slc7a-7

Overview
Nameslc7a-7 (AKN21451.1)
Smed IDSMED30007103
Length (bp)1638
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc7a-7 (SMED30007103) t-SNE clustered cells

Violin plots show distribution of expression levels for slc7a-7 (SMED30007103) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc7a-7 (SMED30007103) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc7a-7 (SMED30007103) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007103

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30007103SMESG000044247.1 dd_Smed_v4_2179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007103SMESG000044247.1 dd_Smed_v4_2179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007103SMESG000044247.1 dd_Smed_v4_2179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30007103SMESG000044247.1 dd_Smed_v4_2179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30007103SMESG000044247.1 dd_Smed_v4_2179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30007103SMESG000044247.1 OX_Smed_1.0.10660ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynx musculatureSMED30007103SMESG000044247.1 dd_Smed_v4_2179_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc7a-7 vs. Ensembl Human
Match: SLC7A6 (solute carrier family 7 member 6 [Source:HGNC Symbol;Acc:HGNC:11064])

HSP 1 Score: 363.999 bits (933), Expect = 1.367e-119
Identity = 197/480 (41.04%), Postives = 308/480 (64.17%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGV---KWKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            E+       + +  QLKKEI+L+NG+ +V+G+MIGSGIF+SP GV +   S G +L++W + G+FS++GA CY ELG  I +S   YAYI +AFG F+AF+RLW+ ++V  P   AI+++TFA YI++P F +C  P +A R LAA+CI LLTF+NC  VK  TRVQD FT+AK++AL+ +I+ G+VKLC G + +++  F  ++ D+G L++  Y+ LF+Y GW+ LN + EE+KNP ++LP A+ IS  IVT++Y+L NV+Y+T+L+  ++  ++AVAV      F +  W IP+ V++S FGG+N  I  +SR+F V ++   +P  L+MI     TPIP+++F   ++++YL+  D++ L+NY  F  W     +++  LY R+  K  K  RP  + + FPIV+ + S F+++         S++G  I L+ VP Y +GV   + ++P      L   T+  Q+L   V TE D
Sbjct:   26 EDVSSPPQRSSETMQLKKEISLLNGVSLVVGNMIGSGIFVSPKGVLVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLVVEPTGQAIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTFVNCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVLSSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIHIERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRW--KEPKRPRPLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFIRNVLAAITRGTQQLCFCVLTELD 503          
BLAST of slc7a-7 vs. Ensembl Human
Match: SLC7A6 (solute carrier family 7 member 6 [Source:HGNC Symbol;Acc:HGNC:11064])

HSP 1 Score: 363.999 bits (933), Expect = 1.367e-119
Identity = 197/480 (41.04%), Postives = 308/480 (64.17%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGV---KWKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            E+       + +  QLKKEI+L+NG+ +V+G+MIGSGIF+SP GV +   S G +L++W + G+FS++GA CY ELG  I +S   YAYI +AFG F+AF+RLW+ ++V  P   AI+++TFA YI++P F +C  P +A R LAA+CI LLTF+NC  VK  TRVQD FT+AK++AL+ +I+ G+VKLC G + +++  F  ++ D+G L++  Y+ LF+Y GW+ LN + EE+KNP ++LP A+ IS  IVT++Y+L NV+Y+T+L+  ++  ++AVAV      F +  W IP+ V++S FGG+N  I  +SR+F V ++   +P  L+MI     TPIP+++F   ++++YL+  D++ L+NY  F  W     +++  LY R+  K  K  RP  + + FPIV+ + S F+++         S++G  I L+ VP Y +GV   + ++P      L   T+  Q+L   V TE D
Sbjct:   26 EDVSSPPQRSSETMQLKKEISLLNGVSLVVGNMIGSGIFVSPKGVLVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLVVEPTGQAIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTFVNCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVLSSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIHIERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRW--KEPKRPRPLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFIRNVLAAITRGTQQLCFCVLTELD 503          
BLAST of slc7a-7 vs. Ensembl Human
Match: SLC7A7 (solute carrier family 7 member 7 [Source:HGNC Symbol;Acc:HGNC:11065])

HSP 1 Score: 358.221 bits (918), Expect = 1.634e-117
Identity = 194/469 (41.36%), Postives = 306/469 (65.25%), Query Frame = 1
Query:  139 DKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVK---WKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            ++ +LKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LVIW + G+FS+ GA CY ELG  IK+S   YAYI +AFG FLAF+RLW  +++  P   AI+++TFA Y+++P+F +C  P  A R LAA+CI LLTFINC  VK  T VQDIFT+AK+LAL+ VI+ G+V+L  G ++++E+ F  ++  +G + +  Y+ LF+Y GW+ LN + EE+KNP ++LP ++ IS  IVT++Y+L NV+Y+T+L   +I  ++AVAV      F +  W+IP+ V++S FGG+N  I+  SR+F V ++   +P ++ MI     TP+PS++F  +++++YL   D++ L+NY  F  W     +I+  LY R+  K     RP  + + FPIV+ L + F++          S++G  I L+ +P Y + ++    K+P    R +G  T+++Q L + VA E D
Sbjct:   29 EQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRW--KEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMD 495          
BLAST of slc7a-7 vs. Ensembl Human
Match: SLC7A7 (solute carrier family 7 member 7 [Source:HGNC Symbol;Acc:HGNC:11065])

HSP 1 Score: 358.221 bits (918), Expect = 1.634e-117
Identity = 194/469 (41.36%), Postives = 306/469 (65.25%), Query Frame = 1
Query:  139 DKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVK---WKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            ++ +LKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LVIW + G+FS+ GA CY ELG  IK+S   YAYI +AFG FLAF+RLW  +++  P   AI+++TFA Y+++P+F +C  P  A R LAA+CI LLTFINC  VK  T VQDIFT+AK+LAL+ VI+ G+V+L  G ++++E+ F  ++  +G + +  Y+ LF+Y GW+ LN + EE+KNP ++LP ++ IS  IVT++Y+L NV+Y+T+L   +I  ++AVAV      F +  W+IP+ V++S FGG+N  I+  SR+F V ++   +P ++ MI     TP+PS++F  +++++YL   D++ L+NY  F  W     +I+  LY R+  K     RP  + + FPIV+ L + F++          S++G  I L+ +P Y + ++    K+P    R +G  T+++Q L + VA E D
Sbjct:   29 EQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRW--KEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMD 495          
BLAST of slc7a-7 vs. Ensembl Human
Match: SLC7A7 (solute carrier family 7 member 7 [Source:HGNC Symbol;Acc:HGNC:11065])

HSP 1 Score: 358.221 bits (918), Expect = 1.634e-117
Identity = 194/469 (41.36%), Postives = 306/469 (65.25%), Query Frame = 1
Query:  139 DKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVK---WKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            ++ +LKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LVIW + G+FS+ GA CY ELG  IK+S   YAYI +AFG FLAF+RLW  +++  P   AI+++TFA Y+++P+F +C  P  A R LAA+CI LLTFINC  VK  T VQDIFT+AK+LAL+ VI+ G+V+L  G ++++E+ F  ++  +G + +  Y+ LF+Y GW+ LN + EE+KNP ++LP ++ IS  IVT++Y+L NV+Y+T+L   +I  ++AVAV      F +  W+IP+ V++S FGG+N  I+  SR+F V ++   +P ++ MI     TP+PS++F  +++++YL   D++ L+NY  F  W     +I+  LY R+  K     RP  + + FPIV+ L + F++          S++G  I L+ +P Y + ++    K+P    R +G  T+++Q L + VA E D
Sbjct:   29 EQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRW--KEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMD 495          
BLAST of slc7a-7 vs. Ensembl Celegans
Match: aat-1 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:Q19834])

HSP 1 Score: 365.54 bits (937), Expect = 4.871e-121
Identity = 214/484 (44.21%), Postives = 318/484 (65.70%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQ-LKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMG---FTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVY-PDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATEPDE 1539
            E D+   +  E K + L+K +TL NG+ +++G +IGSGIF+SPTGV  +AGS G +L++W++ G+F+ IGAYCY ELG +IK+S GDYAYI +AFGPF+AF+RLWI+ IV RPC + IV+LTFA Y L P F +C  P +    LA   I+L+T INC SV+ +T VQD FT AK++AL ++ILTG+  L  G   +  ++E+ F +T+ D  ++++ FY+GLFAY GWN+LN ++EE++NP ++LP A+ IS +  TV+Y+L NV+ +T +SP E+  + AVAV      +    +++P+ V+ ST G  NG+I T++R+F   A+  QMPA L MI+    TPIP+VI    +S+ YL+   D+Y L+NY+    WL    AI AL + R  +      RP  V LI+P ++L     +++   V    ++ +G +IML+AVPVY I + WK KPK FN  +   T F+QKLF+VV  + ++
Sbjct:   12 EGDEAPQNETEGKGKGLEKSLTLFNGVSMIVGCIIGSGIFVSPTGVQEQAGSVGLSLIVWLISGIFTAIGAYCYAELGTLIKKSGGDYAYIMEAFGPFVAFIRLWIEAIVVRPCTVTIVALTFAIYGLRPFFPDCAPPDVVAELLAILLIVLMTAINCISVRLATIVQDWFTIAKVVALCLIILTGLGLLFFGESQYKDSFENIFENTSQDFTKVSLAFYSGLFAYSGWNFLNFIVEELQNPKRNLPLAIAISITSCTVIYVLTNVALYTAISPDEMLESPAVAVLFANKLYGKFAFIMPLCVACSTIGSANGVIFTSARLFYSGAREGQMPAVLTMINKKTKTPIPAVILTGALSIAYLLASKDVYQLINYIQISYWLAIGTAIAALFWLR--RTMPDASRPIKVPLIWPAIFLAGCIALVLIPMVAAPRDTGIGLLIMLSAVPVYGIFIGWKNKPKWFNEFIDSSTVFIQKLFMVVDEDKED 493          
BLAST of slc7a-7 vs. Ensembl Celegans
Match: aat-1 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:Q19834])

HSP 1 Score: 365.54 bits (937), Expect = 4.871e-121
Identity = 214/484 (44.21%), Postives = 318/484 (65.70%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQ-LKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMG---FTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVY-PDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATEPDE 1539
            E D+   +  E K + L+K +TL NG+ +++G +IGSGIF+SPTGV  +AGS G +L++W++ G+F+ IGAYCY ELG +IK+S GDYAYI +AFGPF+AF+RLWI+ IV RPC + IV+LTFA Y L P F +C  P +    LA   I+L+T INC SV+ +T VQD FT AK++AL ++ILTG+  L  G   +  ++E+ F +T+ D  ++++ FY+GLFAY GWN+LN ++EE++NP ++LP A+ IS +  TV+Y+L NV+ +T +SP E+  + AVAV      +    +++P+ V+ ST G  NG+I T++R+F   A+  QMPA L MI+    TPIP+VI    +S+ YL+   D+Y L+NY+    WL    AI AL + R  +      RP  V LI+P ++L     +++   V    ++ +G +IML+AVPVY I + WK KPK FN  +   T F+QKLF+VV  + ++
Sbjct:   12 EGDEAPQNETEGKGKGLEKSLTLFNGVSMIVGCIIGSGIFVSPTGVQEQAGSVGLSLIVWLISGIFTAIGAYCYAELGTLIKKSGGDYAYIMEAFGPFVAFIRLWIEAIVVRPCTVTIVALTFAIYGLRPFFPDCAPPDVVAELLAILLIVLMTAINCISVRLATIVQDWFTIAKVVALCLIILTGLGLLFFGESQYKDSFENIFENTSQDFTKVSLAFYSGLFAYSGWNFLNFIVEELQNPKRNLPLAIAISITSCTVIYVLTNVALYTAISPDEMLESPAVAVLFANKLYGKFAFIMPLCVACSTIGSANGVIFTSARLFYSGAREGQMPAVLTMINKKTKTPIPAVILTGALSIAYLLASKDVYQLINYIQISYWLAIGTAIAALFWLR--RTMPDASRPIKVPLIWPAIFLAGCIALVLIPMVAAPRDTGIGLLIMLSAVPVYGIFIGWKNKPKWFNEFIDSSTVFIQKLFMVVDEDKED 493          
BLAST of slc7a-7 vs. Ensembl Celegans
Match: aat-3 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVL7])

HSP 1 Score: 350.517 bits (898), Expect = 4.667e-115
Identity = 209/485 (43.09%), Postives = 320/485 (65.98%), Query Frame = 1
Query:  109 NDKKSNDSNEDKCQ---LKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTS---NWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYP-DMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATEPDE 1539
            N + SN+ ++++     L+K +TL NG+ I++G +IGSGIFISPTG+  +AGS G +L++W+L G+F+ IGA+CY ELG +I++S GDYAYI +AFGPFLAF+RLWI+ IV RPC   IV+LTFA Y+L+P + +C  P ++   +AA  ++LLT +NC SVK +++VQD F   K  ALV++I TG+  +  G      ++E+ F +T  D+   ++ FY+GLFAY GWNYLN ++EE++NP ++LP ++ ISCS+ T++Y L NV+ +T ++P E+  + AVAV     N+    + +P+FV+ ST G  NG+I+T+SR+F   A+  QMP  L M++ +  TPIP+VI   L+S++YL+   ++Y L+NY+    W+    AILAL YFR  K      R     ++FPI++ +    +++   +G   ++ +G +IML+ VPVYLI + WK KPK  +      T F QKLF+VV    +E
Sbjct:   11 NQEPSNEHHDEEVGDKGLEKTMTLFNGVSIIVGCIIGSGIFISPTGIQAQAGSVGLSLIVWVLSGLFAGIGAFCYAELGTLIRKSGGDYAYIMEAFGPFLAFLRLWIESIVVRPCTATIVALTFAIYMLKPFYPDCDSPPLSTELIAALLLVLLTAVNCISVKWASKVQDFFFVTKTAALVLIIFTGLWNMVSGKPEAFDSFENIFENTAKDLETASLAFYSGLFAYQGWNYLNFIVEELQNPKRNLPLSIAISCSLCTIIYTLTNVALYTSITPDEMLASPAVAVLFAEKNYGWFAFCMPIFVACSTIGSANGVILTSSRLFYCGAREGQMPNVLTMVNKTTKTPIPAVILTGLLSLLYLLLSNNIYSLINYIQVSYWIAIGGAILALFYFR--KTMPDAPRAVKAPIVFPIIFFIGCVLLVLVPVLGNPKDTAIGILIMLSGVPVYLIFIAWKGKPKCIDSLTDSVTIFTQKLFMVVDANKEE 493          
BLAST of slc7a-7 vs. Ensembl Celegans
Match: aat-3 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVL7])

HSP 1 Score: 350.903 bits (899), Expect = 8.333e-115
Identity = 209/485 (43.09%), Postives = 320/485 (65.98%), Query Frame = 1
Query:  109 NDKKSNDSNEDKCQ---LKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTS---NWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYP-DMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATEPDE 1539
            N + SN+ ++++     L+K +TL NG+ I++G +IGSGIFISPTG+  +AGS G +L++W+L G+F+ IGA+CY ELG +I++S GDYAYI +AFGPFLAF+RLWI+ IV RPC   IV+LTFA Y+L+P + +C  P ++   +AA  ++LLT +NC SVK +++VQD F   K  ALV++I TG+  +  G      ++E+ F +T  D+   ++ FY+GLFAY GWNYLN ++EE++NP ++LP ++ ISCS+ T++Y L NV+ +T ++P E+  + AVAV     N+    + +P+FV+ ST G  NG+I+T+SR+F   A+  QMP  L M++ +  TPIP+VI   L+S++YL+   ++Y L+NY+    W+    AILAL YFR  K      R     ++FPI++ +    +++   +G   ++ +G +IML+ VPVYLI + WK KPK  +      T F QKLF+VV    +E
Sbjct:   47 NQEPSNEHHDEEVGDKGLEKTMTLFNGVSIIVGCIIGSGIFISPTGIQAQAGSVGLSLIVWVLSGLFAGIGAFCYAELGTLIRKSGGDYAYIMEAFGPFLAFLRLWIESIVVRPCTATIVALTFAIYMLKPFYPDCDSPPLSTELIAALLLVLLTAVNCISVKWASKVQDFFFVTKTAALVLIIFTGLWNMVSGKPEAFDSFENIFENTAKDLETASLAFYSGLFAYQGWNYLNFIVEELQNPKRNLPLSIAISCSLCTIIYTLTNVALYTSITPDEMLASPAVAVLFAEKNYGWFAFCMPIFVACSTIGSANGVILTSSRLFYCGAREGQMPNVLTMVNKTTKTPIPAVILTGLLSLLYLLLSNNIYSLINYIQVSYWIAIGGAILALFYFR--KTMPDAPRAVKAPIVFPIIFFIGCVLLVLVPVLGNPKDTAIGILIMLSGVPVYLIFIAWKGKPKCIDSLTDSVTIFTQKLFMVVDANKEE 529          
BLAST of slc7a-7 vs. Ensembl Celegans
Match: aat-2 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:Q19151])

