120) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member (SMED30007120) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007120

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30007120SMESG000068504.1 dd_Smed_v4_15098_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30007120SMESG000068504.1 dd_Smed_v4_15098_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007120SMESG000068504.1 dd_Smed_v4_15098_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30007120SMESG000068504.1 dd_Smed_v4_15098_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 54.299 bits (129), Expect = 1.188e-6
Identity = 76/308 (24.68%), Postives = 147/308 (47.73%), Query Frame = 1
Query: 1378 PALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKE---FIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVA--LHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILS 2286
            P +KF+ ++  +I +L L  YI++ ++    S  E I   Y F   +E  R+  +      L++   ++++  N  D+ + ++ SV  + R+ +                ++ G +++      C + + +  +++    + +  GP + MI  M+I D++    + LV ++SFGV  Q++++PN    +PS K L K +F +    I+        D     NE ++    +     +  A  +  ++  Y++V NI+++NLLIAVF+ T  ++   S   WK +RY+ I  F  R  LPPP  I S
Sbjct:  869 PIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPF-------------RSDGRVIY------CVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNE---EPSWK-LAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFS 1152          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 56.6102 bits (135), Expect = 1.205e-7
Identity = 76/308 (24.68%), Postives = 147/308 (47.73%), Query Frame = 1
Query: 1378 PALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKE---FIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVA--LHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILS 2286
            P +KF+ ++  +I +L L  YI++ ++    S  E I   Y F   +E  R+  +      L++   ++++  N  D+ + ++ SV  + R+ +                ++ G +++      C + + +  +++    + +  GP + MI  M+I D++    + LV ++SFGV  Q++++PN    +PS K L K +F +    I+        D     NE ++    +     +  A  +  ++  Y++V NI+++NLLIAVF+ T  ++   S   WK +RY+ I  F  R  LPPP  I S
Sbjct:  392 PIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPF-------------RSDGRVIY------CVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNE---EPSWK-LAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFS 675          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 55.4546 bits (132), Expect = 3.586e-7
Identity = 76/308 (24.68%), Postives = 147/308 (47.73%), Query Frame = 1
Query: 1378 PALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKE---FIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVA--LHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILS 2286
            P +KF+ ++  +I +L L  YI++ ++    S  E I   Y F   +E  R+  +      L++   ++++  N  D+ + ++ SV  + R+ +                ++ G +++      C + + +  +++    + +  GP + MI  M+I D++    + LV ++SFGV  Q++++PN    +PS K L K +F +    I+        D     NE ++    +     +  A  +  ++  Y++V NI+++NLLIAVF+ T  ++   S   WK +RY+ I  F  R  LPPP  I S
Sbjct:  881 PIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPF-------------RSDGRVIY------CVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNE---EPSWK-LAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFS 1164          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 52.373 bits (124), Expect = 2.776e-6
Identity = 76/308 (24.68%), Postives = 147/308 (47.73%), Query Frame = 1
Query: 1378 PALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKE---FIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVA--LHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILS 2286
            P +KF+ ++  +I +L L  YI++ ++    S  E I   Y F   +E  R+  +      L++   ++++  N  D+ + ++ SV  + R+ +                ++ G +++      C + + +  +++    + +  GP + MI  M+I D++    + LV ++SFGV  Q++++PN    +PS K L K +F +    I+        D     NE ++    +     +  A  +  ++  Y++V NI+++NLLIAVF+ T  ++   S   WK +RY+ I  F  R  LPPP  I S
Sbjct:  741 PIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPF-------------RSDGRVIY------CVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNE---EPSWK-LAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFS 1024          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 52.373 bits (124), Expect = 3.210e-6
Identity = 76/308 (24.68%), Postives = 147/308 (47.73%), Query Frame = 1
Query: 1378 PALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKE---FIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVA--LHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILS 2286
            P +KF+ ++  +I +L L  YI++ ++    S  E I   Y F   +E  R+  +      L++   ++++  N  D+ + ++ SV  + R+ +                ++ G +++      C + + +  +++    + +  GP + MI  M+I D++    + LV ++SFGV  Q++++PN    +PS K L K +F +    I+        D     NE ++    +     +  A  +  ++  Y++V NI+++NLLIAVF+ T  ++   S   WK +RY+ I  F  R  LPPP  I S
Sbjct:  853 PIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPF-------------RSDGRVIY------CVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNE---EPSWK-LAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFS 1136          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 52.373 bits (124), Expect = 3.265e-6
Identity = 76/308 (24.68%), Postives = 147/308 (47.73%), Query Frame = 1
Query: 1378 PALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKE---FIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVA--LHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILS 2286
            P +KF+ ++  +I +L L  YI++ ++    S  E I   Y F   +E  R+  +      L++   ++++  N  D+ + ++ SV  + R+ +                ++ G +++      C + + +  +++    + +  GP + MI  M+I D++    + LV ++SFGV  Q++++PN    +PS K L K +F +    I+        D     NE ++    +     +  A  +  ++  Y++V NI+++NLLIAVF+ T  ++   S   WK +RY+ I  F  R  LPPP  I S
Sbjct:  854 PIVKFWFYTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRLQDQPF-------------RSDGRVIY------CVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMI-DMMYFVIIMLVVLMSFGVARQAILFPNE---EPSWK-LAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFS 1137          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A183SVG1 (Ion_trans domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS8209 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.997e-31
Identity = 117/336 (34.82%), Postives = 189/336 (56.25%), Query Frame = 1
Query: 1378 PALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALC---CXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVK---PSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELK--DRDLNVNQDNVRQVALHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIEFLIFIVPQSHDQIDCKNEKHL 2361
            P +KF+ HS  HI+FL +   +L+ R +  + I E +  VY  G  +E  RQ  +       + +++D  N I+I + VI ++TG    I+ K++ + +SP   + + +       F++A     C   LF  + +F   I    GP+LKM+ +M+ KDL+PL  VF +FI+S+GV+FQ L+YPNSFY K     T ++++  F +TI  +  RA YSIF+ +  + E +  D+D+  N    + V L   L VY  +VN++++NLLIA+FS TV++I ++S   W A+RY+ +K +  +S  PPP NILSI+ E       Q+   I C+    L
Sbjct:  233 PEVKFFFHSIFHILFLIVFTLVLLYRFHFQVHITEYLSVVYVAGYFIEEVRQMIIEALRGEFRSYLRDSWNFIEI-TAVISTLTGFGIRIH-KMD-DRASPLDEVQEPS-------FYVARVFYLCGLHLFCMRTLFITSISPIIGPRLKMMADMLRKDLIPLLIVFAIFILSYGVSFQGLLYPNSFYRKYEDNGTYSMDQFPFALTIEKVISRAFYSIFEVSVALEEAECSDKDVCGNPLGSKLVIL-FGLIVYTGIVNLILINLLIALFSNTVSRIGQQSTAHWLADRYQMVKEYQDKSACPPPLNILSILFEVFGCYCQQAACLISCQGRNSL 557          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A0V0J4K6 (Transient receptor potential cation channel subfamily M member 7 OS=Schistocephalus solidus OX=70667 GN=TRPM7 PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.259e-31
Identity = 114/335 (34.03%), Postives = 186/335 (55.52%), Query Frame = 1
Query: 1378 PALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKN--GGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVK---PSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELK--DRDLNVNQDNVRQVALHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIEFLIFIVPQSHDQIDCKNEKHL 2361
            P +KF+ HS  HI+FL +   +L+ R +  + I E +  VY  G  +E  RQ  +       + +++D  N I+I + VI ++TG    I+ K++ + +SP   + + +     + + F + L C   LF   +           P+LKM+ +M+ KDL+PL  VF +FI+S+GV+FQ L+YPNSFY K     T ++++  F +TI  +  RA YSIF+ +  + E +  D+D+  N    + V L   L VY  +VN++++NLLIA+FS TV++I ++S   W A+RY+ +K +  +S  PPP NILSI+ E       Q+   I C+    L
Sbjct:  856 PEVKFFFHSIFHILFLIVFTLVLLYRFHFQVHITEYLSVVYVAGYFIEEVRQMIIEALRGEFRSYLRDSWNFIEI-TAVISTLTGFGIRIH-KMD-DRASPLDEVQEPSFYVARVFYLFGLHLFCMRTLFITSISPIIG------PRLKMMADMLRKDLIPLLIVFAIFILSYGVSFQGLLYPNSFYRKYEDNGTYSMDQFPFALTIEKVISRAFYSIFEVSVALEEAECSDKDVCGNPLGSKLVIL-FGLIVYTGIVNLILINLLIALFSNTVSRIGQQSTAHWLADRYQMVKEYQDKSACPPPLNILSILFEVFGCYCQQAACLISCQGRNSL 1180          