HSP 1 Score: 312.383 bits (799), Expect = 1.991e-100
Identity = 195/475 (41.05%), Postives = 299/475 (62.95%), Query Frame = 1
Query:  112 DKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESP--FSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIG---LDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLE-RPFTVHLIFPIVYLLVSAFIIVFAFVGGF-YESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLF 1512
            ++K  + + ++ +LK  I+L NG  I+IG +IGSGIF+SP GV L+AGS+G +L+IW+L GVF+MIGA CY ELG +I +S GDYAYIY+AFGP  +F+ LW+ +++  P  +AI+++T A Y L+P F +C  P +     A   I +LTFINCW V+ +TR  D FT  KL+AL ++I  G   L +G   N   P     + T +  + M FY+G+F++ G++YLN + EE+KNP ++LP+A+ IS  IVT+VYML N++YF++L+  EI  ++AVA+      L  F     ++P+FVS S  G +NGI++T SRMF   A++ Q+P   AMIS    TPIPS+IF+   S+V L   +++ L+NY+ F   L    ++  LL  RF+     L  RP  + L++PI++ L+  F+++  F     +E + G  ++L+ +P+Y++ V  K +P         FT F+QKLF
Sbjct:    2 NEKEEEVSLNQIKLKPRISLFNGCTIIIGVIIGSGIFVSPKGVLLEAGSAGMSLLIWLLSGVFAMIGAVCYSELGTLIPKSGGDYAYIYEAFGPLPSFLFLWVALVIINPTSLAIIAITCATYALQP-FYSCPVPDVVVNLFAGCIIAVLTFINCWDVRMATRTNDFFTITKLIALTLIITCGGYWLSLGHIDNLVMPDVAEGSQTKLSAIAMAFYSGVFSFSGFSYLNFVTEELKNPFRNLPRAIYISIPIVTIVYMLVNIAYFSVLTVDEILDSDAVAITFADKILGTFGSK-ILMPLFVSFSCVGSLNGILITCSRMFFSGARNSQLPELFAMISIRQLTPIPSLIFLGGTSIVMLFIGNVFQLINYLSFAESLVVFSSVAGLLKLRFTMPENVLNARPIKISLLWPILFFLMCLFLLILPFFHSDPWELIYGVFLVLSGIPIYVLFVYNKYRPGFIQSVWIGFTHFIQKLF 474          
BLAST of slc7a-7 vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0085785)

HSP 1 Score: 437.187 bits (1123), Expect = 1.189e-148
Identity = 213/432 (49.31%), Postives = 307/432 (71.06%), Query Frame = 1
Query:  229 PTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVV 1521
            PTGV +  GS   AL++W++ G+FSM+GAYCY ELG +I +S  DYAYI + FGPF+AF+RLWI+ ++ RPC  AIV+LTF+ Y+L+P F  C  P  + R LA  CIL+LT INCW VK +T VQDIFT+AKLLAL I+I TGV +L +G T  +   F +T+T +  + + FY+GLFAY GWNYLN ++EE+K+PVK+LP+A+ ISC++VT+VY++ANVS++TILSP E+  ++AVAV      F ++ W IP+FV++STFG VNGI++T+SR+F   A + QMP  L MI     TP P+V+ ++L+SM+YL   D++ L+NYVGF TWL+   A+L L + R+++    L RP  V ++FPIVYL+ + F+ V        E+  G +++L+++PVYL+ + WK KP  F + +G  T+ +QKL +VV
Sbjct:   71 PTGVLMYTGSVNLALIVWVISGLFSMVGAYCYAELGTMITKSGADYAYIMETFGPFMAFIRLWIECMIVRPCSQAIVALTFSTYVLKPFFPECTPPEDSARLLAVCCILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVMGSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQP--NLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKPIWFQKTMGGLTQVLQKLMMVV 498          
BLAST of slc7a-7 vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0085786)

HSP 1 Score: 437.187 bits (1123), Expect = 1.189e-148
Identity = 213/432 (49.31%), Postives = 307/432 (71.06%), Query Frame = 1
Query:  229 PTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVV 1521
            PTGV +  GS   AL++W++ G+FSM+GAYCY ELG +I +S  DYAYI + FGPF+AF+RLWI+ ++ RPC  AIV+LTF+ Y+L+P F  C  P  + R LA  CIL+LT INCW VK +T VQDIFT+AKLLAL I+I TGV +L +G T  +   F +T+T +  + + FY+GLFAY GWNYLN ++EE+K+PVK+LP+A+ ISC++VT+VY++ANVS++TILSP E+  ++AVAV      F ++ W IP+FV++STFG VNGI++T+SR+F   A + QMP  L MI     TP P+V+ ++L+SM+YL   D++ L+NYVGF TWL+   A+L L + R+++    L RP  V ++FPIVYL+ + F+ V        E+  G +++L+++PVYL+ + WK KP  F + +G  T+ +QKL +VV
Sbjct:   71 PTGVLMYTGSVNLALIVWVISGLFSMVGAYCYAELGTMITKSGADYAYIMETFGPFMAFIRLWIECMIVRPCSQAIVALTFSTYVLKPFFPECTPPEDSARLLAVCCILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVMGSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQP--NLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKPIWFQKTMGGLTQVLQKLMMVV 498          
BLAST of slc7a-7 vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0334550)

HSP 1 Score: 436.032 bits (1120), Expect = 3.558e-148
Identity = 213/440 (48.41%), Postives = 311/440 (70.68%), Query Frame = 1
Query:  229 PTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVA--TEPDE 1539
            PTGV +  GS   AL++W++ G+FSM+GAYCY ELG +I +S  DYAYI + FGPF+AF+RLWI+ ++ RPC  AIV+LTF+ Y+L+P F  C  P  + R LA  CIL+LT INCW VK +T VQDIFT+AKLLAL I+I TGV +L +G T  +   F +T+T +  + + FY+GLFAY GWNYLN ++EE+K+PVK+LP+A+ ISC++VT+VY++ANVS++TILSP E+  ++AVAV      F ++ W IP+FV++STFG VNGI++T+SR+F   A + QMP  L MI     TP P+V+ ++L+SM+YL   D++ L+NYVGF TWL+   A+L L + R+++    L RP  V ++FPIVYL+ + F+ V        E+  G +++L+++PVYL+ + WK KP  F + +   T+F+QK+ +V+   T+P +
Sbjct:   71 PTGVLMYTGSVNLALIVWVISGLFSMVGAYCYAELGTMITKSGADYAYIMETFGPFMAFIRLWIECMIVRPCSQAIVALTFSTYVLKPFFPECTPPEDSARLLAVCCILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVMGSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQP--NLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKPIWFQKTMVSLTRFLQKMLMVLGKQTKPAQ 506          
BLAST of slc7a-7 vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0334549)

HSP 1 Score: 436.032 bits (1120), Expect = 3.558e-148
Identity = 213/440 (48.41%), Postives = 311/440 (70.68%), Query Frame = 1
Query:  229 PTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVA--TEPDE 1539
            PTGV +  GS   AL++W++ G+FSM+GAYCY ELG +I +S  DYAYI + FGPF+AF+RLWI+ ++ RPC  AIV+LTF+ Y+L+P F  C  P  + R LA  CIL+LT INCW VK +T VQDIFT+AKLLAL I+I TGV +L +G T  +   F +T+T +  + + FY+GLFAY GWNYLN ++EE+K+PVK+LP+A+ ISC++VT+VY++ANVS++TILSP E+  ++AVAV      F ++ W IP+FV++STFG VNGI++T+SR+F   A + QMP  L MI     TP P+V+ ++L+SM+YL   D++ L+NYVGF TWL+   A+L L + R+++    L RP  V ++FPIVYL+ + F+ V        E+  G +++L+++PVYL+ + WK KP  F + +   T+F+QK+ +V+   T+P +
Sbjct:   71 PTGVLMYTGSVNLALIVWVISGLFSMVGAYCYAELGTMITKSGADYAYIMETFGPFMAFIRLWIECMIVRPCSQAIVALTFSTYVLKPFFPECTPPEDSARLLAVCCILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVMGSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQP--NLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKPIWFQKTMVSLTRFLQKMLMVLGKQTKPAQ 506          
BLAST of slc7a-7 vs. Ensembl Fly
Match: mnd (gene:FBgn0002778 transcript:FBtr0075626)

HSP 1 Score: 361.303 bits (926), Expect = 3.357e-119
Identity = 202/452 (44.69%), Postives = 306/452 (67.70%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIG----VKW 1449
             N    + S     +LKK+I L++G+ I++G ++GSGIF+SP GV   +GS G +L++W+L GV SM+GA CY ELG +I +S GDYAYI  AFGP  AF+ LW+ +++  P   AI +LTFA Y+L+P + +C  PI A + LAA+ I +LT INC++VK  TRV DIFT  K++AL++++  GV  L  G T +W++PFS    D G + + FY+GLF+Y GWNYLN + EE+K+P ++LPKA+ IS  +VTV+YM+ N++YF++LSP EI  ++AVAV  G      M W++P  V+ STFG +NG I  +SR+F V A++  +PA++++I+ +  TP+PS+IF+ +++++ L   D+YVL+NYV +V  L    ++  LL+ R+  K  K ERP  V+L  PI+YL+V  F+++F+     Y   +GTII+L+ +PVY +     VKW
Sbjct:   24 NNSTADSGSQGSGVKLKKQIGLLDGVAIIVGVIVGSGIFVSPKGVLKFSGSIGQSLIVWVLSGVLSMVGALCYAELGTMIPKSGGDYAYIGTAFGPLPAFLYLWVALLILVPTGNAITALTFAIYLLKPFWPSCDAPIEAVQLLAAAMICVLTLINCYNVKWVTRVTDIFTGTKVVALLVIVGAGVWWLFDGNTEHWDNPFSGGLQDPGYIALAFYSGLFSYSGWNYLNFVTEELKDPYRNLPKAICISMPVVTVIYMITNIAYFSVLSPDEILSSDAVAVTFGDKMLGYMSWIMPFAVACSTFGSLNGAIFASSRLFFVGARNGHLPAAISLINVNCLTPVPSLIFLGVLTLLLLFIEDVYVLINYVSYVEALFTLISVSGLLWMRY--KQPKTERPIKVNLALPIIYLIVCLFLVIFSCTQTPYVVGIGTIIILSGIPVYYLTIHKPVKW 473          
BLAST of slc7a-7 vs. Ensembl Zebrafish
Match: slc7a6 (solute carrier family 7 member 6 [Source:NCBI gene;Acc:57957])

HSP 1 Score: 366.696 bits (940), Expect = 3.136e-121
Identity = 199/488 (40.78%), Postives = 305/488 (62.50%), Query Frame = 1
Query:  109 NDKKSNDSNE---------DKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGV---KWKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            + KK N   E         +  QLKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LVIW + G+FS++GA CY ELG  I +S   YAYI ++FG F+AF+RLW  +++  P   A++++TFA Y+++P+F  C  P  A R +AA+CI LLTFIN   VK  TRVQD+FT+AK+LAL+++I+TG+VKLC GFT N+E  F  ++ D G + +  Y+ LF+Y GW+ LN + EE+KNP ++LP ++ IS  IVT++Y+L NV+Y+ +L    I  ++AVAV        VM W IP+ V++S +GG+N  I+  SR+F V A+   +P +L+MI     TP+P+++F   ++++YL   D++ L+NY  F  W     +I   +Y R+  K     RP  + L++PI++ L   F++          S++G  I L+ VPVY +G+   + K+P    + L   T+F Q     V TE D
Sbjct:    6 DSKKMNGQPESPAALSKPRESMQLKKEISLLNGVSLIVGNMIGSGIFVSPKGVLIYSASYGLSLVIWAIGGIFSVVGALCYAELGTTITKSGASYAYILESFGGFIAFIRLWTSLLIIEPTSQAVIAITFANYLVQPLFPTCEPPYSASRLIAAACICLLTFINSAYVKWGTRVQDVFTYAKVLALIVIIITGIVKLCQGFTINFEDSFQGSSRDPGGIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTIIYILTNVAYYAVLDMSAILASDAVAVTFADHTLGVMSWTIPIAVALSCYGGLNSSIIAASRLFFVGAREGHLPDALSMIHIERFTPVPALLFNCAMALIYLTVEDVFQLINYYSFSYWFFVGLSIAGQIYLRW--KEPDRPRPLKLSLVYPIIFCLCVVFLVAVPLYSDTLNSLIGIAIALSGVPVYFLGIHLPESKRPPIITKLLSAITRFTQFTCFCVLTEMD 491          
BLAST of slc7a-7 vs. Ensembl Zebrafish
Match: slc7a6 (solute carrier family 7 member 6 [Source:NCBI gene;Acc:57957])

HSP 1 Score: 364.77 bits (935), Expect = 8.711e-121
Identity = 195/466 (41.85%), Postives = 299/466 (64.16%), Query Frame = 1
Query:  148 QLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGV---KWKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            QLKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LVIW + G+FS++GA CY ELG  I +S   YAYI ++FG F+AF+RLW  +++  P   A++++TFA Y+++P+F  C  P  A R +AA+CI LLTFIN   VK  TRVQD+FT+AK+LAL+++I+TG+VKLC GFT N+E  F  ++ D G + +  Y+ LF+Y GW+ LN + EE+KNP ++LP ++ IS  IVT++Y+L NV+Y+ +L    I  ++AVAV        VM W IP+ V++S +GG+N  I+  SR+F V A+   +P +L+MI     TP+P+++F   ++++YL   D++ L+NY  F  W     +I   +Y R+  K     RP  + L++PI++ L   F++          S++G  I L+ VPVY +G+   + K+P    + L   T+F Q     V TE D
Sbjct:    2 QLKKEISLLNGVSLIVGNMIGSGIFVSPKGVLIYSASYGLSLVIWAIGGIFSVVGALCYAELGTTITKSGASYAYILESFGGFIAFIRLWTSLLIIEPTSQAVIAITFANYLVQPLFPTCEPPYSASRLIAAACICLLTFINSAYVKWGTRVQDVFTYAKVLALIVIIITGIVKLCQGFTINFEDSFQGSSRDPGGIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTIIYILTNVAYYAVLDMSAILASDAVAVTFADHTLGVMSWTIPIAVALSCYGGLNSSIIAASRLFFVGAREGHLPDALSMIHIERFTPVPALLFNCAMALIYLTVEDVFQLINYYSFSYWFFVGLSIAGQIYLRW--KEPDRPRPLKLSLVYPIIFCLCVVFLVAVPLYSDTLNSLIGIAIALSGVPVYFLGIHLPESKRPPIITKLLSAITRFTQFTCFCVLTEMD 465          
BLAST of slc7a-7 vs. Ensembl Zebrafish
Match: slc7a5 (solute carrier family 7 member 5 [Source:ZFIN;Acc:ZDB-GENE-080818-4])