HSP 2 Score: 68.5514 bits (166), Expect = 6.663e-8
Identity = 45/141 (31.91%), Postives = 67/141 (47.52%), Query Frame = 1
Query:  979 NSALFLVLITGRFNLVYPLVRYCQFHVIQYCLLTCLICFKLLSFKIFSDQFKKDLSQVKEFCENYSIAVLSRTAIRDLTEKKETIVNFLTTT-----ELSTKKIILEIAYLGNCFKFLCLPICQRSLTKLWRD---KGPKW 1377
             S LFL +I GRF +   L+R  QF  I  C+L  LI  +L     F +Q + +L Q     E  ++ VL+  +++D T +KE   + L        +LS    ++++     C   L LPICQR L + WR      P W
Sbjct:  579 TSILFLAVICGRFRIAEMLLRMRQFDQIPACVLVVLILKRLFQEPTFPEQVRSELQQFASHVEAIAVDVLTLVSLKDNTPEKEICRSMLNVPLCICGDLS----LIDLFAQAKCTNLLSLPICQRVLDERWRGVLAHLPNW 715          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A0R3W9M3 (ANK_REP_REGION domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7164 PE=3 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.368e-27
Identity = 101/314 (32.17%), Postives = 171/314 (54.46%), Query Frame = 1
Query: 1378 PALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXX---XXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSF---YVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELK-DRDLNVNQDNVRQVALHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIE 2298
            P +KF+ HS  H++FL     +L++ L+  I + E     Y  G  +E  RQ  +         ++KD  N ++IF+ +  +++G    +  K+N +++ P+R        D+   F+IA  C          + +F   I    GP+LKM+ +M+ KDL+PL  VF +F+ S+GVTFQ L+YPNS+    +   TK  E+  F  T+  +  RA YS+F+ +  + E +   D         ++ +  +L  Y V+VN++++NLLIA+FS TV++I  +S   W A+RY+ +K +  +S  PPP N+LSI++E
Sbjct:  659 PEVKFFFHSIFHVIFLVTFTVVLVNSLHFKIRLTECGAITYVIGYAVEEIRQIIIESLRGQFSNYLKDSWNTLEIFA-IAFTLSGFWARVG-KIN-KWAPPER-----EAYDL--SFYIARVCYLFGLHLFCMRTLFITSISPIIGPRLKMMADMLRKDLVPLLIVFAIFLFSYGVTFQGLMYPNSYIQQTLSNGTKVYERMPFLSTVEKLISRAFYSMFEVSVALEEAECKSDEQCGSQLGNKLVILFVLIAYTVIVNLILINLLIALFSNTVSRIGMQSTAHWLADRYQMVKEYQDKSMFPPPLNLLSILVE 962          

HSP 2 Score: 69.3218 bits (168), Expect = 4.176e-8
Identity = 45/152 (29.61%), Postives = 69/152 (45.39%), Query Frame = 1
Query:  982 SALFLVLITGRFNLVYPLVRYCQFHVIQYCLLTCLICFKLLSFKIFSDQFKKDLSQVKEFCENYSIAVLSRTAIRDLTEKKETIVNFLTTT-ELSTKKIILEIAYLGNCFKFLCLPICQRSLTKLWRD---KGPKWPALKFYVHSTIHIVFL 1425
            S LFL L+ GRF +   L+R  QF +I   +L  LI  +L     F +Q + +L Q+    E  ++ VL+  +++D T +KE     L     +     ++++     C   L LPICQR L + WR      P W          + I FL
Sbjct:  389 SILFLALLCGRFRVAEQLLRMRQFDLIPASVLVVLILHRLYQEPTFPEQVRCELQQIASLVEAIAVDVLTLVSLKDNTPEKEICRGILNAPLRICGDLSLIDLCAQAKCTNLLSLPICQRVLDERWRGVLTHLPNWIGFASRFCPLVAIAFL 540          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A564YTV5 (Ion_trans domain-containing protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS9052 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.399e-27
Identity = 111/335 (33.13%), Postives = 173/335 (51.64%), Query Frame = 1
Query: 1354 WRDKGPKW---------PALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIE--LICYVYGFGNLLEIFRQFSLCYRYSFLKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNG---GDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKN---LEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLN--VNQDNVRQVALHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIEF 2301
            W+   P+W         P +KF+ HS  H+VFL     +L++ L+  IS  E   I YV G+G  +E  RQ  +         ++KD  N +++F+  +  V    R+  SK+N E  +P  L +  N      + + F + L C   LF   +           P+LKM+ +M+ KDL+PL  VF +F+ S+GV+FQ L+YPNS+  K         EK  F  TI  +  RA YS+F+ +  + E +    N    +    +  +  +L  Y VVVN++++NLLIA+FS TV++I  +S   W A+RY+ +K +  +S  PPP N+LSI IE 
Sbjct:  356 WQSS-PRWNFVKAIYASPEVKFFFHSIFHVVFLVTFTGVLVNALHFKISWTECGAIAYVIGYG--VEEIRQMIIESLRGQFSNYLKDSWNALELFAIGLTLVGFWVRV--SKINEE--APPELEAYNNTFYFARVCYLFGLHLFCMRTLFITSISPIIG------PRLKMMADMLRKDLVPLIIVFAIFLYSYGVSFQGLMYPNSYKEKRFDNGSVIYEKVPFGETIESMISRAFYSMFEVSTALEEAQCDYGNEFCGKKAGNKFVILFVLIAYTVVVNLILINLLIALFSNTVSRIGMQSTAHWLADRYQMVKEYQDKSMFPPPLNLLSICIEL 677          

HSP 2 Score: 70.8626 bits (172), Expect = 1.106e-8
Identity = 40/126 (31.75%), Postives = 64/126 (50.79%), Query Frame = 1
Query:  988 LFLVLITGRFNLVYPLVRYCQFHVIQYCLLTCLICFKLLSFKIFSDQFKKDLSQVKEFCENYSIAVLSRTAIRDLTEKKETIVNFLTTT-ELSTKKIILEIAYLGNCFKFLCLPICQRSLTKLWRD 1362
            LFL L+ GRF +   L+R  QF +I   +L  LI  +L     F +Q + +L Q+    E+ ++ VL+  +++D T +KE     L     +     ++++    NC   L LPICQR L + WR 
Sbjct:  108 LFLALLCGRFRVAELLLRMRQFDLIPASVLVVLILHRLYQEPTFPEQVRSELQQMASMVESIAVDVLTLVSLKDNTPEKEICRGILNAPLRICGDLSLIDLCAQANCANLLSLPICQRVLDERWRG 233          
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Match: A0A0R3WI04 (ANK_REP_REGION domain-containing protein OS=Hydatigena taeniaeformis OX=6205 PE=3 SV=2)