HSP 1 Score: 364.77 bits (935), Expect = 2.088e-120
Identity = 219/482 (45.44%), Postives = 317/482 (65.77%), Query Frame = 1
Query:  106 ENDKKSND----SNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNW--ESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATE 1530
            E+DK+  +      E+   LK+ ITL+NG+ I++G++IGSGIF++PTGV  +AGS G +LV+W +CGVFS IGA CY ELG  I +S GDYAYI + +G   AF++LWI++++ RP    IV+  FA YIL+P+F  C  P    + +A  CILLLT +NC+SVKA+TRVQD F  AKLLAL ++I+ G V++  G T     E+ F  +NTD G + +  Y+GLFAY GWNYLN + EEM  P K+LP+A++IS  IVTVVY+L N++YFT LSP ++  + AVAV  G  +   M W+IP+FV +S FG VNG + T+SR+F V ++   +P+ L+MI   L TP+PS+IF  +++++Y    D++ ++N+  F  WL  A AI+ +++ R+ K   +LERP  V+++ PIV++L   F+IV +F     E  +G  I+ T VPVY  GV W+ KPK   + +   T   QK+  VV  E
Sbjct:   17 EDDKQVTEKMLTGREETVVLKRTITLVNGVAIIVGTIIGSGIFVTPTGVVKEAGSVGLSLVVWTVCGVFSTIGALCYAELGTTITKSGGDYAYILEVYGSLPAFLKLWIELLIIRPSSQYIVAYVFATYILKPIFPVCPVPETGAKLVACLCILLLTAVNCYSVKAATRVQDAFAAAKLLALGLIIIIGFVEIGKGDTVELLPENSFKGSNTDFGNIGLALYSGLFAYGGWNYLNFVTEEMIEPYKNLPRAIIISLPIVTVVYVLTNLAYFTTLSPEKMLSSEAVAVDFGNYHLGPMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSLLSMIHPDLLTPLPSLIFTCIMTLLYAFSNDIFSVINFFSFFNWLCIAMAIVGMMWLRYKKP--ELERPIKVNILLPIVFVLACLFLIVVSFWKTPVECAIGFGIIATGVPVYFFGVWWQTKPKWLLQIIFSSTVMCQKMMEVVPQE 496          
BLAST of slc7a-7 vs. Ensembl Zebrafish
Match: slc7a7 (solute carrier family 7 member 7 [Source:ZFIN;Acc:ZDB-GENE-051127-5])

HSP 1 Score: 361.688 bits (927), Expect = 3.862e-119
Identity = 200/482 (41.49%), Postives = 304/482 (63.07%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKW---KKPKSFNRKLGDFTKFVQKLFIVVATEPDES 1542
             N      S+++  +LKKEI+L+NG+ +++G+MIGSGIF+SP GV + +GS G +LV+W + G+FS+ GA CY ELG  I +S   YAYI +AFG FLAF+RLW  +++  P   A++++TF+ Y+++P+F  C+ P +A R LAA+CI LLTF+NC  VK  TRVQD FT+ K++AL+ VI+TG+VK+  G+T N+E  FSD++ D G + +  Y+ LF+Y GW+ LN + EE+KNP ++LP A+ IS  IVTV+Y+L N++Y+TIL    I  ++AVAV      F  + W IP+ V+ S FGG+N  I+  SR+F V ++   +P  L MI  +  TPIP+++F   +++VYL   D++ L+NY  F  W     +IL  LY R+  K     RP  + L FPI++ L + F++V         S++G  I L+ VPVY +       ++P    + +      +QK+   V TE D+ 
Sbjct:   17 SNGNLKASSSQESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSGSYGLSLVVWTIGGIFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYVANRLLAAACICLLTFVNCAYVKYGTRVQDFFTYVKVVALIAVIITGLVKIFQGYTQNFEGLFSDSSHDPGDVALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIAISMPIVTVIYILTNLAYYTILPIPAILDSDAVAVTFADQVFGYLNWTIPVAVAFSCFGGLNASIVAASRLFFVGSREGHLPDYLCMIHITRFTPIPALLFNGAMALVYLCVEDVFKLINYYSFSYWFFVGLSILGQLYLRW--KQPDRPRPLKLSLFFPIIFCLCTVFLVVVPLYSDTINSLIGIGIALSGVPVYFLCCHLPATRRPMWLRKFIASSGVLIQKVCFCVLTEMDKE 496          
BLAST of slc7a-7 vs. Ensembl Zebrafish
Match: slc7a7 (solute carrier family 7 member 7 [Source:ZFIN;Acc:ZDB-GENE-051127-5])

HSP 1 Score: 361.688 bits (927), Expect = 3.862e-119
Identity = 200/482 (41.49%), Postives = 304/482 (63.07%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKW---KKPKSFNRKLGDFTKFVQKLFIVVATEPDES 1542
             N      S+++  +LKKEI+L+NG+ +++G+MIGSGIF+SP GV + +GS G +LV+W + G+FS+ GA CY ELG  I +S   YAYI +AFG FLAF+RLW  +++  P   A++++TF+ Y+++P+F  C+ P +A R LAA+CI LLTF+NC  VK  TRVQD FT+ K++AL+ VI+TG+VK+  G+T N+E  FSD++ D G + +  Y+ LF+Y GW+ LN + EE+KNP ++LP A+ IS  IVTV+Y+L N++Y+TIL    I  ++AVAV      F  + W IP+ V+ S FGG+N  I+  SR+F V ++   +P  L MI  +  TPIP+++F   +++VYL   D++ L+NY  F  W     +IL  LY R+  K     RP  + L FPI++ L + F++V         S++G  I L+ VPVY +       ++P    + +      +QK+   V TE D+ 
Sbjct:   17 SNGNLKASSSQESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSGSYGLSLVVWTIGGIFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYVANRLLAAACICLLTFVNCAYVKYGTRVQDFFTYVKVVALIAVIITGLVKIFQGYTQNFEGLFSDSSHDPGDVALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIAISMPIVTVIYILTNLAYYTILPIPAILDSDAVAVTFADQVFGYLNWTIPVAVAFSCFGGLNASIVAASRLFFVGSREGHLPDYLCMIHITRFTPIPALLFNGAMALVYLCVEDVFKLINYYSFSYWFFVGLSILGQLYLRW--KQPDRPRPLKLSLFFPIIFCLCTVFLVVVPLYSDTINSLIGIGIALSGVPVYFLCCHLPATRRPMWLRKFIASSGVLIQKVCFCVLTEMDKE 496          
BLAST of slc7a-7 vs. Ensembl Xenopus
Match: slc7a7 (solute carrier family 7 (amino acid transporter light chain, y+L system), member 7 [Source:NCBI gene;Acc:394818])

HSP 1 Score: 382.489 bits (981), Expect = 4.696e-127
Identity = 202/479 (42.17%), Postives = 310/479 (64.72%), Query Frame = 1
Query:  109 NDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVK---WKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
             D  ++  +++  +LKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LV+W + G+FS+ GA CY ELG  I +S   YAYI +AFG F+AF+RLW  +++  P   A++++TF+ Y+L+P+F +C  P  A R +AA CI LLTF+NC  VK  TRVQDIFT+AK+LAL+ VI+ G+VK+C G + N+E+ F+ ++ D+G + +  Y+ LF+Y GW+ LN + EE+KNP ++LP A+ IS  IVTV+Y+L NV+Y+T+L   EI  ++AVAV      F +  W IP+ V++S FGG+N  I+  SR+F V ++   +P +L+MI     TPIP+++F   +++VYL   D++ L+NY  F  WL    +I   LY R+  K     RP  + L+FPI++ L + F++          S++G  I L+ VPVY + V+    +KP+   R  G  T++ Q L   V TE D
Sbjct:   21 KDSTADSGSQESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVLWAVGGIFSIFGALCYAELGTTITKSGASYAYILEAFGGFVAFIRLWTSLLIIEPTSQAVIAITFSNYMLQPIFPSCGSPYAANRLIAAGCIALLTFVNCAYVKWGTRVQDIFTYAKVLALIAVIIAGIVKICQGHSENFENSFAGSSYDVGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTVIYILTNVAYYTVLDIREILASDAVAVTFADQIFGIFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDALSMIHVERFTPIPALLFNGAMALVYLCVEDIFQLINYYSFSYWLFVGLSIAGQLYLRW--KQPDRPRPLKLSLVFPIIFCLCTVFLVAVPLYSDLINSLIGVGIALSGVPVYFLLVRVSEKRKPQCLQRAAGALTRYTQILCYSVLTEMD 497          
BLAST of slc7a-7 vs. Ensembl Xenopus
Match: slc7a7 (solute carrier family 7 (amino acid transporter light chain, y+L system), member 7 [Source:NCBI gene;Acc:394818])

HSP 1 Score: 376.711 bits (966), Expect = 7.638e-125
Identity = 201/471 (42.68%), Postives = 305/471 (64.76%), Query Frame = 1
Query:  133 NEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVK---WKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            +    +LKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LV+W + G+FS+ GA CY ELG  I +S   YAYI +AFG F+AF+RLW  +++  P   A++++TF+ Y+L+P+F +C  P  A R +AA CI LLTF+NC  VK  TRVQDIFT+AK+LAL+ VI+ G+VK+C G + N+E+ F+ ++ D+G + +  Y+ LF+Y GW+ LN + EE+KNP ++LP A+ IS  IVTV+Y+L NV+Y+T+L   EI  ++AVAV      F +  W IP+ V++S FGG+N  I+  SR+F V ++   +P +L+MI     TPIP+++F   +++VYL   D++ L+NY  F  WL    +I   LY R+  K     RP  + L+FPI++ L + F++          S++G  I L+ VPVY + V+    +KP+   R  G  T++ Q L   V TE D
Sbjct:   17 DNTSMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVLWAVGGIFSIFGALCYAELGTTITKSGASYAYILEAFGGFVAFIRLWTSLLIIEPTSQAVIAITFSNYMLQPIFPSCGSPYAANRLIAAGCIALLTFVNCAYVKWGTRVQDIFTYAKVLALIAVIIAGIVKICQGHSENFENSFAGSSYDVGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTVIYILTNVAYYTVLDIREILASDAVAVTFADQIFGIFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDALSMIHVERFTPIPALLFNGAMALVYLCVEDIFQLINYYSFSYWLFVGLSIAGQLYLRW--KQPDRPRPLKLSLVFPIIFCLCTVFLVAVPLYSDLINSLIGVGIALSGVPVYFLLVRVSEKRKPQCLQRAAGALTRYTQILCYSVLTEMD 485          
BLAST of slc7a-7 vs. Ensembl Xenopus
Match: dpm3 (dolichyl-phosphate mannosyltransferase polypeptide 3 [Source:Xenbase;Acc:XB-GENE-975729])

HSP 1 Score: 373.629 bits (958), Expect = 1.305e-123
Identity = 215/478 (44.98%), Postives = 318/478 (66.53%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNW--ESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATE 1530
                +  DS     +L++ ITL+NG+ I++G++IGSGIF++PTGV  +AGS G +L++W +CG+FS++GA CY ELG  I +S GDYAY+ + +GP  AF++LW+++++ RP    IV+L FA Y+L+P+F  C  P  A + +A  CILLLT INC+SVKA+TRVQD F  AKLLAL ++I+ G V+L  G   N   E+ F  T+T++GQ  +  Y+GLFAY GWNYLN ++EEM  P K+LP+A++IS  IVT+VY+L N++YFT LS  ++  + AVAV  G  +  VM W+IP+FV +S FG VNG + T+SR+F V A+   +P+ LAMI   L TP+PS+IF   ++++Y    D++ ++N+  F  WL  A AI+ L++ R+ K   +LERP  V+++ PI ++L   F+IV +F     E  +G II+L+ VPVY  GV W+ KP+     +   T  +QK+   V  E
Sbjct:   31 NGSAEPTDSAGGAVELQRTITLVNGVAIIVGTIIGSGIFVTPTGVLREAGSPGLSLLVWAVCGLFSIVGALCYAELGTTISKSGGDYAYVLEVYGPLPAFLKLWVELLIIRPSSQYIVALVFATYLLKPVFPTCPVPDDAAKLVACLCILLLTAINCYSVKAATRVQDAFAAAKLLALCLIIILGFVQLGKGGVENLKPENAFEGTSTNVGQWVLALYSGLFAYGGWNYLNFVVEEMIEPYKNLPRAIIISMPIVTLVYVLTNLAYFTTLSTEQMLNSEAVAVDFGNYHLGVMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGAREGHLPSLLAMIHPRLLTPMPSLIFTCAMTLLYAFSDDIFSVINFFSFFNWLCVALAIIGLMWLRYKKP--ELERPIKVNILLPIFFILACFFLIVVSFYMTPVECGIGFIIILSGVPVYFFGVWWQNKPEWLLHGIYSSTALLQKVMEAVPQE 506          
BLAST of slc7a-7 vs. Ensembl Xenopus
Match: dpm3 (dolichyl-phosphate mannosyltransferase polypeptide 3 [Source:Xenbase;Acc:XB-GENE-975729])

HSP 1 Score: 374.015 bits (959), Expect = 1.384e-123
Identity = 215/478 (44.98%), Postives = 318/478 (66.53%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNW--ESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATE 1530
                +  DS     +L++ ITL+NG+ I++G++IGSGIF++PTGV  +AGS G +L++W +CG+FS++GA CY ELG  I +S GDYAY+ + +GP  AF++LW+++++ RP    IV+L FA Y+L+P+F  C  P  A + +A  CILLLT INC+SVKA+TRVQD F  AKLLAL ++I+ G V+L  G   N   E+ F  T+T++GQ  +  Y+GLFAY GWNYLN ++EEM  P K+LP+A++IS  IVT+VY+L N++YFT LS  ++  + AVAV  G  +  VM W+IP+FV +S FG VNG + T+SR+F V A+   +P+ LAMI   L TP+PS+IF   ++++Y    D++ ++N+  F  WL  A AI+ L++ R+ K   +LERP  V+++ PI ++L   F+IV +F     E  +G II+L+ VPVY  GV W+ KP+     +   T  +QK+   V  E
Sbjct:   35 NGSAEPTDSAGGAVELQRTITLVNGVAIIVGTIIGSGIFVTPTGVLREAGSPGLSLLVWAVCGLFSIVGALCYAELGTTISKSGGDYAYVLEVYGPLPAFLKLWVELLIIRPSSQYIVALVFATYLLKPVFPTCPVPDDAAKLVACLCILLLTAINCYSVKAATRVQDAFAAAKLLALCLIIILGFVQLGKGGVENLKPENAFEGTSTNVGQWVLALYSGLFAYGGWNYLNFVVEEMIEPYKNLPRAIIISMPIVTLVYVLTNLAYFTTLSTEQMLNSEAVAVDFGNYHLGVMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGAREGHLPSLLAMIHPRLLTPMPSLIFTCAMTLLYAFSDDIFSVINFFSFFNWLCVALAIIGLMWLRYKKP--ELERPIKVNILLPIFFILACFFLIVVSFYMTPVECGIGFIIILSGVPVYFFGVWWQNKPEWLLHGIYSSTALLQKVMEAVPQE 510          
BLAST of slc7a-7 vs. Ensembl Xenopus
Match: slc7a7 (solute carrier family 7 (amino acid transporter light chain, y+L system), member 7 [Source:NCBI gene;Acc:394818])

HSP 1 Score: 372.474 bits (955), Expect = 2.147e-123
Identity = 195/461 (42.30%), Postives = 301/461 (65.29%), Query Frame = 1
Query:  109 NDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVK---WKKPKSFNRKLG 1482
             D  ++  +++  +LKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LV+W + G+FS+ GA CY ELG  I +S   YAYI +AFG F+AF+RLW  +++  P   A++++TF+ Y+L+P+F +C  P  A R +AA CI LLTF+NC  VK  TRVQDIFT+AK+LAL+ VI+ G+VK+C G + N+E+ F+ ++ D+G + +  Y+ LF+Y GW+ LN + EE+KNP ++LP A+ IS  IVTV+Y+L NV+Y+T+L   EI  ++AVAV      F +  W IP+ V++S FGG+N  I+  SR+F V ++   +P +L+MI     TPIP+++F   +++VYL   D++ L+NY  F  WL    +I   LY R+  K     RP  + L+FPI++ L + F++          S++G  I L+ VPVY + V+    +KP+   R  G
Sbjct:   18 KDSTADSGSQESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVLWAVGGIFSIFGALCYAELGTTITKSGASYAYILEAFGGFVAFIRLWTSLLIIEPTSQAVIAITFSNYMLQPIFPSCGSPYAANRLIAAGCIALLTFVNCAYVKWGTRVQDIFTYAKVLALIAVIIAGIVKICQGHSENFENSFAGSSYDVGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTVIYILTNVAYYTVLDIREILASDAVAVTFADQIFGIFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDALSMIHVERFTPIPALLFNGAMALVYLCVEDIFQLINYYSFSYWLFVGLSIAGQLYLRW--KQPDRPRPLKLSLVFPIIFCLCTVFLVAVPLYSDLINSLIGVGIALSGVPVYFLLVRVSEKRKPQCLQRAAG 476          
BLAST of slc7a-7 vs. Ensembl Mouse
Match: Slc7a6 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 6 [Source:MGI Symbol;Acc:MGI:2142598])