HSP 1 Score: 131.724 bits (330), Expect = 2.004e-27
Identity = 101/314 (32.17%), Postives = 172/314 (54.78%), Query Frame = 1
Query: 1378 PALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXX---XXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSF---YVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDR-DLNVNQDNVRQVALHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIE 2298
            P +KF+ HS  H++FL     +L++ L+  I + E     Y  G  +E  RQ  +         ++KD  N ++IF+ +  ++TG    +  K+N +++ P+R        D+   F+IA  C          + +F   I    GP+LKM+ +M+ KDL+PL  VF +F+ S+GV+FQ L+YPNS+    +   TK  E+  F  T+  +  RA YS+F+ +  + E + R +         ++ +  +L  Y V+VN++++NLLIA+FS TV++I  +S   W A+RY+ +K +  +S  PPP N+LSI++E
Sbjct:  638 PEVKFFFHSIFHVIFLVTFTVVLVNSLHFKIRLTECGAITYVIGYAVEEVRQIIIESLRGQFTNYLKDSWNTLEIFA-IAFTLTGFWARVG-KIN-QWAPPER-----EAYDL--SFYIARVCYLFGLHLFCMRTLFITSISPIIGPRLKMMADMLRKDLVPLLIVFAIFLFSYGVSFQGLMYPNSYIQQTLSNGTKVYERMPFLSTVEKLISRAFYSMFEVSVALEEAECRPEEQCGSQLGNKLVILFVLIAYTVIVNLILINLLIALFSNTVSRIGMQSTAHWLADRYQMVKEYQDKSMFPPPLNLLSIMVE 941          

HSP 2 Score: 68.9366 bits (167), Expect = 5.499e-8
Identity = 42/136 (30.88%), Postives = 65/136 (47.79%), Query Frame = 1
Query:  982 SALFLVLITGRFNLVYPLVRYCQFHVIQYCLLTCLICFKLLSFKIFSDQFKKDLSQVKEFCENYSIAVLSRTAIRDLTEKKETIVNFLTTT-ELSTKKIILEIAYLGNCFKFLCLPICQRSLTKLWRD---KGPKW 1377
            S LFL L+ GRF +   L+R  QF +I   +L  LI  +L     F +Q + +L Q+    E  ++ VL+  +++D T +KE     L     +     ++++     C   L LPICQR L + WR      P W
Sbjct:  368 SILFLALLCGRFRVAEQLLRMRQFDLIPASVLVVLILHRLYQEPTFPEQVRCELQQIASLVEAIAVDVLTLVSLKDNTPEKEICRGILNAPLRICGDLSLIDLCAQAKCTNLLSLPICQRVLDERWRGVLTHLPNW 503          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Match: hrc (transient receptor potential cation channel subfamily M member 4-like [Source:NCBI gene;Acc:103047479])

HSP 1 Score: 67.3958 bits (163), Expect = 5.704e-11
Identity = 81/263 (30.80%), Postives = 133/263 (50.57%), Query Frame = 1
Query: 1807 PKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNY-----CINELKDRDLNVN--QDNVRQVALHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIEFL---IFIVPQSH------DQIDCKNEKHLLQFMSFKILQAFSLKDFRYKLVEREDEREHQREIEIEYLQTSLNKLENYMNNIKSIL-VDRQ 2544
            PK+ +I+  ++KD+    F   V+++++GV  Q LIY  SF   PS   + +++F    + IF +  Y   D+ +     C   + + D N+   +D      + ILL +Y++V NI+++NLLIA+FS T TK+ E+S V WK +R+K I  +  R  L PPF I S   +F+   I  VP         D ID  N +     M+++ +Q       +  L+  E ++  QRE E E L+    K++  +     I  VDR+
Sbjct:  949 PKI-IIVGKMMKDVFFFLFFLAVWMMAYGVANQGLIY--SF--DPSADRILRRVFYRPYLHIFGQIPYEQMDSGFEWNVTCTTNVTEIDENMEPCRDTRYNWMVVILLMIYLLVTNILLINLLIAMFSYTFTKVQERSDVYWKFQRFKVIIEYHSRPCLAPPFIIFSHFHQFIKRNIRKVPSEKIHQFAVDLIDKANNR----MMTWENIQ-------KENLLSAEGKK--QRESEAERLKRMSVKVDGVLKQTAEIKDVDRR 1193          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:101156483])

HSP 1 Score: 55.0694 bits (131), Expect = 4.154e-7
Identity = 90/402 (22.39%), Postives = 167/402 (41.54%), Query Frame = 1
Query: 1378 PALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSF---LKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVALH-------ILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIEFLIFIVPQSHDQ-------IDCKNEKHLLQFMSFKILQAFSLKDFRYKLVEREDEREHQREIEIEYLQTSLNKLENYMNNIKSIL 2532
            P +KF+ ++  ++ FL L  Y+++ ++    S  E +  VY F + +E  R+  +         +K +  D  N  D  + V   +    R+                    GGD      I  C + + +  +++    + +Q GP + MI  M+  ++  +  + LV ++S+GV  ++++YPN    +PS       +F    +   +   Y I   + C N         ++D+V+ +           L  VY+ V  I+M+NLLIA F+    ++   S + WK +RY  I  +  +  LPPPF +L  V         +  +        +  +++K L  F    +   F  KD ++     E  R   + +E   LQ  L ++ N +N IK  L
Sbjct:  854 PIVKFWSNTLFYLGFLMLYTYVVLVKMIQAPSTQEWVVIVYIFTSAIEKIREMFMSEAGKISQKIKVWFSDYFNVSDFLAIVTFFIGCGLRLA-------------------GGDAFLPGRIVYCLNIIFWYVRLLDILAVNQQAGPYVMMIAKMV-ANMFYIVVIMLVVLLSYGVPRKAILYPNE---EPSWTLARDVVFQPYWMMYGEVYAYEI---DVCANN--------SEDSVKPLCASAGVWLTPFLQAVYLFVQYILMVNLLIAFFNNVYMQVKSISNLVWKFQRYHFIMAYHEKPVLPPPFILLCHVYSLFCMCRKRKKESTYGPKLFLTEEDQKKLHDFEEQCVETYFHEKDDQFHSGSEERIRLTSQRVEAMSLQ--LKEVGNKVNFIKRSL 1219          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:101156483])