HSP 1 Score: 365.54 bits (937), Expect = 1.727e-120
Identity = 198/480 (41.25%), Postives = 307/480 (63.96%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGV---KWKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            E+    +  + +  QLKKEI+L+NG+ +V+G+MIGSGIF+SP GV     S G +L++W + G+FS++GA CY ELG  I +S   YAYI +AFG F+AF+RLW+ +++  P   AI+++TFA YI++P F  C  P +A R LAA+C+ LLTF+NC  VK  TRVQD FT+AK+LAL+ +I+ G+VKLC G T +++  F  ++ ++G L++  Y+ LF+Y GW+ LN + EE+KNP ++LP A+ IS  IVT++Y+L NV+Y+T+L+  ++  ++AVAV      F +  W IP+ V++S FGG+N  I  +SR+F V ++   +P  L+MI     TP+P+++F   ++++YLV  D+++L+NY  F  W     +++  LY R+  K     RP  + L FPIV+ + S F++          S++G  I L+ VPVY +GV   + ++P      L   T+  QKL   V TE D
Sbjct:   26 EDAGSPSQGSPETMQLKKEISLLNGVSLVVGNMIGSGIFVSPKGVLKYTASYGLSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLIVEPTSQAIIAITFANYIIKPSFPTCDPPYVACRLLAAACVCLLTFVNCAYVKWGTRVQDTFTYAKVLALIAIIIMGLVKLCQGHTEHFQDAFKGSSWNVGDLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNIQDVHKSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPNLLSMIHIERFTPVPALLFNCTMTLIYLVVKDVFLLINYFSFSYWFFVGLSVVGQLYLRW--KEPDWPRPLKLSLFFPIVFCVCSLFLVAVPLFSDTINSLIGIGIALSGVPVYFLGVYLPESRRPLFIRNVLATVTRVTQKLCFCVLTELD 503          
BLAST of slc7a-7 vs. Ensembl Mouse
Match: Slc7a8 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 8 [Source:MGI Symbol;Acc:MGI:1355323])

HSP 1 Score: 363.229 bits (931), Expect = 2.505e-119
Identity = 219/505 (43.37%), Postives = 317/505 (62.77%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQ-------LKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMG--FTSNWESPFSD-TNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVV--------ATEPDESLKLS*KP 1563
            +N   S+ S E +         LKKEI L++  GI++G++IGSGIF+SP GV   AGS G AL++W++ G+ + +GA CY ELG  I +S GDY+Y+   FG    F+RLWI V+V  P   A+++LTF+ Y+L+P+F  C  P    R LAA C+LLLT++NC SV+ +TRVQDIFT  KLLAL ++I+ G+V++C G  F    ++ F +    DIG + + F  G FAY GWN+LN + EE+ +P K+LP+A+ IS  +VT VY+ AN++Y T +SP E+  +NAVAV  G     VM W++P+ V++STFGGVNG + T+SR+F   A+   +P+ LAMI     TPIP+++F  L +++ LV  DMY L+NYVGF+ +L +   +   +  R+ K    + RP  V L+FPI+YLL  AF+++F+         +G  IMLT VPVY +GV W+ KPK FN  +   T   QK+ +VV        A E  + L+   KP
Sbjct:   13 KNHPGSDTSPEAEASSGGGGVALKKEIGLVSACGIIVGNIIGSGIFVSPKGVLENAGSVGLALIVWIVTGIITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEFFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANIAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCLSTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKP--DIPRPIKVSLLFPIIYLLFWAFLLIFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFNDFIKSLTLVSQKMCVVVYPQEGNSGAEETTDDLEEQHKP 515          
BLAST of slc7a-7 vs. Ensembl Mouse
Match: Slc7a7 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 [Source:MGI Symbol;Acc:MGI:1337120])

HSP 1 Score: 354.755 bits (909), Expect = 2.586e-116
Identity = 197/476 (41.39%), Postives = 306/476 (64.29%), Query Frame = 1
Query:  139 DKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVK---WKKPKSFNRKLGDFTKFVQKLFIVVATEPD-ESLKLS 1554
            ++ +LKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LVIW + G+FS+ GA CY ELG  IK+S   YAYI +AFG FLAF+RLW  +++  P   A++++TFA Y+++P+F +C  P  A R LAA+CI LLTFINC  VK  T VQDIFT+AK+LAL+ VI+ G+V+L  G T+N+E+ F  ++  +G + +  Y+ LF+Y GW+ LN + EE++NP ++LP ++ IS  IVT++Y+L NV+Y+++L   EI  ++AVAV      F V  W+IP+ V+ S FGG+N  I+  SR+  V ++   +P ++ M+     TP+PS++F  ++S+VYL   D++ L+NY  F  W     +I+  LY R+  K     RP  + L FPI++ L + F++          S++G  I L+ +P Y   ++    K+P    R +   T+++Q L + VA E D E  +LS
Sbjct:   30 EQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASFGLSLVIWAVGGIFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFANYMVQPLFPSCGAPYAAGRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIIAGIVRLGQGATANFENSFEGSSFAMGDIALALYSALFSYSGWDTLNYVTEEIRNPERNLPLSIGISMPIVTIIYLLTNVAYYSVLDIKEILASDAVAVTFADQIFGVFNWIIPVAVAFSCFGGLNASIVAASRLLFVGSREGHLPDAICMVHVERFTPVPSLLFNGVLSLVYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRW--KDPDRPRPLKLSLFFPIIFCLCTIFLVAVPLYSDTINSLIGIGIALSGLPFYFFIIRVPEHKRPLFLRRIVASITRYLQILCMSVAAEMDLEDGELS 503          
BLAST of slc7a-7 vs. Ensembl Mouse
Match: Slc7a7 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 [Source:MGI Symbol;Acc:MGI:1337120])

HSP 1 Score: 354.755 bits (909), Expect = 2.586e-116
Identity = 197/476 (41.39%), Postives = 306/476 (64.29%), Query Frame = 1
Query:  139 DKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVK---WKKPKSFNRKLGDFTKFVQKLFIVVATEPD-ESLKLS 1554
            ++ +LKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LVIW + G+FS+ GA CY ELG  IK+S   YAYI +AFG FLAF+RLW  +++  P   A++++TFA Y+++P+F +C  P  A R LAA+CI LLTFINC  VK  T VQDIFT+AK+LAL+ VI+ G+V+L  G T+N+E+ F  ++  +G + +  Y+ LF+Y GW+ LN + EE++NP ++LP ++ IS  IVT++Y+L NV+Y+++L   EI  ++AVAV      F V  W+IP+ V+ S FGG+N  I+  SR+  V ++   +P ++ M+     TP+PS++F  ++S+VYL   D++ L+NY  F  W     +I+  LY R+  K     RP  + L FPI++ L + F++          S++G  I L+ +P Y   ++    K+P    R +   T+++Q L + VA E D E  +LS
Sbjct:   30 EQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASFGLSLVIWAVGGIFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFANYMVQPLFPSCGAPYAAGRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIIAGIVRLGQGATANFENSFEGSSFAMGDIALALYSALFSYSGWDTLNYVTEEIRNPERNLPLSIGISMPIVTIIYLLTNVAYYSVLDIKEILASDAVAVTFADQIFGVFNWIIPVAVAFSCFGGLNASIVAASRLLFVGSREGHLPDAICMVHVERFTPVPSLLFNGVLSLVYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRW--KDPDRPRPLKLSLFFPIIFCLCTIFLVAVPLYSDTINSLIGIGIALSGLPFYFFIIRVPEHKRPLFLRRIVASITRYLQILCMSVAAEMDLEDGELS 503          
BLAST of slc7a-7 vs. Ensembl Mouse
Match: Slc7a7 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 [Source:MGI Symbol;Acc:MGI:1337120])

HSP 1 Score: 354.755 bits (909), Expect = 2.586e-116
Identity = 197/476 (41.39%), Postives = 306/476 (64.29%), Query Frame = 1
Query:  139 DKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVK---WKKPKSFNRKLGDFTKFVQKLFIVVATEPD-ESLKLS 1554
            ++ +LKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LVIW + G+FS+ GA CY ELG  IK+S   YAYI +AFG FLAF+RLW  +++  P   A++++TFA Y+++P+F +C  P  A R LAA+CI LLTFINC  VK  T VQDIFT+AK+LAL+ VI+ G+V+L  G T+N+E+ F  ++  +G + +  Y+ LF+Y GW+ LN + EE++NP ++LP ++ IS  IVT++Y+L NV+Y+++L   EI  ++AVAV      F V  W+IP+ V+ S FGG+N  I+  SR+  V ++   +P ++ M+     TP+PS++F  ++S+VYL   D++ L+NY  F  W     +I+  LY R+  K     RP  + L FPI++ L + F++          S++G  I L+ +P Y   ++    K+P    R +   T+++Q L + VA E D E  +LS
Sbjct:   30 EQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASFGLSLVIWAVGGIFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFANYMVQPLFPSCGAPYAAGRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIIAGIVRLGQGATANFENSFEGSSFAMGDIALALYSALFSYSGWDTLNYVTEEIRNPERNLPLSIGISMPIVTIIYLLTNVAYYSVLDIKEILASDAVAVTFADQIFGVFNWIIPVAVAFSCFGGLNASIVAASRLLFVGSREGHLPDAICMVHVERFTPVPSLLFNGVLSLVYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRW--KDPDRPRPLKLSLFFPIIFCLCTIFLVAVPLYSDTINSLIGIGIALSGLPFYFFIIRVPEHKRPLFLRRIVASITRYLQILCMSVAAEMDLEDGELS 503          
BLAST of slc7a-7 vs. UniProt/SwissProt
Match: sp|Q8BGK6|YLAT2_MOUSE (Y+L amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc7a6 PE=1 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 1.208e-119
Identity = 198/480 (41.25%), Postives = 307/480 (63.96%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGV---KWKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            E+    +  + +  QLKKEI+L+NG+ +V+G+MIGSGIF+SP GV     S G +L++W + G+FS++GA CY ELG  I +S   YAYI +AFG F+AF+RLW+ +++  P   AI+++TFA YI++P F  C  P +A R LAA+C+ LLTF+NC  VK  TRVQD FT+AK+LAL+ +I+ G+VKLC G T +++  F  ++ ++G L++  Y+ LF+Y GW+ LN + EE+KNP ++LP A+ IS  IVT++Y+L NV+Y+T+L+  ++  ++AVAV      F +  W IP+ V++S FGG+N  I  +SR+F V ++   +P  L+MI     TP+P+++F   ++++YLV  D+++L+NY  F  W     +++  LY R+  K     RP  + L FPIV+ + S F++          S++G  I L+ VPVY +GV   + ++P      L   T+  QKL   V TE D
Sbjct:   26 EDAGSPSQGSPETMQLKKEISLLNGVSLVVGNMIGSGIFVSPKGVLKYTASYGLSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLIVEPTSQAIIAITFANYIIKPSFPTCDPPYVACRLLAAACVCLLTFVNCAYVKWGTRVQDTFTYAKVLALIAIIIMGLVKLCQGHTEHFQDAFKGSSWNVGDLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNIQDVHKSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPNLLSMIHIERFTPVPALLFNCTMTLIYLVVKDVFLLINYFSFSYWFFVGLSVVGQLYLRW--KEPDWPRPLKLSLFFPIVFCVCSLFLVAVPLFSDTINSLIGIGIALSGVPVYFLGVYLPESRRPLFIRNVLATVTRVTQKLCFCVLTELD 503          
BLAST of slc7a-7 vs. UniProt/SwissProt
Match: sp|Q59I64|YLAT2_DANRE (Y+L amino acid transporter 2 OS=Danio rerio OX=7955 GN=slc7a6 PE=2 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 1.937e-119
Identity = 194/466 (41.63%), Postives = 299/466 (64.16%), Query Frame = 1
Query:  148 QLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGV---KWKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            QLKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LVIW + G+FS++GA CY ELG  I +S   YAYI ++FG F+AF+RLW  +++  P   A++++TFA Y+++P+F  C  P  A R +AA+CI LLTFIN   VK  TRVQD+FT+AK+LAL+++I+TG+VKLC GFT N+E  F  ++ D G + +  Y+ LF+Y GW+ LN + EE+KNP ++LP ++ IS  IVT++Y+L NV+Y+ +L    I  ++AVAV        VM W IP+ V++S +GG+N  I+  SR+F V A+   +P +L+MI     TP+P+++F   ++++YL   D++ L+NY  F  W     +I   +Y R+  K     RP  + L++PI++ L   F++          +++G  I L+ VPVY +G+   + K+P    + L   T+F Q     V TE D
Sbjct:    2 QLKKEISLLNGVSLIVGNMIGSGIFVSPKGVLIYSASYGLSLVIWAIGGIFSVVGALCYAELGTTITKSGASYAYILESFGGFIAFIRLWTSLLIIEPTSQAVIAITFANYLVQPLFPTCEPPYSASRLIAAACICLLTFINSAYVKWGTRVQDVFTYAKVLALIVIIITGIVKLCQGFTINFEDSFQGSSRDPGGIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTIIYILTNVAYYAVLDMSAILASDAVAVTFADHTLGVMSWTIPIAVALSCYGGLNSSIIAASRLFFVGAREGHLPDALSMIHIERFTPVPALLFNCAMALIYLTVEDVFQLINYYSFSYWFFVGLSIAGQIYLRW--KEPDRPRPLKLSLVYPIIFCLCVVFLVAVPLYSDTLNTLIGIAIALSGVPVYFLGIHLPESKRPPIITKLLSAITRFTQFTCFYVLTEMD 465          
BLAST of slc7a-7 vs. UniProt/SwissProt
Match: sp|Q9WVR6|LAT2_RAT (Large neutral amino acids transporter small subunit 2 OS=Rattus norvegicus OX=10116 GN=Slc7a8 PE=1 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 2.376e-119
Identity = 216/488 (44.26%), Postives = 313/488 (64.14%), Query Frame = 1
Query:  112 DKKSNDSNEDKCQ-------LKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMG--FTSNWESPFSD-TNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATEPDES 1542
            D+ S+ S E +         LKKEI L++  GI++G++IGSGIF+SP GV   AGS G AL++W++ GV + +GA CY ELG  I +S GDY+Y+   FG    F+RLWI V+V  P   A+++LTF+ Y+L+P+F  C  P    R LAA C+LLLT++NC SV+ +TRVQDIFT  KLLAL ++I+ GVV++C G  F    ++ F +    DIG + + F  G FAY GWN+LN + EE+ +P K+LP+A+ IS  +VT VY+ AN++Y T +SP E+  +NAVAV  G     VM W++P+ V++STFGGVNG + T+SR+F   A+   +P+ LAMI     TPIP+++F  L +++ LV  DMY L+NYVGF+ +L +   +   +  R+ K    + RP  + L+FPI+YLL  AF+++F+         +G  IMLT VPVY +GV W+ KPK FN  +   T   QK+ +VV  +  +S
Sbjct:   17 DRGSDTSPEAEASSGGGGVALKKEIGLVSACGIIVGNIIGSGIFVSPKGVLENAGSVGLALIVWIVTGVITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGVVQICKGEFFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANIAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCLSTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKP--DIPRPIKISLLFPIIYLLFWAFLLIFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFNDFIESLTLVSQKMCVVVYPQEGDS 502          
BLAST of slc7a-7 vs. UniProt/SwissProt
Match: sp|Q92536|YLAT2_HUMAN (Y+L amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC7A6 PE=1 SV=3)