HSP 1 Score: 55.0694 bits (131), Expect = 4.265e-7
Identity = 90/402 (22.39%), Postives = 167/402 (41.54%), Query Frame = 1
Query: 1378 PALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSF---LKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVALH-------ILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIEFLIFIVPQSHDQ-------IDCKNEKHLLQFMSFKILQAFSLKDFRYKLVEREDEREHQREIEIEYLQTSLNKLENYMNNIKSIL 2532
            P +KF+ ++  ++ FL L  Y+++ ++    S  E +  VY F + +E  R+  +         +K +  D  N  D  + V   +    R+                    GGD      I  C + + +  +++    + +Q GP + MI  M+  ++  +  + LV ++S+GV  ++++YPN    +PS       +F    +   +   Y I   + C N         ++D+V+ +           L  VY+ V  I+M+NLLIA F+    ++   S + WK +RY  I  +  +  LPPPF +L  V         +  +        +  +++K L  F    +   F  KD ++     E  R   + +E   LQ  L ++ N +N IK  L
Sbjct:  869 PIVKFWSNTLFYLGFLMLYTYVVLVKMIQAPSTQEWVVIVYIFTSAIEKIREMFMSEAGKISQKIKVWFSDYFNVSDFLAIVTFFIGCGLRLA-------------------GGDAFLPGRIVYCLNIIFWYVRLLDILAVNQQAGPYVMMIAKMV-ANMFYIVVIMLVVLLSYGVPRKAILYPNE---EPSWTLARDVVFQPYWMMYGEVYAYEI---DVCANN--------SEDSVKPLCASAGVWLTPFLQAVYLFVQYILMVNLLIAFFNNVYMQVKSISNLVWKFQRYHFIMAYHEKPVLPPPFILLCHVYSLFCMCRKRKKESTYGPKLFLTEEDQKKLHDFEEQCVETYFHEKDDQFHSGSEERIRLTSQRVEAMSLQ--LKEVGNKVNFIKRSL 1234          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 52.373 bits (124), Expect = 2.180e-6
Identity = 99/378 (26.19%), Postives = 179/378 (47.35%), Query Frame = 1
Query: 1378 PALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSF-----LKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYC----INELKDR--DLNVNQDNVRQVALHI-LLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNI---LSIVIEFLIFIVPQSHDQIDCKNEKHLLQFMSFKILQAFSLKDFRYKL-VEREDEREHQREI 2463
            P +KFY +   +  FL L A +L+   +   S+ EL+ YV+ F  + E FRQ   C    F      K +I D  N +D+ S ++  +    R+ +                    ++ +   I LC  F++F  +++    I +  GPK+ +I+  ++KDL    F+  ++++++GV  Q ++  N   +    +    + + I   +  +    + F  + C     + LK +   LN N   V    L I +L VY++  NI+++NLLIA+F+ T  ++ + +   WK +RY+ IK +  R   PPPF I   LS++I   I++        D K++   ++ +S++ L    +KD RY L V++E  R   R I
Sbjct:  780 PQVKFYWNIVSYFFFLNLFAGVLMMDFHATPSVPELLLYVWVFSLVCEEFRQL-FCNSDGFGFKIKAKLYITDLWNILDVLSILLFLLGLAFRLTS--------------------ELFYAGKIVLCIDFVVFCLRLMAIFTISQTLGPKI-IIVRRMMKDLFFFMFLLSIWVVAYGVAKQGILIHNDTRLDWIFRGAIYEPYLIIFGNFPENLAEAKFSLDSCSMNGTDPLKPKCPILNENHAPVFPEWLTITMLCVYLLFANILLLNLLIAIFNFTFQEVQDNTDRIWKFQRYELIKEYHSRPAAPPPFIIFSHLSLLIRS-IWLCKSHCKSKDLKDQTEAMELLSWEAL----MKD-RYLLSVKQETSRSTDRLI 1129          
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 51.9878 bits (123), Expect = 2.846e-6
Identity = 99/378 (26.19%), Postives = 179/378 (47.35%), Query Frame = 1
Query: 1378 PALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSF-----LKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYC----INELKDR--DLNVNQDNVRQVALHI-LLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNI---LSIVIEFLIFIVPQSHDQIDCKNEKHLLQFMSFKILQAFSLKDFRYKL-VEREDEREHQREI 2463
            P +KFY +   +  FL L A +L+   +   S+ EL+ YV+ F  + E FRQ   C    F      K +I D  N +D+ S ++  +    R+ +                    ++ +   I LC  F++F  +++    I +  GPK+ +I+  ++KDL    F+  ++++++GV  Q ++  N   +    +    + + I   +  +    + F  + C     + LK +   LN N   V    L I +L VY++  NI+++NLLIA+F+ T  ++ + +   WK +RY+ IK +  R   PPPF I   LS++I   I++        D K++   ++ +S++ L    +KD RY L V++E  R   R I
Sbjct:  780 PQVKFYWNIVSYFFFLNLFAGVLMMDFHATPSVPELLLYVWVFSLVCEEFRQL-FCNSDGFGFKIKAKLYITDLWNILDVLSILLFLLGLAFRLTS--------------------ELFYAGKIVLCIDFVVFCLRLMAIFTISQTLGPKI-IIVRRMMKDLFFFMFLLSIWVVAYGVAKQGILIHNDTRLDWIFRGAIYEPYLIIFGNFPENLAEAKFSLDSCSMNGTDPLKPKCPILNENHAPVFPEWLTITMLCVYLLFANILLLNLLIAIFNFTFQEVQDNTDRIWKFQRYELIKEYHSRPAAPPPFIIFSHLSLLIRS-IWLCKSHCKSKDLKDQTEAMELLSWEAL----MKD-RYLLSVKQETSRSTDRLI 1129          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000068504.1 (SMESG000068504.1)

HSP 1 Score: 1573.91 bits (4074), Expect = 0.000e+0
Identity = 848/848 (100.00%), Postives = 848/848 (100.00%), Query Frame = 1
Query:   16 MSNSAKSAADYIRNDDKSGFLTNFETFEIEDFYSLSVESLKTAITWCRTKKIYLIHRIIKRTQNVTNLSFLSDNQNLQFYKQHHLLDCDFKTWLHVAVISESHQNGDAKNVTNYVEIVEFLVSKLEVDVSRTDCHGYTALHYACGNMIFTKDLYNLLNHSSKKILILTSKDDLTPLEIASSDIEKLKIIKDVEKEGXXXXXXXXXXXXXXXPKINEGFKLYESKSATEIWIILLNNNDQYELMNFLKKNKNCKEKFYLSSQEFREXXXXXXXXXXXXXXFVQGKKYFLDKNELIDERLYHELTGYQVKGLCQSKSCCQFYFNSALFLVLITGRFNLVYPLVRYCQFHVIQYCLLTCLICFKLLSFKIFSDQFKKDLSQVKEFCENYSIAVLSRTAIRDLTEKKETIVNFLTTTELSTKKIILEIAYLGNCFKFLCLPICQRSLTKLWRDKGPKWPALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVALHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIEFLIFIVPQSHDQIDCKNEKHLLQFMSFKILQAFSLKDFRYKLVEREDEREHQREIEIEYLQTSLNKLENYMNNIKSILVDRQKKGKK 2559
            MSNSAKSAADYIRNDDKSGFLTNFETFEIEDFYSLSVESLKTAITWCRTKKIYLIHRIIKRTQNVTNLSFLSDNQNLQFYKQHHLLDCDFKTWLHVAVISESHQNGDAKNVTNYVEIVEFLVSKLEVDVSRTDCHGYTALHYACGNMIFTKDLYNLLNHSSKKILILTSKDDLTPLEIASSDIEKLKIIKDVEKEGLDILLSEIDSISSAIPKINEGFKLYESKSATEIWIILLNNNDQYELMNFLKKNKNCKEKFYLSSQEFREIISNSNDNGNGLLNFVQGKKYFLDKNELIDERLYHELTGYQVKGLCQSKSCCQFYFNSALFLVLITGRFNLVYPLVRYCQFHVIQYCLLTCLICFKLLSFKIFSDQFKKDLSQVKEFCENYSIAVLSRTAIRDLTEKKETIVNFLTTTELSTKKIILEIAYLGNCFKFLCLPICQRSLTKLWRDKGPKWPALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCSFLLFSFKVIFFGFIFEQFGPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVALHILLFVYIVVVNIMMMNLLIAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIEFLIFIVPQSHDQIDCKNEKHLLQFMSFKILQAFSLKDFRYKLVEREDEREHQREIEIEYLQTSLNKLENYMNNIKSILVDRQKKGKK
Sbjct:    1 MSNSAKSAADYIRNDDKSGFLTNFETFEIEDFYSLSVESLKTAITWCRTKKIYLIHRIIKRTQNVTNLSFLSDNQNLQFYKQHHLLDCDFKTWLHVAVISESHQNGDAKNVTNYVEIVEFLVSKLEVDVSRTDCHGYTALHYACGNMIFTKDLYNLLNHSSKKILILTSKDDLTPLEIASSDIEKLKIIKDVEKEGLDILLSEIDSISSAIPKINEGFKLYESKSATEIWIILLNNNDQYELMNFLKKNKNCKEKFYLSSQEFREIISNSNDNGNGLLNFVQGKKYFLDKNELIDERLYHELTGYQVKGLCQSKSCCQFYFNSALFLVLITGRFNLVYPLVRYCQFHVIQYCLLTCLICFKLLSFKIFSDQFKKDLSQVKEFCENYSIAVLSRTAIRDLTEKKETIVNFLTTTELSTKKIILEIAYLGNCFKFLCLPICQRSLTKLWRDKGPKWPALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCSFLLFSFKVIFFGFIFEQFGPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVALHILLFVYIVVVNIMMMNLLIAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIEFLIFIVPQSHDQIDCKNEKHLLQFMSFKILQAFSLKDFRYKLVEREDEREHQREIEIEYLQTSLNKLENYMNNIKSILVDRQKKGKK 848          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000068518.1 (SMESG000068518.1)