HSP 1 Score: 363.999 bits (933), Expect = 6.567e-119
Identity = 197/480 (41.04%), Postives = 308/480 (64.17%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGV---KWKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            E+       + +  QLKKEI+L+NG+ +V+G+MIGSGIF+SP GV +   S G +L++W + G+FS++GA CY ELG  I +S   YAYI +AFG F+AF+RLW+ ++V  P   AI+++TFA YI++P F +C  P +A R LAA+CI LLTF+NC  VK  TRVQD FT+AK++AL+ +I+ G+VKLC G + +++  F  ++ D+G L++  Y+ LF+Y GW+ LN + EE+KNP ++LP A+ IS  IVT++Y+L NV+Y+T+L+  ++  ++AVAV      F +  W IP+ V++S FGG+N  I  +SR+F V ++   +P  L+MI     TPIP+++F   ++++YL+  D++ L+NY  F  W     +++  LY R+  K  K  RP  + + FPIV+ + S F+++         S++G  I L+ VP Y +GV   + ++P      L   T+  Q+L   V TE D
Sbjct:   26 EDVSSPPQRSSETMQLKKEISLLNGVSLVVGNMIGSGIFVSPKGVLVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLVVEPTGQAIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTFVNCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVLSSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIHIERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRW--KEPKRPRPLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFIRNVLAAITRGTQQLCFCVLTELD 503          
BLAST of slc7a-7 vs. UniProt/SwissProt
Match: sp|Q9QXW9|LAT2_MOUSE (Large neutral amino acids transporter small subunit 2 OS=Mus musculus OX=10090 GN=Slc7a8 PE=1 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 1.752e-118
Identity = 219/505 (43.37%), Postives = 317/505 (62.77%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQ-------LKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMG--FTSNWESPFSD-TNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVV--------ATEPDESLKLS*KP 1563
            +N   S+ S E +         LKKEI L++  GI++G++IGSGIF+SP GV   AGS G AL++W++ G+ + +GA CY ELG  I +S GDY+Y+   FG    F+RLWI V+V  P   A+++LTF+ Y+L+P+F  C  P    R LAA C+LLLT++NC SV+ +TRVQDIFT  KLLAL ++I+ G+V++C G  F    ++ F +    DIG + + F  G FAY GWN+LN + EE+ +P K+LP+A+ IS  +VT VY+ AN++Y T +SP E+  +NAVAV  G     VM W++P+ V++STFGGVNG + T+SR+F   A+   +P+ LAMI     TPIP+++F  L +++ LV  DMY L+NYVGF+ +L +   +   +  R+ K    + RP  V L+FPI+YLL  AF+++F+         +G  IMLT VPVY +GV W+ KPK FN  +   T   QK+ +VV        A E  + L+   KP
Sbjct:   13 KNHPGSDTSPEAEASSGGGGVALKKEIGLVSACGIIVGNIIGSGIFVSPKGVLENAGSVGLALIVWIVTGIITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEFFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANIAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCLSTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKP--DIPRPIKVSLLFPIIYLLFWAFLLIFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFNDFIKSLTLVSQKMCVVVYPQEGNSGAEETTDDLEEQHKP 515          
BLAST of slc7a-7 vs. TrEMBL
Match: A0A0H3YIW3 (Slc7a-7 OS=Schmidtea mediterranea OX=79327 GN=slc7a-7 PE=2 SV=1)

HSP 1 Score: 936.791 bits (2420), Expect = 0.000e+0
Identity = 483/483 (100.00%), Postives = 483/483 (100.00%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWKKPKSFNRKLGDFTKFVQKLFIVVATEPDESLKLS 1554
            ENDKKSNDSNEDKCQLKKEITLINGIGIVIGSMIGSGIFISPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWKKPKSFNRKLGDFTKFVQKLFIVVATEPDESLKLS
Sbjct:    8 ENDKKSNDSNEDKCQLKKEITLINGIGIVIGSMIGSGIFISPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWKKPKSFNRKLGDFTKFVQKLFIVVATEPDESLKLS 490          
BLAST of slc7a-7 vs. TrEMBL
Match: A0A0H3YK32 (Slc7a-9 OS=Schmidtea mediterranea OX=79327 GN=slc7a-9 PE=2 SV=1)

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 307/479 (64.09%), Postives = 402/479 (83.92%), Query Frame = 1
Query:  115 KKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVV-ATEPDESL 1545
            K SN        LKK ITL+NG+ I++GSMIGSGIFISPTGVYLK GSS ++++IW+LCG+++MIGAYCY ELGC+IKRS+GDYAY+Y+AFGP +AF+R+WIDVIVTRPC +AI+SLTFA+Y+LEP++  C QP +AR+ LAA+CIL++TF+NCWSVKASTRVQDI T+AK+ AL+I+I+TG+VKL MG+T NWESPF  T T+ G +TM FY GLFAY GW+YLNCM+EEMK+PVKD+P+A+ ISC +VT++Y+LANVSYFTILS  EI  +NA+AVR+G   + VMWW+IP+FV++STFGGVNG I+TTSR+FLVAAQ DQMP  LAMI+T  STPIPSV+FV++VS+ YL++PD++ LMNYVGFVTWLTF  A+L+L+YFR   K++K+ERP  V+++FPI+YL V+ F+I+FAF+GG +ESMMGT+IM++A+PVY I V WK KPK FNR L      VQK+F+V+    P++++
Sbjct:   11 KSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRI--KWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEKAM 487          
BLAST of slc7a-7 vs. TrEMBL
Match: A0A0H3YJ06 (Slc7a-10 OS=Schmidtea mediterranea OX=79327 GN=slc7a-10 PE=2 SV=1)

HSP 1 Score: 611.298 bits (1575), Expect = 0.000e+0
Identity = 285/441 (64.63%), Postives = 371/441 (84.13%), Query Frame = 1
Query:  229 PTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVV-ATEPDESL 1545
            P+GV+LK GS G+AL+IW LCG++S+IGAYCY ELGC+IKRSSGDYAY+Y+AFGP + F+RLW+DV+VTRPC IAIVSLTFA+Y LEP +  C QP++A++ LAA CIL++TF+NCWSVKASTRVQDI T+AK+ AL+I+I+TG+VKL MG+T NWESPF  T T+ G +TM FY GLFAY GW+YLNCM+EEMK+PVKD+P+A+ ISC +VT++Y+LANVSYFTILS  EI  +NA+AVRIG   + VMWW+IP+FV++STFGGVNG I+TTSR+FLVAAQ DQMP  LAMI+T  STPIPSV+FV++VS+ YL++PD++ LMNYVGFVTWLTF  A+L+L+YFR   K++K+ERP  V+++FPI+YL V+ F+I+FAF+GG +ESMMGT+IM++A+PVY I V WK KPK FNR L      VQK+F+V+    P++++
Sbjct:   53 PSGVFLKTGSIGSALIIWFLCGIYSLIGAYCYAELGCMIKRSSGDYAYVYEAFGPIMGFIRLWVDVLVTRPCSIAIVSLTFAQYFLEPFYYLCDQPLLAKQLLAAGCILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRIGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRI--KWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKRFNRMLESINISVQKMFMVILPAMPEKAM 491          
BLAST of slc7a-7 vs. TrEMBL
Match: A0A0H3YEY5 (Slc7a-6 OS=Schmidtea mediterranea OX=79327 GN=slc7a-6 PE=2 SV=1)

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 269/475 (56.63%), Postives = 364/475 (76.63%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWKKPKSFNRKLGDFTKFVQKLFIVVATE 1530
            + D+   +S+ DK +LKKEI L+NGIGI++GS+IGSGIF+SPT V++K+GS G+AL+IW LCG+FS+IGAYCY+ELG +I RS GDYAY+  AFGPF+AF+RLW+DVIV RP   AI++L FAEY LE +++ CV PIMA+R LAA CI +LTFINC+SV+ ST VQDI ++AK+ AL+I+I+TG+VKL  G T NWE+ F+D++T+ G   M FY GLFAY GWNYLNC++EEMKNP +DLP ++LIS  ++  +Y+L N++YFTIL P EI  T AVAV + +  + VMWW++P+FV+MSTFGGVNG ++ TSR+F VAAQ +QMP  L  I+    TP+PSV+FVSLVS+VYL + D+ +L+NY+GFV WL    A+  +++FR+    +   RP  VHL FPI+Y + +  +++ +FVGG YES+MG +I+LTA PVY I V WKKPKSF  KL + T  +QKLF VV ++
Sbjct:    5 KTDEVVKESSNDKVELKKEINLLNGIGIIVGSIIGSGIFVSPTEVFIKSGSPGSALIIWFLCGIFSLIGAYCYMELGTMITRSGGDYAYVLDAFGPFIAFLRLWVDVIVARPVSQAIIALVFAEYTLEALYIGCVSPIMAKRLLAAGCIGILTFINCYSVRWSTLVQDILSYAKVFALLIIIMTGIVKLAQGDTGNWENAFADSSTNPGDYAMAFYAGLFAYNGWNYLNCLIEEMKNPRRDLPLSILISMILIIFIYVLTNMAYFTILLPSEILNTKAVAVTVAIRLYGVMWWIMPIFVAMSTFGGVNGNLLATSRIFFVAAQENQMPMILETINVKYYTPVPSVLFVSLVSLVYLCFSDINILINYMGFVNWLAIGVAVFTVIWFRYKDPSKP--RPIRVHLAFPIIYCVATVILLILSFVGGPYESLMGIVIILTAAPVYWIFVLWKKPKSFQDKLDNITVVLQKLFYVVPSQ 477          
BLAST of slc7a-7 vs. TrEMBL
Match: A0A1S3IH31 (large neutral amino acids transporter small subunit 2 OS=Lingula unguis OX=7574 GN=LOC106163974 PE=4 SV=1)

HSP 1 Score: 486.878 bits (1252), Expect = 1.080e-164
Identity = 245/478 (51.26%), Postives = 347/478 (72.59%), Query Frame = 1
Query:  109 NDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATEPDE 1539
            ++  S+  + +K +LK +I+L+N   I++GS+IGSGIF+SP GV  +AGS G +L+IW LCG+FS+IGAYCY ELG +IK+S  DYAYI++AFGPFLAF+RLW++ ++ RPC  AIVSLTFA YI+EP+F +C QP  A R LAA CIL LTFINC+ VK +TRVQD+FT+AK+LAL+++I+TG V++  G+  N+ +PF +T  D+G  ++ FY+GLFAY GWNY NC+ EE+KNP K+LP+A+ ISC +V  VY+LANV+YFT ++P E+  ++AVAV      + VMWW++P+FV++STFGGVNGI+ TT+R+F V ++   MP  L+ +  +  TP P+V+FV+L ++ YLV  DMY L+NYVGFVTWL    +++ALLYFR+S  +    RP  V L++PI+Y   S F++V        E+  G +I+ T +PVYLI + WK KPK+   K+   T  +QKL +VV  E  +
Sbjct:   24 SEAASSGESNNKIELKPKISLVNACTIIVGSIIGSGIFVSPKGVLAEAGSVGLSLIIWALCGIFSLIGAYCYAELGTMIKKSGADYAYIFEAFGPFLAFLRLWVECLIIRPCSAAIVSLTFANYIIEPLFPDCEQPASAVRLLAAFCILTLTFINCFDVKWATRVQDVFTYAKVLALILIIITGFVQIGRGYYENFLAPFENTTNDVGAASLAFYSGLFAYNGWNYANCVTEELKNPEKNLPRAIWISCILVMFVYVLANVAYFTTVTPKELLESSAVAVTFSQRLYGVMWWIMPVFVALSTFGGVNGIMFTTARLFYVGSREGHMPMILSTVQINRLTPAPAVLFVALTTLCYLVSTDMYALINYVGFVTWLAIGLSVVALLYFRYS--WPDANRPIKVSLVWPIIYTAASVFLVVVPLYASPVETGFGCLIIATGIPVYLIFIGWKTKPKAIQSKIDACTLTLQKLLLVVPEEKKD 499          
BLAST of slc7a-7 vs. Ensembl Cavefish
Match: slc7a7 (solute carrier family 7 member 7 [Source:NCBI gene;Acc:103035629])

HSP 1 Score: 362.844 bits (930), Expect = 1.438e-119
Identity = 205/476 (43.07%), Postives = 303/476 (63.66%), Query Frame = 1
Query:  118 KSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLI---GVKWKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            KS+ SNE   +LKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LV+W + GVFS+ GA CY ELG  I +S   YAYI +AFG FLAF+RLW  +++  P   A++++TF+ Y+++P+F  C+ P  A R LAA+CI LLTF+NC  VK  TRVQD FT+AK++AL+ VI+TG+VK+  G T N+E  F +++ D G + +  Y+ LF+Y GW+ LN + EE+KNP ++LP ++ IS  IVTV+Y+L NV+Y+TIL    I  ++AVAV      F V  W IP+ V++S FGG+N  I+  SR+F V ++   +P  L MI  S  TPIP+++F   +++VYL   D++ L+NY  F  W     +IL  LY R+  K     RP  + +IFPIV+ L + F++V         S++G  I L+ +PVY +       ++P    R +      +QK+   V TE D
Sbjct:   22 KSSSSNESM-KLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASYGLSLVVWTIGGVFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYAANRLLAAACICLLTFVNCAYVKWGTRVQDFFTYAKVIALIAVIITGLVKIFQGHTQNFEGLFDNSSHDPGDVALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTVIYILTNVAYYTILPIPAILDSDAVAVTFADKVFGVFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDYLCMIHVSRYTPIPALLFNGAMALVYLCVEDIFKLINYYSFSYWFFVGLSILGQLYLRW--KQPDRPRPLKLSIIFPIVFCLCTIFLVVVPLYSDTINSLIGIGIALSGIPVYFLCCYTPASRRPMWLRRFIASSGVLIQKVCFSVLTEMD 494          
BLAST of slc7a-7 vs. Ensembl Cavefish
Match: slc7a7 (solute carrier family 7 member 7 [Source:NCBI gene;Acc:103035629])

HSP 1 Score: 362.073 bits (928), Expect = 2.014e-119
Identity = 205/476 (43.07%), Postives = 303/476 (63.66%), Query Frame = 1
Query:  118 KSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLI---GVKWKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            KS+ SNE   +LKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LV+W + GVFS+ GA CY ELG  I +S   YAYI +AFG FLAF+RLW  +++  P   A++++TF+ Y+++P+F  C+ P  A R LAA+CI LLTF+NC  VK  TRVQD FT+AK++AL+ VI+TG+VK+  G T N+E  F +++ D G + +  Y+ LF+Y GW+ LN + EE+KNP ++LP ++ IS  IVTV+Y+L NV+Y+TIL    I  ++AVAV      F V  W IP+ V++S FGG+N  I+  SR+F V ++   +P  L MI  S  TPIP+++F   +++VYL   D++ L+NY  F  W     +IL  LY R+  K     RP  + +IFPIV+ L + F++V         S++G  I L+ +PVY +       ++P    R +      +QK+   V TE D
Sbjct:   22 KSSSSNESM-KLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASYGLSLVVWTIGGVFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYAANRLLAAACICLLTFVNCAYVKWGTRVQDFFTYAKVIALIAVIITGLVKIFQGHTQNFEGLFDNSSHDPGDVALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTVIYILTNVAYYTILPIPAILDSDAVAVTFADKVFGVFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDYLCMIHVSRYTPIPALLFNGAMALVYLCVEDIFKLINYYSFSYWFFVGLSILGQLYLRW--KQPDRPRPLKLSIIFPIVFCLCTIFLVVVPLYSDTINSLIGIGIALSGIPVYFLCCYTPASRRPMWLRRFIASSGVLIQKVCFSVLTEMD 494          
BLAST of slc7a-7 vs. Ensembl Cavefish
Match: slc7a7 (solute carrier family 7 member 7 [Source:NCBI gene;Acc:103035629])