HSP 1 Score: 479.174 bits (1232), Expect = 3.198e-156
Identity = 336/851 (39.48%), Postives = 515/851 (60.52%), Query Frame = 1
Query:   25 SAKSAADYIRNDDKSGFLTNFETFEIE--DFYSLSVESLK-TAITWCRTKKIYLIHRIIKRTQNVTNLSFLSDNQNLQFYKQHHLLDCDFKTWLHVAVISESHQNGDAKNVTNYVEIVEFLVSKLEVDVSRTDCHGYTALHYACGNMIFTKDLYNLLNHSSKKILILTSKDDLTPLEIASSDIEKLKIIKDVEKEGXXXXXXXXXXXXXXXPKINEGFKLYESKSATEIWIILLNNNDQYELMNFLKKNKNCKEKFYLSSQEFREXXXXXXXXXXXXXXFVQGKKYFLDKNELID-ERLYHELTGYQVKGLC-----QSKSCCQFYFNSALFLVLITGRFNLVYPLVRYCQFHVIQYCLLTCLICFKLLSFKIFSDQFKKDLSQVKEFCENYSIAVLSRTAIRDLTEKKETIVNFLTTTELSTKKIILEIAYLGNCFKFLCLPICQRSLTKLWRDKGPKWPALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVALHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIEFL--------IFIVPQSHDQIDCKN----EKHLLQFMSFKILQAFSLKDFRYKLVEREDEREHQREIEIEYLQTSLNKLENYMN 2514
            S     + IR+++   F ++     I   DF  L  +  K TAI WCR K +YL+H++  +   V ++ F++  ++LQ++ ++HL D + KTWLH+AV     QN      +  +EI+ FL+  + ++V +TD + YTALH AC    + +   +LL   S++ LI  S DD+TPLE+  +D ++        K+     L +     S    + E F+  +  +  ++W+ LL  +++Y L+NF+KK  N +  +YLSS+EF  +I+N ++NG G++ +++ K  F+  +   + E+++ +LT  + K        + +   +FY NSALFL LITGRF +V  L+  CQF  I Y LL CLIC  LLS   F DQ   ++  +KEFCE YSIAV++R  IRD T  K+ I  FL    +   + IL+IA+L    KFL LP CQ++LT+LW     + PALKFY+HS IH VFLGL +Y LI   Y +IS+IE++CY+YG G  +E  RQ  +  +  FLK + KDPTN IDI +T  + V G    ++ ++       +  L  ++    LF   + LC S +LF  ++I+FG IFEQ GPKLKMI  MI++DL+PL F+F+VFI SFG+TFQ+L+YPNSFY    +++ EKK     + DIFKR+TY+IF T+Y + E++ ++     +    +A+  LL +Y++VVNIM+MNLLIA+FS TVT II+KS  SWKA RYKDIK +  RS LPPP NI  I+ E +        +FIV +  D I+       EK+    +SFKI+QAF+L+  R+KL+  +++RE++R+ EI+ ++ ++ K+++ ++
Sbjct:    6 STLDLVELIRSNESEKFKSSIHNLPINVFDFTDLLTDKEKETAIEWCREKGVYLLHKMFAKVTKVESVDFIT--RHLQYFIENHLKDEEDKTWLHIAV-----QN------SRKIEILRFLIEDVSINVEKTDINKYTALHLACQKPEYVEGELDLLIKKSEQ-LIAKSFDDITPLELVCND-KRKLKDIKKNKKINLNHLLKQIDKISNGLLVTEDFEFNDKLTLEKVWLSLLQKDNKYRLINFVKKYDNLENMYYLSSKEFSYVINNCHENGQGIMTYIKNK--FIKSHSSFNLEKIFTDLTDLKTKDPSIKEPEKMEENHEFY-NSALFLALITGRFEMVPTLLTCCQFDSITYGLLVCLICHNLLSVTDFPDQVLGNIRNLKEFCEKYSIAVMNRAVIRDFTPDKKIISGFLNKPNILAGQRILDIAFLSKSTKFLSLPSCQKALTRLWYRGTRRCPALKFYMHSFIHCVFLGLFSYFLIINFYSNISVIEIVCYLYGIGYFMEETRQIYIYRQKDFLKSYFKDPTNYIDISATGFM-VFGFILRVSLQIPKHPDQSEAGLFIESTNVFLFISRLILCISMILFFMRIIYFGSIFEQIGPKLKMISIMIVRDLMPLIFIFVVFITSFGITFQALLYPNSFYGLNFSQSFEKKSISFILGDIFKRSTYTIFHTHYALEEMEHQETPYFVNKEGNIAVFFLLVLYMIVVNIMLMNLLIALFSNTVTTIIQKSSESWKANRYKDIKEYYDRSLLPPPMNIFEIIFEIIYVFCKKPKVFIVNEEGDGINLIQDEFVEKNENISVSFKIIQAFALRGRRHKLIVSQEDREYERKTEIKTMKKAIEKIKHNLD 837          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000068517.1 (SMESG000068517.1)

HSP 1 Score: 476.478 bits (1225), Expect = 2.635e-155
Identity = 321/813 (39.48%), Postives = 482/813 (59.29%), Query Frame = 1
Query:  115 SLSVESLKTAITWCRTKKIYLIHRIIKRTQNVTNLSFLSDNQNLQFYKQHHLLDCDFKTWLHVAVISESHQNGDAKNVTNYVEIVEFLVSKLEVDVSRTDCHGYTALHYACGNMIFTKDLYNLLNHSSKKILILTSKDDLTPLEIASSDIEKLKIIKDVEKEGXXXXXXXXXXXXXXXPKINEGFKLYESKSATEIWIILLNNNDQYELMNFLKKNKNCKEKFYLSSQEFREXXXXXXXXXXXXXXFVQGKKYFLDKNELIDERLYHELTGYQVKGLCQS--KSCCQFYFNSALFLVLITGRFNLVYPLVRYCQFHVIQYCLLTCLICFKLLSFKIFSDQFKKDLSQVKEFCENYSIAVLSRTAIRDLTEKKETIVNFLTTTELSTKKIILEIAYLGNCFKFLCLPICQRSLTKLWRDKGPKWPALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRY-SFLKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVALHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIEFLIFIVPQSH--------------DQIDCKNEKHLLQFMSFKILQAFSLKDFRYKLVEREDEREHQREIEIEYLQTSLNKLE 2502
            +L+ E  K A+ WCR   IYL+H++        +L FL +N  L+ YK +HL D   +TWLH+AV  +             V+I+ FLV+++++D+  TD + +TALH AC    +      +L   S + L+  S DD+TPLE+A +D+ KLK +K      ++ LL  ID +S  +P+  E F   +  S   +W+ LL  ND++ L  ++KK+     K+Y++  E  EI+  S +NG+G+L +++ K  +L+ N  + E ++  LTG  ++ +  +        Y+ SALF+ LITGRF LV  L+ YCQF +I Y L+TCLIC KL+  K F +Q   D+ ++K+ CE YS+AVL+RT IRDLT  K  I  FL  T+    + IL+IA+LG C KFL LP CQ + TK W  +  + PALKFY+HS  H +FLGLL+Y+L+   Y   + IE+ICY YG G   E  RQ  + Y+   F   ++++ +N IDI S   L ++G  RI            + L  +    ++ F   + LC S +L+  ++I+FG IFEQ GPKLKM+  MII+DL+PL F+F VFI +FG+ FQSL++PNSFY        EKK   + +  + +R+TY+IFDT+Y   EL+  +     ++  ++A++ LL +Y+VVVNIM+ NLLIA+FS TVT II+KSR SWKA RYKDIK +  RS  PPP N+  I+IE ++ +  +                   +  NE    QF+SFKI+QAF+LKD RYKL+  E+++E++  IEI+ ++  +  ++
Sbjct:   38 TLNDEEKKKAVDWCREIGIYLVHKLFIFVTKTESLLFLQNN--LELYKTNHLCDEKERTWLHIAVRYDRD-----------VKILSFLVNEIQIDIRWTDSNKFTALHLACQKSNYIPGELEILIKESNQ-LVARSFDDVTPLELACADMRKLKDLKRNRIVNINELLQHIDKVSFGLPE-TEDFYFNDKISTKRMWLNLLQKNDKHILSYYMKKDPKFYLKYYMTVAEMTEIVDLSLENGHGVLTYIKNK--YLENNVSMGE-IFVSLTGLNLEKIQSNDENETTYVYYRSALFMTLITGRFELVPTLLAYCQFDLISYGLMTCLICKKLVVIKEFPEQVIVDIRKLKDCCEKYSVAVLNRTVIRDLTPGKTIISGFLNKTDKLVGQNILDIAHLGKCSKFLGLPTCQETFTKQWNTRNRQCPALKFYLHSLFHCIFLGLLSYVLVYDFYAKATAIEIICYAYGLGYFFEEVRQIYINYKEDGFNSSYLEEASNYIDIGSIFTLILSGTLRIFLPIKTYPNQGDEGLFLESKDFNLFF-IRLILCISLILYYMRIIYFGSIFEQLGPKLKMMARMIIQDLMPLIFIFAVFIAAFGIAFQSLMFPNSFYPIKGNSTFEKKSIYVILRALIRRSTYTIFDTHYPFEELEHDEGGYVVNSEGKIAVYFLLIIYMVVVNIMLTNLLIALFSNTVTVIIQKSRDSWKANRYKDIKEYFDRSLFPPPLNVAEILIEIIVKVYRKKQLVKMKDLTLNEEEMQNFENANETQKTQFISFKIIQAFTLKDCRYKLILNENDKEYENRIEIKCIKKGIESID 831          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000068496.1 (SMESG000068496.1)

HSP 1 Score: 462.225 bits (1188), Expect = 5.789e-150
Identity = 322/815 (39.51%), Postives = 488/815 (59.88%), Query Frame = 1
Query:   97 EIEDFYSLSVESLKTAITWCRTKKIYLIHRIIKRTQNVTNLSFLSDNQNLQFYKQHHLLDCDFKTWLHVAVISESHQNGDAKNVTNYVEIVEFLVSKLEVDVSRTDCHGYTALHYACGNMIFTKDLYNLLNHSSKKILILTSKDDLTPLEIASSDIEKLKIIKDVEKEGXXXXXXXXXXXXXXXPKINEGFKLYESKSATEIWIILLNNNDQYELMNFLKKNKNCKEKFYLSSQEFREXXXXXXXXXXXXXXFVQGKKYFLDKNELIDERLYHELTGYQVKGLCQSKSCCQFYFNSALFLVLITGRFNLVYPLVRYCQFHVIQYCLLTCLICFKLLSFKIFSDQFKKDLSQVKEFCENYSIAVLSRTAIRDLTEKKETIVNFLTTTELSTKKIILEIAYLGNCFKFLCLPICQRSLTKLWRDKGPKWPALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYRYSFLKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVALHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIEFLIFIVPQSHDQIDCKNEKHL---------------LQFMSFKILQAFSLKDFRYKLVEREDEREHQREIEIEYLQTSLNK 2496
            EI D   LS +  +  I W +   +YL+H++      ++++ FL  N  L ++KQ+HLLD + +TWLHVAV+               +EI++F+V  L +DV + D +G TALH AC  + + +   N+L  +SK+ LI  S DD+TPLE++  D+ KLK I+      L  LL  ID ISS +P+ +E F   E+    ++W+ LL+ ND++ L+N +KK+ N K K+Y+    F +I+   ++NG G++ +V+ K++F++K     E ++ +L+G  +K           ++ S++FL LITGRF LV  L+ YCQF +I + L+ C IC  L   KIF DQ  +++ ++K+F E Y+IAVL+RT IRD T  K++I NFL  ++    K IL+IA+LG C +FL LP CQ +  ++W     K PA+K+ +HS IH+VFL L A++LI   Y  IS  E+ICY+YG G LLE  RQ  +  +   +  ++++PTN ID+ S V + +    R +            RLL+     D  F     LC SF+L+S ++I+ G +F+Q GPKLKMI  MI++DLLPL F+FLVFI SFGVTFQSL+Y N         +  +K     I  IF+RAT++IFD  Y + E+ + D   +     +VA +  L ++IVVVN+M+MNLLIA+FS TVT+II+KS  SWKA+RYKDIK +  RS LPPP NIL I  E ++ ++     +    +  +L                +F SF+ILQAFSL+D RYKL++ E+++E++R++ I  +   L++
Sbjct:   37 EITD--KLSDKEKERLIKWSKDLGVYLVHQLTGTATKLSSIEFLKIN--LTYFKQNHLLDQEKRTWLHVAVVCNRS-----------IEILKFIVEDLYLDVEKQDINGNTALHNACQKVKYNEGELNVLIKNSKQ-LISQSLDDVTPLELSCGDLRKLKDIQKNPLVNLKELLESIDDISSGLPQ-HEEFYFNENLPMDKMWLNLLHKNDKHRLINSMKKDPNFKSKYYIQPDLFIDIVMACHENGQGIVTYVK-KQFFINKQTKSPEEIFKQLSGLNLKESAHLNE--NVFYTSSVFLSLITGRFELVPTLLSYCQFEIIPFGLIICRICHNLTHVKIFPDQVLENILKLKDFSEKYAIAVLNRTVIRDTTMNKKSISNFLNKSKY-LDKTILDIAHLGKCKRFLSLPSCQGAFDEIWWKNNRKCPAVKYMIHSIIHLVFLILFAFVLISEFYFFISPEEIICYIYGLGYLLEELRQIYILKQNRLMMFYLRNPTNIIDMTSLVFMGIGASLRFM--------FQSDRLLNGLKIQDQFFVTRFVLCISFILYSMRIIYLGSVFKQLGPKLKMISKMIVQDLLPLVFIFLVFIFSFGVTFQSLLYTNVLLGSSKLNSSARKSPIYIISTIFRRATFTIFDVQYTLQEITELDGTNSVTYNGRVATYFFLIIFIVVVNVMLMNLLIALFSYTVTEIIQKSNESWKADRYKDIKEYFDRSTLPPPLNILEITTEIVVNLIKLKRTENRKSSNLNLETFQLLEGQQMFGKKSKFTSFEILQAFSLQDCRYKLIQTEEDKEYERQMNILLINRKLDE 822          
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Match: SMESG000068502.1 (SMESG000068502.1)