HSP 1 Score: 362.073 bits (928), Expect = 2.014e-119
Identity = 205/476 (43.07%), Postives = 303/476 (63.66%), Query Frame = 1
Query:  118 KSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLI---GVKWKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            KS+ SNE   +LKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LV+W + GVFS+ GA CY ELG  I +S   YAYI +AFG FLAF+RLW  +++  P   A++++TF+ Y+++P+F  C+ P  A R LAA+CI LLTF+NC  VK  TRVQD FT+AK++AL+ VI+TG+VK+  G T N+E  F +++ D G + +  Y+ LF+Y GW+ LN + EE+KNP ++LP ++ IS  IVTV+Y+L NV+Y+TIL    I  ++AVAV      F V  W IP+ V++S FGG+N  I+  SR+F V ++   +P  L MI  S  TPIP+++F   +++VYL   D++ L+NY  F  W     +IL  LY R+  K     RP  + +IFPIV+ L + F++V         S++G  I L+ +PVY +       ++P    R +      +QK+   V TE D
Sbjct:   22 KSSSSNESM-KLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASYGLSLVVWTIGGVFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYAANRLLAAACICLLTFVNCAYVKWGTRVQDFFTYAKVIALIAVIITGLVKIFQGHTQNFEGLFDNSSHDPGDVALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTVIYILTNVAYYTILPIPAILDSDAVAVTFADKVFGVFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDYLCMIHVSRYTPIPALLFNGAMALVYLCVEDIFKLINYYSFSYWFFVGLSILGQLYLRW--KQPDRPRPLKLSIIFPIVFCLCTIFLVVVPLYSDTINSLIGIGIALSGIPVYFLCCYTPASRRPMWLRRFIASSGVLIQKVCFSVLTEMD 494          
BLAST of slc7a-7 vs. Ensembl Cavefish
Match: slc7a8b (large neutral amino acids transporter small subunit 2 [Source:NCBI gene;Acc:103044995])

HSP 1 Score: 359.762 bits (922), Expect = 2.269e-118
Identity = 212/480 (44.17%), Postives = 303/480 (63.12%), Query Frame = 1
Query:  118 KSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGF-----TSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATEPDE 1539
             S         LKKEI L++  GI++G++IGSGIF+SP GV   A S G AL+IW+  GV + IGA CY ELG  I +S GDY+Y+   FG    F+RLWI ++V  P   A++SLTF+ Y+L+P+F  C       R LAA C+LLLT++NC+SV+ +TRVQDIFT  KLLAL ++I+ G+V++C G       ++   PF D   D+G++ + F  G FAY GWN+LN + EE+ +P ++LP+A+ IS  +VT VY+ ANV+Y T +SP E+  +NAVAV  G     VM W++P+ V++STFGG+NG + T+SRMF   A+   +P  LAMI  +  TPIP+++F  + +++ L   DMY L+NYVGF+ +L +   +   +  R  +    L RP  V L++P++YLL  AF++VF+         +G  IMLT VPVY +GV W+ KPK F   +G  T   QKL +VV    DE
Sbjct:   18 NSKQPESSGVALKKEIGLLSACGIIVGNIIGSGIFVSPKGVLENASSVGLALIIWISTGVITAIGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIALLVIYPTNQAVISLTFSNYVLQPLFPTCFATESGLRLLAAVCLLLLTWVNCFSVRWATRVQDIFTAGKLLALGLIIIMGIVQMCKGNYYWLEPAHAFEPFQDY--DVGRIALAFLQGSFAYGGWNFLNYVTEELIDPYRNLPRAIFISIPLVTFVYVFANVAYITAMSPTELLASNAVAVTFGEKLLGVMSWIMPISVALSTFGGINGSLFTSSRMFFAGAREGHLPRLLAMIHVNRFTPIPALLFTCISTLLMLCTSDMYTLINYVGFINYLFYGVTVAGQIVLRIRQP--DLSRPIKVSLVWPVIYLLFWAFLLVFSLYSQPMVCCIGLAIMLTGVPVYYLGVYWENKPKKFTHFVGKMTGLGQKLCLVVYPAEDE 493          
BLAST of slc7a-7 vs. Ensembl Cavefish
Match: slc7a10b (asc-type amino acid transporter 1-like [Source:NCBI gene;Acc:103033048])

HSP 1 Score: 344.739 bits (883), Expect = 3.285e-112
Identity = 201/490 (41.02%), Postives = 307/490 (62.65%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWES-------PFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVV--ATEPDESL 1545
            ++ K   D+  ++  LKKEI L++   I+IG++IGSGIFISP GV   +GS G ALV+W+L G  + +G+ CY ELG  I +S GDY+Y+ + FG  + F+ LW  V++  P  +A+++LTF+ Y+L+P+F NCV P MA R L+A+CIL LT++NC+SV+ +TR+QDIFT  KL+AL ++I  G+V++  G   N+E         FS  +  +GQ+ + F    FA+ GWN+LN + EE+ +P ++LP+A+ IS  +VT VY L N++YF+ +SP E+  +NAVAV  G     +   ++P+ V++STFGG+NG + T+SR+    A+   +P+ LAMI     TPIP+++     ++V +   + + L+NYV F+ +L++   I  LLY+R+ K    L RP  V L+ P+ YLL  A ++ F+         +G +IMLT VPVY +GV WK KPK     +   T   Q++F VV    EP E L
Sbjct:   24 KDRKVKEDTVPERVTLKKEIGLMSACTIIIGNIIGSGIFISPKGVLEHSGSVGLALVVWVLGGGIAALGSLCYAELGVTIPKSGGDYSYVTEIFGGLVGFLLLWSAVLIMYPTTLAVIALTFSNYVLQPVFPNCVPPYMAIRMLSATCILFLTWVNCFSVRLATRIQDIFTVGKLMALGLIIAVGMVQIYKG---NYEGLTPQIAFDFSGNSPSVGQIALAFLQASFAFSGWNFLNYVTEEVVDPRRNLPRAIYISIPLVTFVYTLTNIAYFSSMSPEELLSSNAVAVTFGEKLLGMFSTIMPISVALSTFGGINGYLFTSSRLCFSGAREGHLPSLLAMIHFKSCTPIPALLVCCTATIVIMCIGETHNLINYVSFINYLSYGVTIAGLLYYRWKKP--NLYRPIKVSLLVPMSYLLFWALLLGFSLHSEPVVCGVGLVIMLTGVPVYFLGVYWKDKPKCIYDFIEWATYLGQRVFFVVFPHIEPIEIL 508          
BLAST of slc7a-7 vs. Ensembl Sea Lamprey
Match: SLC7A11 (solute carrier family 7 member 11 [Source:HGNC Symbol;Acc:HGNC:11059])

HSP 1 Score: 324.324 bits (830), Expect = 3.020e-105
Identity = 190/473 (40.17%), Postives = 284/473 (60.04%), Query Frame = 1
Query:  124 NDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIG---LDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATE 1530
            NDS  D+  LKK+ITL+ GI I++G++IG GIFISP G+    GS G +LV+W  CGV S+ GA  Y ELG  IK+S G Y YI +AFGP  AFVRLW+++I+ RP   A+++LTF +YIL+PMF  C  P +A + + A  I L+ FIN  SV  + R+Q   TF+KL A+ I+I+ G++ L  G T +++  F      +  L + FY+G++AY GW Y+N + EE+ NP +++P A+ IS  IVTV Y   N++YF ++S  E+  + AVAV      L NFS+    +P+FV++S  G +NG +   +RMF VA++   +P  L+MI     TP+P+VI +  ++M+ L   D+Y L+N+  F  WL  A A+  L+Y RF++ +  + RPF V L  P+ + L    ++  +       S +G  I L+ VPVY + V W  KP +  R     T+ +Q +  V   E
Sbjct:   39 NDS--DRVHLKKKITLVRGISIIVGTIIGGGIFISPKGILTNTGSVGMSLVVWAACGVLSLFGALSYAELGTCIKKSGGHYTYILEAFGPLPAFVRLWVELIIIRPAATAVIALTFGQYILQPMFPQCHVPQLAVKIVTALAISLVMFINSSSVSWTARLQTFLTFSKLAAVGIIIIPGIIHLAKGNTEHFQDSFVGKEVGLMGLPLAFYSGMYAYSGWFYMNFVTEEVDNPERNIPLAICISMGIVTVAYTFMNMAYFAVMSGAELLASKAVAVTFAERLLGNFSI---TVPVFVALSCLGSLNGGVFAIARMFFVASREGHLPHILSMIHIRKHTPLPAVIILYPLTMLMLFVGDIYSLLNFFSFARWLFIAMAVSGLVYMRFTRPH--MHRPFKVPLFIPVFFSLSCLLVVALSLYSDPVNSGIGCAITLSGVPVYYLTVVWDGKPTAVKRATDRVTRVLQLILQVAPQE 504          
BLAST of slc7a-7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002665.1 (pep scaffold:Pmarinus_7.0:GL476806:119517:143089:1 gene:ENSPMAG00000002414.1 transcript:ENSPMAT00000002665.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 257.684 bits (657), Expect = 1.161e-80
Identity = 139/361 (38.50%), Postives = 207/361 (57.34%), Query Frame = 1
Query:  229 PTGV-YLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTV 1308
            P GV     G   +AL++W  CG+ S++GA CY ELG  +  + G+YAY+ +AFG  LAF+  W  V + RP   + V+LTFAEY+L P+F  C  P    +CLA + +L++  +NC S+K + R  D+ T  K+LAL IV + G+V L  G T N    F+       Q+   FY GL+AY GWN LN   EE+K+  K++ + ++++  +VT  Y+L N+SY T+L+P EI  + AVAV  G        W++P+ V++STFG +N       R+   AA+       LAM+S    TP P+V F +L+S+ +++  D+ +L NY GFVTWL        LL  R+  +   L RP+ V
Sbjct:   62 PGGVLRFVGGDPSSALLVWAGCGLLSLLGALCYAELGAAVPTTGGEYAYVRRAFGAPLAFLFAWTSVALLRPAMNSAVALTFAEYVLRPLFHGCPAPPAIVKCLAIASLLVVGILNCVSMKWAMRALDVLTLLKMLALAIVSVGGLVLLASGRTHNPLGSFAGAPPSPAQIGESFYQGLWAYGGWNALNYATEELKDVHKNITRCIVVAVPLVTAFYVLVNISYMTVLTPKEIISSAAVAVTWGDRVLGSFSWIVPLSVAVSTFGSLNCSAFVMGRLNYAAAREGHALPLLAMLSVRHQTPTPAVAFSTLLSVAFVLPTDLIMLTNYFGFVTWLLVGLNCAGLLVLRY--REPDLRRPYRV 420          
BLAST of slc7a-7 vs. Ensembl Sea Lamprey
Match: slc7a7 (solute carrier family 7 member 7 [Source:ZFIN;Acc:ZDB-GENE-051127-5])

HSP 1 Score: 214.157 bits (544), Expect = 5.304e-66
Identity = 113/239 (47.28%), Postives = 163/239 (68.20%), Query Frame = 1
Query:  109 NDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVK 825
            N        +D  QLKKEI+L++G+ +++G+MIGSGIF+SP GV + + S G +LV+W L G+FS+ GA CY ELG  I +S   YAYI +AFG F AF+RLW  +++  P   A++++TFA Y+++P+F  C  P  A R +AA+CI LLTF+NC  VK   RVQD+ T+AK++AL+ VI+ G+V L  G T N ES F  +N D+G + +  Y+ LF+Y GW+ LN + EE+KNP +
Sbjct:   28 NGDVPAQEAQDSMQLKKEISLVSGVCLIVGNMIGSGIFVSPKGVLMYSASYGLSLVVWALGGIFSVFGALCYAELGTTITKSGASYAYILEAFGKFPAFIRLWTSLLIIEPTSQAVIAITFANYLVQPIFSTCEPPYAASRLIAAACICLLTFVNCAYVKHGIRVQDLSTYAKVIALIAVIIAGIVFLGKGKTENLESSFEGSNWDVGNMALALYSALFSYSGWDTLNFVTEEIKNPER 266          
BLAST of slc7a-7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000258.1 (pep scaffold:Pmarinus_7.0:GL477686:30307:38152:1 gene:ENSPMAG00000000231.1 transcript:ENSPMAT00000000258.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.606 bits (392), Expect = 2.681e-44
Identity = 75/199 (37.69%), Postives = 115/199 (57.79%), Query Frame = 1
Query:  229 PTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVK 825
            P+GV   AGS G AL++W+ CG  S++GA  Y ELG  I++S   Y Y+ +  G   AF+ LW++ I+ RP  +A+V L+  +Y LE ++  C  P +A + LA   I  + ++N WS   S RVQ   + +KL AL  +I  G+  +  G T  +E+ F   ++    L + FY+G+FAY GW  LN + EE+K P +
Sbjct:   29 PSGVLRHAGSVGWALMVWLACGFLSLLGALSYAELGTTIRQSGSHYIYLRETLGTLPAFLFLWVEFIIVRPSVMAVVFLSMGQYSLEALYSPCAVPRIAVKLLAMVSISFVVWVNTWSSTLSLRVQSCLSVSKLAALASIIGVGIAHVARGRTEYFENAFDTADSRPEGLPLAFYSGMFAYSGWASLNSVTEEVKRPER 227          
BLAST of slc7a-7 vs. Ensembl Sea Lamprey
Match: slc7a5 (solute carrier family 7 member 5 [Source:ZFIN;Acc:ZDB-GENE-080818-4])

HSP 1 Score: 137.117 bits (344), Expect = 7.221e-38
Identity = 73/197 (37.06%), Postives = 118/197 (59.90%), Query Frame = 1
Query:  943 AVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATE 1530
            A   G  +  VM W+IP+FVS+S FG VNG + T+SR+F V A+   +P  L+MI   L TP+PS++F  L++++Y +  D++ ++N+  F  WL  A AI  +++ R+  K  + +RP  V+++ PI ++L   F+IV + V    E  +G  I+LT +PVY +GV+W+ KP S    +   T   QK+  V+  E
Sbjct:    1 AQDFGNYHLGVMSWIIPVFVSLSCFGSVNGSLFTSSRLFFVGAREGHLPNLLSMIHRRLFTPVPSLLFTCLMTLLYAISDDIFSVINFFSFFNWLCIAMAICGMMWLRY--KEPQRDRPIKVNILLPISFVLACIFLIVVSVVVTPVECGIGLGIILTGIPVYFVGVRWQNKPPSLLNLISSMTILSQKVLEVIPQE 195          
BLAST of slc7a-7 vs. Ensembl Yeast
Match: MUP1 (High affinity methionine permease; integral membrane protein with 13 putative membrane-spanning regions; also involved in cysteine uptake [Source:SGD;Acc:S000003287])

HSP 1 Score: 70.8626 bits (172), Expect = 1.891e-13
Identity = 81/383 (21.15%), Postives = 164/383 (42.82%), Query Frame = 1
Query:  238 VYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYIL------------EPMFLNCVQPIMAR---RCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGF-----TSNWESPFSDTNTDIG-QLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWW-----VIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTS-LSTPIPSVIFVSLVSMVYLVYP---DMYVLMNYVGFVTWLTFAFAILA-LLYFRFSKKYQKLE 1293
            +Y   GS G AL++W +  + ++ G Y Y+E G  I ++ G+  Y               ++ I  +P     ++  +A YI               MFL      + +   R +  + +     IN  +VK    +Q+I    K+  ++ + +TG V L  G      + N+ + F  T T     +    Y+ ++++ G++ +N  + E+KNPV+ L  A   S   + ++Y+  N++YF ++   ++  +  +   +  D F +++           V +S  G V  +I +  R+     +   +P S    S+   ++P+  +    +V  V ++ P   D Y+L+  +         FAI A LL+  + ++  K+E
Sbjct:   86 IYTLCGSVGLALIMWAVGAIIAISGLYVYMEFGTAIPKNGGEKNY---------------LEAIFRKPKF--FITCMYAAYIFFLGWAAGNSINTAIMFLTAADTEVTKWNQRGIGVAVVFFAFLINSLNVKIGLYLQNILGIFKIGIVLFISITGWVALGGGLKDGYQSHNFRNAFEGTETATAYGIVNALYSVIWSFVGYSNVNYALGEVKNPVRTLKIAGPTSMVFLAIIYIFVNIAYFAVVPKDKLISSKLI---LAADFFDIVFGGQAKRAAAALVGLSALGNVLSVIFSQGRIIQQLGREGVLPFSNFFASSKPFNSPMVGLFQHFIVCTVTILAPPPGDAYLLVQNLISYPMNIINFAISAGLLWIYWQRRQGKIE 448          
BLAST of slc7a-7 vs. Ensembl Yeast
Match: MUP3 (Low affinity methionine permease; similar to Mup1p [Source:SGD;Acc:S000001028])