HSP 1 Score: 388.652 bits (997), Expect = 6.704e-122
Identity = 299/836 (35.77%), Postives = 493/836 (58.97%), Query Frame = 1
Query:   40 ADYIRNDDKSGFLTNFETFEIEDFYSLSVESLKTAITWCRTKKIYLIHRIIKRTQNVTNLSFLSDNQ-NLQFYKQHHLLDCDFKTWLHVAVISESHQNGDAKNVTNYVEIVEFLVSKLEVDVSRTDCHGYTALHYACGNMIFTKDLYNLLNHSSKKILILTSKDDLTPLEIASSDIEKLKIIKDVEKEGXXXXXXXXXXXXXXXPKINEGFKLYESKSATEIWIILLNNNDQYELMNFLKKNKNCKEKFYLSSQEFREXXXXXXXXXXXXXXFVQGKKYFLDKNELIDERLYHELTGYQVKGLCQSKSCCQFYFNSALFLVLITGRFNLVYPLVRYCQFHVIQYCLLTCLICFKLLSFKIFSDQFKKDLSQVKEFCENYSIAVLSRTAIRDLTEKKETIVNFLTTTELSTKKIILEIAYLGNCFKFLCLPICQRSLTKLWRDKGPKWPALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVYGFGNLLEIFRQFSLCYR-YSFLKEFIKDPTNCIDIFSTVILSVTGLTRIINSKLNVEYSSPQRLLSQKNGGDILFGFHIALCCXXXXXXXXXXXXXXXXXXXXPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTKNLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVALHILLFVYXXXXXXXXXXXXXAVFSETVTKIIEKSRVSWKAERYKDIKLFMCRSFLPPPFNILSIVIEFLIFIVPQ---SHDQIDCKNEKHLLQFMSFKILQAFSLKDFRYKLVEREDEREHQREIEIEYLQTSLNKLENYMNNIKSIL 2532
             DY +N D+ G L   +    ED   + +  LK+       K IY  HR+    Q VT    L+  + N + Y + +LLD D +TWLH AV ++S ++         + I++FL+  L+V+V+++D +  TALH AC      K+    L  +  + L   S D  TPLE+A  +I  L+II +  K+  D +L +  +IS +IP   + F   ++++ T +W+ +L  +D+Y L   +K ++N  ++FYL  +EF +++ N +DNG GLL + + +   + + +   E L+  L+G ++     S    + YF SALFL L+TGRF LV  L+ Y Q +VI Y +LTCLIC  L   K F D   +++ +VK+FCE+YSIAVL++T +RD T +K+ +  +L  +E   K  ILEIA+     KFL LP CQ+SL +LW  K    P  KFY H+  HI+FLG+ +YIL+   Y   S +E+ CY+YGFG  LE    ++L Y+  +F++    D    I+I   +++ +  + RII     ++ +   +L  +++   +L    + LC S + F  ++I+FGFIF+  GPKL+MI  MI+ DLLPL+F+FL+F+ISFG+TFQS+++PN+ YV    +  ++K     I +IF+RA ++IF++ Y I E++D+++        + ++H+L  +Y+++ N+M+MNLLIA+FS TV  II +S+ SW A RY     +  RSF+PPPFNI  IV   ++F+  +   + + +  KN+   L+ ++F+ILQ F+ KD R+KL++  + + +++E+++  L+ S+N +   +  +K IL
Sbjct:   14 GDYFKNLDEEGILKILQ----EDNLGIKINELKS-------KNIYFFHRLF---QIVTCFQKLNPIKCNFKNYMKDYLLDSDGRTWLHYAVENKSTED---------ISILKFLIDDLKVEVNKSDHYCRTALHIACAKSDCAKNKIKFLIENGAE-LFSKSLDKKTPLELACCNIGNLEIIINSVKD-FDSVLRKKSNISESIPGPLKPFYYIKNQNPTTMWLSILKYDDKYRLQFMMKDSENFFDRFYLKEKEFSDVLCNCHDNGTGLLQYCRKQLSVVTERKC--ENLFCNLSGLKITN--NSNDEDKVYFKSALFLALLTGRFELVPSLLMYSQLNVILYGMLTCLICRTLSKIKKFPDHVIEEIMKVKQFCEDYSIAVLNKTEVRDSTMEKKVVFEYLNQSERFFKHTILEIAFFSKSSKFLGLPSCQKSLAQLWNPKSRNRPIAKFYAHAISHIIFLGIFSYILLWDFYLKFSPMEIFCYLYGFGYFLEE-ASYALKYKQINFIRLLKNDARLYINISGIILMLIGFIIRIIVKDERLQTTQFDQLY-KESLNPLLNISRLILCLSLIFFYIRIIYFGFIFKILGPKLEMISKMIVNDLLPLTFIFLIFVISFGITFQSILFPNNLYVFILNRTSDRKSPGYIIQEIFRRAAFTIFNSRYIIEEIEDKEIVYQISENSKRSIHMLTILYMILANVMLMNLLIALFSYTVQTIIIQSKESWAANRYGYTFKYFYRSFMPPPFNIFEIVRRAILFLCHKKRMNSNYLHPKNDP--LKELAFRILQIFACKDCRFKLIKSSENKNYEKEMKLNSLKNSINSINRSILTVKEIL 816          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TRPM31.188e-624.68transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm31.205e-724.68transient receptor potential cation channel, subfa... [more]
Trpm33.586e-724.68transient receptor potential cation channel, subfa... [more]
Trpm32.776e-624.68transient receptor potential cation channel, subfa... [more]
Trpm33.210e-624.68transient receptor potential cation channel, subfa... [more]
Trpm33.265e-624.68transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183SVG11.997e-3134.82Ion_trans domain-containing protein OS=Schistoceph... [more]
A0A0V0J4K62.259e-3134.03Transient receptor potential cation channel subfam... [more]
A0A0R3W9M31.368e-2732.17ANK_REP_REGION domain-containing protein OS=Taenia... [more]
A0A564YTV51.399e-2733.13Ion_trans domain-containing protein (Fragment) OS=... [more]
A0A0R3WI042.004e-2732.17ANK_REP_REGION domain-containing protein OS=Hydati... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hrc5.704e-1130.80transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
trpm74.154e-722.39transient receptor potential cation channel subfam... [more]
trpm74.265e-722.39transient receptor potential cation channel subfam... [more]
trpm22.180e-626.19transient receptor potential cation channel subfam... [more]
trpm22.846e-626.19transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068504.10.000e+0100.00SMESG000068504.1[more]
SMESG000068518.13.198e-15639.48SMESG000068518.1[more]
SMESG000068517.12.635e-15539.48SMESG000068517.1[more]
SMESG000068496.15.789e-15039.51SMESG000068496.1[more]
SMESG000068502.16.704e-12235.77SMESG000068502.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007120 ID=SMED30007120|Name=Transient receptor potential cation channel subfamily M member|organism=Schmidtea mediterranea sexual|type=transcript|length=2595bp
ATCAATTTCAGTGAAATGTCAAATAGTGCAAAATCTGCAGCAGATTATAT
CAGAAATGATGACAAATCAGGATTTCTGACTAATTTTGAAACTTTTGAAA
TCGAGGACTTTTATTCTCTTTCGGTTGAAAGTTTGAAAACCGCAATAACC
TGGTGCAGAACGAAAAAAATTTATTTGATTCATAGAATTATCAAAAGAAC
CCAAAACGTTACTAATCTGTCATTTCTTTCTGACAATCAAAACCTCCAAT
TTTACAAGCAACATCATTTATTAGATTGTGACTTCAAAACCTGGCTTCAT
GTTGCAGTAATATCTGAGAGCCACCAAAATGGAGATGCTAAAAATGTAAC
TAATTATGTGGAAATAGTTGAATTTTTAGTGAGTAAACTGGAAGTTGACG
TTTCTCGAACGGATTGTCACGGATATACGGCTCTTCATTATGCTTGTGGA
AACATGATTTTCACCAAAGATTTATACAATTTGCTAAATCATAGTTCGAA
AAAAATCTTGATTTTAACTTCAAAAGATGATCTAACTCCCCTAGAAATCG
CAAGCAGTGACATTGAGAAATTGAAAATAATAAAAGACGTCGAAAAAGAA
GGCTTGGATATCTTATTGTCTGAAATTGACAGCATTTCCTCAGCGATACC
GAAGATAAATGAAGGTTTCAAGCTCTACGAAAGTAAATCGGCAACTGAAA
TCTGGATAATACTGTTAAACAATAATGACCAATATGAGTTGATGAATTTT
TTGAAGAAAAATAAAAACTGCAAAGAAAAATTTTATTTATCCTCTCAAGA
ATTTCGGGAAATAATTTCAAACTCCAACGATAACGGAAATGGGCTACTCA
ATTTTGTTCAAGGCAAAAAATATTTTTTGGACAAAAATGAACTAATTGAT
GAAAGACTTTACCATGAATTGACTGGATATCAGGTGAAAGGTCTTTGCCA
AAGTAAATCCTGTTGTCAATTTTATTTCAATTCGGCTCTTTTTTTGGTCC
TCATTACTGGGAGATTCAATTTAGTTTATCCGCTTGTTCGTTATTGTCAA
TTTCATGTCATTCAATATTGTCTCCTCACTTGTTTGATCTGCTTTAAACT
GTTGTCATTTAAAATCTTTTCAGATCAATTCAAAAAAGACCTTAGTCAAG
TAAAGGAATTCTGTGAAAACTATTCCATAGCAGTTTTGAGTCGAACTGCA
ATTCGAGATTTAACAGAAAAAAAAGAAACAATTGTAAATTTTCTAACAAC
AACAGAACTGTCAACCAAAAAGATAATTCTAGAAATTGCCTATCTGGGAA
ATTGTTTCAAGTTTCTATGTTTACCAATTTGCCAGAGATCTTTGACAAAG
TTATGGAGGGATAAAGGCCCAAAATGGCCAGCTTTAAAATTTTACGTCCA
TTCAACTATTCATATAGTCTTTCTAGGATTGCTTGCTTATATACTTATAG
ACAGACTTTACCATGACATTTCAATAATTGAACTTATTTGCTATGTCTAT
GGGTTTGGAAATCTTTTAGAAATATTTCGCCAATTTTCCCTTTGCTATAG
ATATTCATTTCTGAAAGAATTCATCAAAGATCCAACAAATTGCATTGATA
TATTCTCAACTGTCATTTTATCAGTAACCGGACTAACTCGAATTATAAAT
TCAAAGCTAAATGTAGAATATTCTTCACCCCAGAGGTTGCTTTCACAAAA
GAATGGGGGCGATATTCTGTTTGGTTTTCACATAGCCTTGTGCTGTTCAT
TTTTACTGTTTTCTTTCAAGGTCATTTTTTTCGGGTTCATTTTCGAACAA
TTCGGTCCAAAACTGAAAATGATAATAAACATGATTATCAAAGATTTGTT
GCCACTGAGTTTTGTATTTTTGGTTTTTATCATTTCATTTGGAGTCACCT
TTCAATCTTTGATATATCCCAATAGTTTCTATGTCAAACCATCCACAAAG
AACTTGGAGAAAAAGATGTTTGATATTACAATAATAGATATTTTCAAGCG
GGCAACCTATTCAATTTTTGATACAAATTATTGTATCAATGAATTAAAGG
ATAGAGATCTCAATGTCAACCAGGACAATGTCCGTCAGGTAGCCTTACAT
ATATTATTGTTTGTCTACATAGTGGTTGTAAATATCATGATGATGAATTT
GTTAATAGCAGTCTTCAGTGAAACGGTCACCAAAATAATCGAAAAGTCTC
GAGTTTCCTGGAAGGCTGAAAGATATAAAGATATAAAATTATTCATGTGT
CGATCATTTCTCCCCCCACCTTTTAATATTCTTAGCATTGTAATAGAATT
TTTAATTTTCATTGTTCCTCAATCTCATGATCAAATCGACTGCAAAAATG
AGAAACATCTTTTGCAGTTTATGTCTTTCAAAATTTTACAAGCTTTTAGT
TTGAAGGATTTTCGCTATAAACTAGTGGAACGAGAAGATGAAAGAGAACA
TCAAAGAGAAATTGAAATAGAATACCTTCAAACTTCTTTGAATAAATTAG
AAAATTATATGAACAATATAAAATCAATTTTAGTTGATAGACAAAAAAAA
GGTAAAAAATAGATGTGCAGTTTCAGATTTTTATTTCTTAGACAT
back to top