HSP 1 Score: 68.9366 bits (167), Expect = 8.268e-13
Identity = 79/369 (21.41%), Postives = 151/369 (40.92%), Query Frame = 1
Query:  277 IWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIV-------SLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSN---WESPFSDTNTD----IGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIK----------LTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMIST-SLSTPIPSVIFVSLVSMVY-LVYPDMYVLMNYV----GFVTWLTFAFAILALLYFRFSKKYQKLE 1293
            IW+     +  G Y ++E G  I +S G   ++ ++F       RL I V+ +   C +++       S+ F +Y+L       V      + ++ S I+    I+  SV+    +Q+     KL+ +V++   G+  L    ++    W+ P +    D    +  +   F +  F + GW+ ++ +  E+KNPVK L  +  +S  I  V Y + NV+Y  +L+  EI            T     R+G          I   +++S    +  +I + SR+     +   +P S+ M        P+PS+     +++ + L+ P      NY+    G+          + L  +RF  K +  E
Sbjct:  104 IWVFSAAIAFAGLYLFLEFGSWIPKSGGRKNFLERSF----ERPRLLISVVFS---CYSVLTGYALTGSIVFGKYVLSAF---GVTDDSWSKYVSISFIIFAVLIHGVSVRHGVFIQNALGGLKLIMIVLMCFAGLYTLFFYKSTGQVAWDLPVTQVEKDSLLSVSSIATAFISSFFCFSGWDTVHTVTSEIKNPVKTLKVSGPLSLIICFVCYTMMNVAYLKVLTYEEIVSAGPLVGSVLFTKLFGPRVGGK-------FIAFSIAISAASNILVVIYSISRVNQEIFKEGYLPFSIHMSKNWPFDAPLPSISLCGFITIAWILILPKEGESFNYLVSMDGYGNQFFLLLVAIGLFIWRFKHKNEVPE 455          
BLAST of slc7a-7 vs. Ensembl Nematostella
Match: EDO41545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T4])

HSP 1 Score: 338.191 bits (866), Expect = 2.100e-110
Identity = 192/471 (40.76%), Postives = 306/471 (64.97%), Query Frame = 1
Query:  136 EDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLV--YPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATEPDE 1539
              K  LKK IT++NGIGI+ G++IGSGIFISPTG+  +AGS G AL+IW+ CG+ +M+G  CY ELG ++ +S  +YAY+ +AFG   A++  W  +++ RP   AI++L F EY+ +P F +C  P    + LA  C++++T +NCWSVK +TRVQD+FT+AKLL + ++ + G+V+LC G T ++++ FS + T+IGQ+ + FY GL+A+ GWN LN   EEMK+P +D+P+A++I  S++TV Y+L NV+Y T+L    I  + AVAV +G      + W++P+FV+ STFG VNG+++T  R+  VAA+ + MP+ LAMI     TP+PS++F +LVS++ L+        L+++  F  WL +    L+LL+ R+ +  Q   RP+ V ++ PI+  + S ++IV    G  + S++   ++   +P Y + V     PK F R +  FT++  K+  +  T+P+E
Sbjct:   36 RGKITLKKNITMVNGIGIIAGTVIGSGIFISPTGIQKEAGSIGLALLIWLGCGILAMLGCLCYAELGALVTKSGAEYAYLMEAFGRIPAYLFAWTSILIIRPASGAIIALIFGEYVAKPFFPDCPPPPEVVKILACVCLVVVTGVNCWSVKWATRVQDVFTYAKLLCIAMLTIIGIVELCRGKTEHFQNGFSGSTTNIGQIGLAFYIGLWAFDGWNNLNYCTEEMKHPERDMPRAIIIGISLITVCYLLINVAYITVLGASGILESEAVAVSVGNMYLGPVKWIVPLFVAASTFGAVNGMVLTNGRLLYVAARDNLMPSLLAMIHVKRFTPLPSLLFTTLVSVIMLIPETSSFTTLVDFFSFAAWLFYGGTFLSLLWLRYKRPNQ--HRPYRVWVVVPIIMSISSIYLIVAPITGDPFGSLIALAVIAAGLPFYFLFVYSNLTPKWFLRMVDSFTEWNMKVMDLAMTDPEE 504          
BLAST of slc7a-7 vs. Ensembl Nematostella
Match: EDO41594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3U0])

HSP 1 Score: 335.495 bits (859), Expect = 4.289e-110
Identity = 179/449 (39.87%), Postives = 277/449 (61.69%), Query Frame = 1
Query:  232 TGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNC-------VQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPD---MYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATEPDESL 1545
            +GV++  GS+G  + +W LCGV +M+G+ CY ELG +I +S  +YAY+  AFG  +AF+  W   I+ +P  IAIVSL F +Y++EP F  C       +   +  + LAA CI ++T++NC+SVK +TRVQ +FT AKL+A+ ++I+TG+V+L  GFT +++  F  T T IG +   FYNGL+AY GWN LN + EE+KNP +DLP+++L    + TV Y+L N++Y T+L+P+E+  + AVAV +    + VM W IP+FV+ STFG  NG   +  R+  VAA+   +P  LAM+ T   TP+P+++F S+++ + L+ PD      L+NY  F  W+ +   + ALL+ R+ K   ++ERP+ V L+ PI+ LL S ++I+  F     ES    + +L  +P YL+ V +K  PK F   +   T  +Q L      E +E +
Sbjct:   11 SGVFMYTGSAGLGIAVWALCGVIAMMGSLCYAELGTMIVKSGAEYAYLNAAFGERVAFLFSWTSTILLKPSQIAIVSLAFGQYVVEPFFPTCSGFDPDRLDLKILEKLLAAVCIGVITYVNCFSVKLATRVQVVFTAAKLIAIAMLIITGLVRLGQGFTGSFDDAFKGTTTSIGMVGFAFYNGLWAYDGWNNLNYVTEELKNPYRDLPRSILFGIPLGTVCYVLVNIAYLTVLTPVEVMASGAVAVTLSNRLYGVMAWTIPIFVACSTFGAANGSAFSGGRLVYVAAREGHLPEFLAMVHTKRHTPLPAMLFNSIIAWLMLL-PDSSSFETLINYFSFAAWVFYGSTVSALLWLRYRKP--EMERPYKVPLLVPIMVLLASLYLIIAPFYEAPLESFYCLLFILAGIPFYLVFVYFKVAPKWFLNGVDSITYKLQVLCDCALPESEEEV 456          
BLAST of slc7a-7 vs. Ensembl Nematostella
Match: EDO40551 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S703])

HSP 1 Score: 329.717 bits (844), Expect = 4.184e-107
Identity = 189/469 (40.30%), Postives = 289/469 (61.62%), Query Frame = 1
Query:  148 QLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNC-VQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMY---VLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLF-IVVATEPD 1536
             LKKE++LING+ +V+G MIGSGIFISP GV  + GS G +LV+W  CG+ ++ G+ CY E+G +I +S  +Y+Y+  AFGP  AF+  W   ++ RP  +AIVSLTFA Y+ +P F NC + P+  R+ LAA C+ L  FINC SV+ +TR+QD FT  KL+A+ I+++ G++ +  G     E PF  +  +   + + FY+GL+AY GWN LN + EEMKNP +DLP+A++I   +VT+ Y+L N++Y  ++    I  + AVA+ +G      M W+IP+FV+ STFG VNG++ + +R+  V+A++  MP  LAMI     TP+PS+IF++ ++++ L+ PD      L+NY  F  WL++   I ALLY R+  K     RP+ V L+ P++    + ++++  F     ES M  I ++  +PVY +  KW    K     +  F   VQK F + +   PD
Sbjct:   34 HLKKEVSLINGVALVVGVMIGSGIFISPKGVLQQTGSVGLSLVVWAGCGLLALFGSLCYCEMGTMIPKSGAEYSYLKDAFGPLPAFLYSWTLALIIRPSSLAIVSLTFARYVTQPFFPNCEISPLSVRKILAACCLALTLFINCASVRWATRIQDSFTLGKLIAIAILVILGIITIAKGQVEYLEDPFEKSTPNPAAIGLAFYSGLWAYDGWNALNFVTEEMKNPARDLPRALIIGIPLVTICYLLTNIAYIAVVGREGILSSGAVAMTVGDMYLGPMSWIIPIFVACSTFGCVNGLLFSGARLVYVSARNGHMPRLLAMIHNKCQTPMPSIIFMNTIALIMLI-PDASEFGTLVNYFSFAAWLSYFAVICALLYLRW--KRPNAHRPYKVWLVIPVIAACAALYLLITPFAKEPVESSMALIFIVLGIPVYFLFCKWDILGKMCGPSVDKFLWNVQKWFDLSLEERPD 499          
BLAST of slc7a-7 vs. Ensembl Nematostella
Match: EDO37074 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGV3])

HSP 1 Score: 327.791 bits (839), Expect = 1.795e-106
Identity = 191/480 (39.79%), Postives = 288/480 (60.00%), Query Frame = 1
Query:  106 ENDKKSNDSN-EDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYP--DMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            E D ++     + K  L+K +TL++GI  ++G++IGSGIFISPTG+     S G +L++W  CG  +++   CY ELG  +++S  +YAY+ +AFGP  AF+  W  +I+ RP   AIVSL FAEY+ +P F  C  P    + L  +CI+ +T INCWSV+ +TRVQ IFT+AKLL + ++++ GVV+LC G T N ++ F  + TD  ++   FY GL+AY GWN LN   EEMK+P +D+PKA++I  SI+T  Y++ N++Y T+L    I  + AVAV IG      M W+IP+FV+ STFG VNG+  T+ R+   AA+   +P+ LAMI     TP+PS++  S +++  L+ P  +   L+ +  F  WL +  +  ALL+ R+ K   ++ RP+ V ++ PI  LL S ++ +  FV     S +  +I+L  +P Y        PK F R    FT   QKLF +   + D
Sbjct:   22 EADPEAPKVQIQSKVGLEKRVTLLSGISFIVGTVIGSGIFISPTGILGTTQSIGLSLMVWFGCGFLALLACLCYTELGTAVQKSGAEYAYLMEAFGPIPAFLFAWTGIIINRPAITAIVSLIFAEYVAKPFFPECAPPPAVVKLLGLACIVTVTGINCWSVRWATRVQRIFTYAKLLCIAMLVIIGVVELCKGKTENLQNAFEGSETDPAKIGFAFYIGLWAYDGWNSLNYCTEEMKDPARDMPKAIIIGISIITGCYLMVNIAYITVLGGAGILASEAVAVSIGDVYLGPMKWIIPVFVAASTFGTVNGVAFTSGRLTYTAARDGLLPSMLAMIQVKRLTPLPSMLLTSTIAICMLLPPGSNFMSLVGFFSFAAWLFYGGSFAALLWLRYKKP--EMPRPYRVPIVIPIFMLLASMYLCIAPFVAKPIGSTIACLIILAGLPFYFFFKSPYVPKWFRRYFESFTYGSQKLFNIALADED 499          
BLAST of slc7a-7 vs. Ensembl Nematostella
Match: EDO41148 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S561])

HSP 1 Score: 304.679 bits (779), Expect = 1.379e-97
Identity = 170/489 (34.76%), Postives = 288/489 (58.90%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQ-----PIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPD---MYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWKK-PKSFNRKLGDFTKFVQKLFIVVATEPDESL 1545
            + +     + ++   L++ + L   +  ++G++IGSGIF +P  V L  GS G +L++W LCG+ ++ G+  Y+EL  +I R  G+YAY+ QAFGPF AF+  WI V   +P  + I+ L F  Y++EP F +C       P++  + LAAS + ++T +NC SVK S+R+Q  FT  K++A+++++LTG+V++  G  S+ +  F  T T +G +   FYNGLF+Y GWN LN  +EE+K P + +P+A+ I+  +VT  Y+L N+ Y ++L+P E++ +NAVAV +    + VM W IP+ V+ STFG  NG   +  R+   AA+   +P  LAM+ T   TPIP+++F S +S + L+ PD      L+N+  F+ WL +   + ++++ R  +K +   RP+ V +I P +  L+S +++V  F      S    + +L+ +PVYL  V++K  P+    +    T  +Q +  V   + ++ L
Sbjct:   19 DENACPKQTQDEYIGLRRNVGLSGAVAFLVGTIIGSGIFATPRWVLLYTGSVGLSLLVWALCGMIALFGSLSYVELALMIPRCGGEYAYLMQAFGPFAAFLYSWISVCFLKPATVLIL-LAFGAYVIEPFFPHCSHREDLVPVI--KILAASALGVITIVNCASVKWSSRIQIAFTVGKMIAILMLVLTGIVRIAQGHVSSLKDSFQGTATSLGMVGFAFYNGLFSYDGWNQLNFFVEEIKEPNRTVPRAIWIAIPLVTASYVLVNIGYLSVLTPDELRTSNAVAVTLASRMYGVMAWTIPILVAFSTFGSANGNFFSGGRLAYAAAREGHLPELLAMVHTKRHTPIPAILFSSTISCIMLI-PDSSKFETLLNFGAFIVWLFYGVTMFSIIWMRVRQKDKT--RPYKVPIILPCLMTLLSIYLVVAPFYQAPLPSFYALLAVLSGIPVYLFFVRYKVLPQCIMDRYARITVRIQLVLGVALPKSEKEL 501          
BLAST of slc7a-7 vs. Ensembl Medaka
Match: ENSORLT00000006048.2 (large neutral amino acids transporter small subunit 1 [Source:NCBI gene;Acc:101158196])

HSP 1 Score: 386.341 bits (991), Expect = 1.825e-128
Identity = 206/472 (43.64%), Postives = 309/472 (65.47%), Query Frame = 1
Query:  130 SNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTS--NWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWKKPKSFNRKLGDFTKFVQKLFIVVATEPDE 1539
            +  +K +LK+ ITL NG+G++IG++IGSGIF++PTGV  + GS+G +LV+W  CGV S +GA CY ELG  I +S GDY YI + +G   AF++LW+++++ RP    +VSL FA Y+L+P++ +C  P  A + +A  C+  LTF+NC SV+A+T+VQD+FT +KL AL I+IL G +++  G       E  F  +   +  + +  Y+GLFA+ GWNYLN + EEM NP ++LP A++IS  IVTVVY+L N++YFT +SP  +  + AVAV  G  +   M W+IP+FV MS FG VNG + T++R+F   A+  Q+PA+L ++ T L TP+PS+IF   +SM+Y +  D++ ++N   F TWL    AI  L++ R +K    L RP  V+L  P+ ++L   F+IV +F    +E ++GT I+LT +P YL+G KWKKP    + L  FT F QK+ + V  E ++
Sbjct:   58 AKSEKIELKRSITLFNGVGMIIGTIIGSGIFVTPTGVVKETGSAGLSLVVWSACGVVSTMGALCYAELGTTIAKSGGDYTYILEVYGELAAFLKLWVEMLIIRPSSQYVVSLVFATYLLKPLYPSCPVPDSAAKLIACLCLTSLTFVNCISVRAATKVQDLFTASKLFALCIIILFGFIQIFTGDVPYLTPEKSFEGSKMGVDNIVLALYSGLFAFGGWNYLNYVTEEMVNPERNLPLAIIISMPIVTVVYVLTNLAYFTTISPEVMVESEAVAVTFGEQHLGRMSWLIPVFVGMSCFGAVNGSLFTSARLFYAGAREGQLPAALGLVHTDLFTPVPSLIFTCFLSMMYTISQDIFSVINLFSFFTWLCVGMAIAGLVWLRLTKP--DLRRPIKVYLFIPVTFVLGCIFMIVVSFWAAPFECLVGTSIILTGIPAYLLGYKWKKPHMVQKMLEIFTMFCQKILMSVPEEREQ 527          
BLAST of slc7a-7 vs. Ensembl Medaka
Match: slc7a5 (solute carrier family 7 member 5 [Source:NCBI gene;Acc:101163489])