protein sequence of SMED30007120-orf-1

>SMED30007120-orf-1 ID=SMED30007120-orf-1|Name=SMED30007120-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=854bp
INFSEMSNSAKSAADYIRNDDKSGFLTNFETFEIEDFYSLSVESLKTAIT
WCRTKKIYLIHRIIKRTQNVTNLSFLSDNQNLQFYKQHHLLDCDFKTWLH
VAVISESHQNGDAKNVTNYVEIVEFLVSKLEVDVSRTDCHGYTALHYACG
NMIFTKDLYNLLNHSSKKILILTSKDDLTPLEIASSDIEKLKIIKDVEKE
GLDILLSEIDSISSAIPKINEGFKLYESKSATEIWIILLNNNDQYELMNF
LKKNKNCKEKFYLSSQEFREIISNSNDNGNGLLNFVQGKKYFLDKNELID
ERLYHELTGYQVKGLCQSKSCCQFYFNSALFLVLITGRFNLVYPLVRYCQ
FHVIQYCLLTCLICFKLLSFKIFSDQFKKDLSQVKEFCENYSIAVLSRTA
IRDLTEKKETIVNFLTTTELSTKKIILEIAYLGNCFKFLCLPICQRSLTK
LWRDKGPKWPALKFYVHSTIHIVFLGLLAYILIDRLYHDISIIELICYVY
GFGNLLEIFRQFSLCYRYSFLKEFIKDPTNCIDIFSTVILSVTGLTRIIN
SKLNVEYSSPQRLLSQKNGGDILFGFHIALCCSFLLFSFKVIFFGFIFEQ
FGPKLKMIINMIIKDLLPLSFVFLVFIISFGVTFQSLIYPNSFYVKPSTK
NLEKKMFDITIIDIFKRATYSIFDTNYCINELKDRDLNVNQDNVRQVALH
ILLFVYIVVVNIMMMNLLIAVFSETVTKIIEKSRVSWKAERYKDIKLFMC
RSFLPPPFNILSIVIEFLIFIVPQSHDQIDCKNEKHLLQFMSFKILQAFS
LKDFRYKLVEREDEREHQREIEIEYLQTSLNKLENYMNNIKSILVDRQKK
GKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 51..200
e-value: 1.2E-9
score: 40.0
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 81..184
NoneNo IPR availablePANTHERPTHR13800TRANSIENT RECEPTOR POTENTIAL CATION CHANNEL, SUBFAMILY M, MEMBER 6coord: 357..840
NoneNo IPR availableTMHMMTMhelixcoord: 427..449
NoneNo IPR availableTMHMMTMhelixcoord: 616..638
NoneNo IPR availableTMHMMTMhelixcoord: 351..373
NoneNo IPR availableTMHMMTMhelixcoord: 697..719
NoneNo IPR availableTMHMMTMhelixcoord: 490..512
NoneNo IPR availableTMHMMTMhelixcoord: 573..595
NoneNo IPR availableTMHMMTMhelixcoord: 324..346
NoneNo IPR availableTMHMMTMhelixcoord: 464..483