HSP 1 Score: 373.629 bits (958), Expect = 1.074e-123
Identity = 214/478 (44.77%), Postives = 315/478 (65.90%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNW--ESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATE 1530
            E+  ++    ED   LK+ ITL+NG+ I++G++IGSGIF++PTGV  +AGS G +L++W +CGVFS +GA CY ELG  I +S GDYAYI + +G   AF++LWI++++ RP    IV+  FA Y+L+P+F  C  P    + +A  CILLLTF+NC+SVKA+TRVQD F  AKLLAL+++I+ G VK+  G T +   E+ F  +N + G + +  Y+GLFAY GWNYLN + EEM  P K+LP+A++IS  IVT VY+L N++YFT LSP ++  + AVAV  G  +   M W+IP+FV +S FG VNG + T+SR+F V A+   +P  L+MI  +L TP+PS+IF  L++++Y    D++ ++N+  F  WL  A AI+ +++ R  K   +LERP  V+++ PI ++L   F+I+ +F     E  +G  I+ T +PVY IGV W+ KPK     +   T + QK+  VV  E
Sbjct:   41 EDKGEAAAGGEDGVALKRTITLLNGVAIIVGTIIGSGIFVTPTGVVKEAGSVGLSLIVWAVCGVFSTVGALCYAELGTTITKSGGDYAYILEVYGSLPAFLKLWIELLIIRPSSQYIVAYVFATYLLKPLFPVCPVPENGAKLVACLCILLLTFVNCYSVKAATRVQDFFAAAKLLALILIIIIGFVKIGQGDTDDLLPENSFKGSNYEFGNIGLALYSGLFAYGGWNYLNFVTEEMIEPYKNLPRAIIISLPIVTAVYVLTNLAYFTTLSPQQMLGSEAVAVDFGNHHLGPMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGAREGHLPNLLSMIHPTLLTPLPSLIFTCLMTLLYAFSNDIFSVINFFSFFNWLCIALAIIGMMWLRHKKP--ELERPIKVNILLPISFVLACLFLIIVSFWKTPIECAIGFGIIATGLPVYFIGVWWQNKPKWLLHGIFSSTAWCQKVMEVVPQE 516          
BLAST of slc7a-7 vs. Ensembl Medaka
Match: slc7a7 (solute carrier family 7 member 7 [Source:NCBI gene;Acc:101169978])

HSP 1 Score: 363.999 bits (933), Expect = 3.584e-120
Identity = 204/476 (42.86%), Postives = 305/476 (64.08%), Query Frame = 1
Query:  118 KSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLI---GVKWKKPKSFNRKLGDFTKFVQKLFIVVATEPD 1536
            KS  S+E   +LKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LV+W + G+FS+ GA CY ELG  I +S   YAYI +AFG FLAF+RLW  +++  P   A++++TF+ Y+++P+F  C+ P +A R LAA+CI LLTF+NC  VK  TRVQD FT+AK+LAL+ VI+TG+VK+  G+T N++  F  ++ D G L +  Y+ LF+Y GW+ LN + EE+KNP ++LP A+ IS  IVTV+Y+L NV+Y+TIL    I  ++AVAV      F VM W IP+ V++S FGG+N  I+  SR+F V ++   +P  L MI  S  TPIP+++F   ++++YL   D++ L+NY  F  W     +IL  LY R+  K     RP  + LI+PI++ +++ F++V         S++G  I L+ VPVY +      +K+P      +      +QK+   V TE D
Sbjct:   21 KSGSSDESM-KLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIHSASYGLSLVVWTIGGIFSIFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYVANRLLAAACICLLTFVNCAYVKWGTRVQDFFTYAKVLALIAVIITGLVKIGQGYTQNFDGMFDGSSRDPGHLALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIAISMPIVTVIYILTNVAYYTILPINAILDSDAVAVTFADQVFGVMNWTIPLAVALSCFGGLNASIVAASRLFFVGSREGHLPDFLCMIHVSRYTPIPALLFNGFMALIYLCVEDVFRLINYYSFSYWFFVGLSILGQLYLRW--KEPDRVRPLKLSLIYPIIFCILTVFLVVVPLYSDTINSLIGIGIALSGVPVYFLCCYTPAYKRPLWLRNFIAKSGLIIQKVCFSVLTEMD 493          
BLAST of slc7a-7 vs. Ensembl Medaka
Match: slc7a6 (Y+L amino acid transporter 2 [Source:NCBI gene;Acc:101174987])

HSP 1 Score: 351.673 bits (901), Expect = 1.891e-115
Identity = 198/476 (41.60%), Postives = 307/476 (64.50%), Query Frame = 1
Query:  124 NDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGV---KWKKPKSFNRKLGDFTKFVQKLFIVVATEPDES 1542
             +S ++  QLKKEI+L+NG+ +++G+MIGSGIF+SP GV + + S G +LVIW + G+FS++GA CY ELG  I +S   YAYI ++FG F+AF+RLW  +++  P   A++++TFA Y+++P+F  C  P +A R LAA+C+ LLTFIN   V+  TRVQDIFT+AK+ AL+++I+TG+VKLC G+T+N+ES F  ++ D G + +  Y+ LF+Y GW+ LN + EE+KNP ++LP A+ IS  IVT +Y+L NV+Y+ +L    I  ++AVAV        +M W IP+ V++S +GG+N  I+  SR+F V ++   +P +L+MI     TPIP++IF  ++S++YL   D++ L+NY  F  W     ++   +Y R+  K     RP  + L++P+V+ + S F++          S++G  I L+ VPVY +GV   + K+P    + L   T F Q     V TE D+S
Sbjct:   21 QESPKETVQLKKEISLLNGVSLIVGNMIGSGIFVSPKGVLIYSASYGLSLVIWAIGGLFSVVGALCYAELGTTITKSGASYAYILESFGGFIAFIRLWTSLLIIEPTSQAVIAITFANYLVQPLFPTCEPPYVAARLLAAACLCLLTFINSAYVRWGTRVQDIFTYAKVAALIVIIVTGIVKLCQGYTNNFESAFQGSSADPGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTTIYILTNVAYYAVLDVGAILGSDAVAVTFADHTLGLMSWTIPIAVALSCYGGLNASIIAASRLFFVGSREGHLPDALSMIHIERFTPIPALIFNCIMSLIYLTVEDVFQLINYYSFSYWFFMGLSVAGQIYLRW--KQPDRARPLKLTLVYPLVFCMCSVFLVAVPLYSNTVNSLIGIAIALSGVPVYFLGVYLPESKRPPIITKLLRSLTYFTQYSCFCVLTEMDKS 494          
BLAST of slc7a-7 vs. Ensembl Medaka
Match: slc7a10a (asc-type amino acid transporter 1 [Source:NCBI gene;Acc:101166040])

HSP 1 Score: 352.058 bits (902), Expect = 2.713e-115
Identity = 201/486 (41.36%), Postives = 301/486 (61.93%), Query Frame = 1
Query:  106 ENDKKSNDSNED---KCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFS---DTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATEPDES 1542
            +  ++ +DSN D   K  LKKEI L++   I+IG++IGSGIFISP GV   AGS G +L++W+  G    +G+ CY ELG  I +S GDY+Y+ + FG  + F+ LW  V++  P  +A+++LTF+ Y+L+P F NCV P +A + LAA C+L LT++NC SV+ +TR+QDIFT  KLLAL ++I+ G+V++  G         +     ++ +GQ+ + F    FAY GWN+LN + EE+  P K+LP+A+ IS  +VT+VY + N++YF+ ++P E+  +NAVAV  G     +  WV+P+ V++STFGG+NG + T+SR+    A+   +P  LAMI     TPIP+++     ++V L   + + L+NYV F+ +L++   I  LLY R  K    L RP  V L+ PI YL+  A ++ F+         +G +IMLT VPVY +GV+WK KPK   R +  FT   QKL  VV  + D S
Sbjct:   15 KTRRRKDDSNSDNSGKVTLKKEIGLLSACAIIIGNIIGSGIFISPKGVLEHAGSVGLSLIVWVCGGGICALGSLCYAELGVTIPKSGGDYSYVTEIFGGLVGFLLLWSAVLIMYPTTLAVIALTFSNYVLQPAFQNCVPPFIAIKLLAAICVLFLTWVNCSSVRWATRIQDIFTVGKLLALALIIVVGLVQIFRGHYDALVPSVAFEFQQDSSVGQIALAFLQASFAYSGWNFLNYVTEEVVEPRKNLPRAIYISIPLVTLVYTMTNIAYFSSMTPEELLASNAVAVTFGEKLLGMFSWVMPISVALSTFGGINGYLFTSSRLCFSGAREGHLPYLLAMIHLKNCTPIPALLVCCFATIVILCIGETHNLINYVSFINYLSYGVTIAGLLYLR--KTRPNLARPIRVSLLVPISYLVFWAVLLGFSLYSEPVVCGLGMVIMLTGVPVYFVGVQWKEKPKWVYRLVERFTYVGQKLCYVVFPQNDSS 498          
BLAST of slc7a-7 vs. Planmine SMEST
Match: SMESG000044247.1 (SMESG000044247.1)

HSP 1 Score: 936.791 bits (2420), Expect = 0.000e+0
Identity = 483/483 (100.00%), Postives = 483/483 (100.00%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWKKPKSFNRKLGDFTKFVQKLFIVVATEPDESLKLS 1554
            ENDKKSNDSNEDKCQLKKEITLINGIGIVIGSMIGSGIFISPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWKKPKSFNRKLGDFTKFVQKLFIVVATEPDESLKLS
Sbjct:    8 ENDKKSNDSNEDKCQLKKEITLINGIGIVIGSMIGSGIFISPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWKKPKSFNRKLGDFTKFVQKLFIVVATEPDESLKLS 490          
BLAST of slc7a-7 vs. Planmine SMEST
Match: SMESG000025359.1 (SMESG000025359.1)

HSP 1 Score: 622.468 bits (1604), Expect = 0.000e+0
Identity = 308/479 (64.30%), Postives = 402/479 (83.92%), Query Frame = 1
Query:  115 KKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVV-ATEPDESL 1545
            K SN        LKK ITL+NG+ I++GSMIGSGIFISPTGVYLK GSS ++++IW+LCG+++MIGAYCY ELGC+IKRS+GDYAY+Y+AFGP +AF+R+WIDVIVTRPC +AI+SLTFA+Y+LEP++  C QP +AR+ LAA+CIL++TF+NCWSVKASTRVQDI T+AK+ AL+I+I+TG+VKL MG+T NWESPF  T T+ G +TM FY GLFAY GW+YLNCM+EEMK+PVKD+P+A+ ISC +VT++Y+LANVSYFTILS  EI  +NA+AVRIG   + VMWW+IP+FV++STFGGVNG I+TTSR+FLVAAQ DQMP  LAMI+T  STPIPSV+FV++VS+ YL++PD++ LMNYVGFVTWLTF  A+L+L+YFR   K++K+ERP  V+++FPI+YL V+ F+I+FAF+GG +ESMMGT+IM++A+PVY I V WK KPK FNR L      VQK+F+V+    P++++
Sbjct:   11 KSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRIGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRI--KWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKRFNRMLESINISVQKMFMVILPAMPEKAM 487          
BLAST of slc7a-7 vs. Planmine SMEST
Match: SMESG000051755.1 (SMESG000051755.1)

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 269/475 (56.63%), Postives = 364/475 (76.63%), Query Frame = 1
Query:  106 ENDKKSNDSNEDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWKKPKSFNRKLGDFTKFVQKLFIVVATE 1530
            + D+   +S+ DK +LKKEI L+NGIGI++GS+IGSGIF+SPT V++K+GS G+AL+IW LCG+FS+IGAYCY+ELG +I RS GDYAY+  AFGPF+AF+RLW+DVIV RP   AI++L FAEY LE +++ CV PIMA+R LAA CI +LTFINC+SV+ ST VQDI ++AK+ AL+I+I+TG+VKL  G T NWE+ F+D++T+ G   M FY GLFAY GWNYLNC++EEMKNP +DLP ++LIS  ++  +Y+L N++YFTIL P EI  T AVAV + +  + VMWW++P+FV+MSTFGGVNG ++ TSR+F VAAQ +QMP  L  I+    TP+PSV+FVSLVS+VYL + D+ +L+NY+GFV WL    A+  +++FR+    +   RP  VHL FPI+Y + +  +++ +FVGG YES+MG +I+LTA PVY I V WKKPKSF  KL + T  +QKLF VV ++
Sbjct:    5 KTDEVVKESSNDKVELKKEINLLNGIGIIVGSIIGSGIFVSPTEVFIKSGSPGSALIIWFLCGIFSLIGAYCYMELGTMITRSGGDYAYVLDAFGPFIAFLRLWVDVIVARPVSQAIIALVFAEYTLEALYIGCVSPIMAKRLLAAGCIGILTFINCYSVRWSTLVQDILSYAKVFALLIIIMTGIVKLAQGDTGNWENAFADSSTNPGDYAMAFYAGLFAYNGWNYLNCLIEEMKNPRRDLPLSILISMILIIFIYVLTNMAYFTILLPSEILNTKAVAVTVAIRLYGVMWWIMPIFVAMSTFGGVNGNLLATSRIFFVAAQENQMPMILETINVKYYTPVPSVLFVSLVSLVYLCFSDINILINYMGFVNWLAIGVAVFTVIWFRYKDPSKP--RPIRVHLAFPIIYCVATVILLILSFVGGPYESLMGIVIILTAAPVYWIFVLWKKPKSFQDKLDNITVVLQKLFYVVPSQ 477          
BLAST of slc7a-7 vs. Planmine SMEST
Match: SMESG000081276.1 (SMESG000081276.1)

HSP 1 Score: 311.612 bits (797), Expect = 5.492e-100
Identity = 185/474 (39.03%), Postives = 290/474 (61.18%), Query Frame = 1
Query:  136 EDKCQLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEI----KLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVVATEPDES 1542
            ++K  L+KEI ++ G+ I+IG +IGSGIF+SP GV     S G + VIW+L GVFS+IGA  Y ELG  I  S G+Y YI + FG  LAF  LWI  ++      A  +  FA+Y+L+P+FL C  P  A+ CL    +  L  INC++VK + ++  +FT  K+ AL+++I  G+  + MG + ++  PF+ +N + G L++ FY+G +A+ GWNYLN + EEMKNP ++LP A+L+S  IVT VY++ NV+Y  +L+P E+    + ++A+AV           W++P+ V+ S FG +NG I++ SR+    A    +P  ++MIS S  TP+PS+I + +V + + +  D++ L+   GF   + FA A  +LLY R   K  + +  F +++I PI +L+V  F+ V A      ES++G  IM+  VP++L+GV WK KPKSFN    + T + QKL +V+  + ++ 
Sbjct:   11 DEKAVLRKEIGVLQGVSIIIGVIIGSGIFVSPVGVLKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGAASTAANAFIFAQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSALLLIIGLGLFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTVISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIR--HKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAEDD 482          
BLAST of slc7a-7 vs. Planmine SMEST
Match: SMESG000017104.1 (SMESG000017104.1)

HSP 1 Score: 309.686 bits (792), Expect = 5.523e-99
Identity = 187/466 (40.13%), Postives = 282/466 (60.52%), Query Frame = 1
Query:  148 QLKKEITLXXXXXXXXXXXXXXXXXXXPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKL----TNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKW-KKPKSFNRKLGDFTKFVQKLFIVVATE 1530
            QL+K+I +  G+ I+IG ++GSGIF+SP GV     S G + V+W++ G+FS  GA  + ELG  I RS G+Y YI + FG   AF+ LWI  I+      A  S+ FA+YIL+P+F +C  P+ A    A   I+ L  INC++V+ +T++  +FT +K+LAL+I+I+ G V L  G T ++  PFS +      + M FY G +AY GWNYLN +  EMKNP K+LP A+++S +++TVVY+L NV+Y  +LSP EI L    + AVAV        VM WV+P+FV MS FG +N  +++ SR+    A+  QMP  LAM+S    TP+P+VI ++L+++++  Y + + L+   GF   +  A A+  LLY R+  K   L RPF + +I P+++LL   FI         ++S +   +ML ++PVY+I + W KKP+S    +   T  +QKL  VV  +
Sbjct:   32 QLRKDIGVFEGVSIIIGVIVGSGIFVSPVGVLKYTDSVGLSFVMWLIAGIFSTTGALVWAELGTTIPRSGGEYIYIMKTFGSMPAFLCLWITFILIGAVATAANSMIFAQYILQPIFGSCEVPVTAVLITANLGIMTLGAINCYNVQWATKMAIVFTVSKVLALLIIIVIGGVYLIRGNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITVVYLLVNVAYLAVLSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVIIITLLTILFQFYRNAFYLIELAGFAFAVIAAMAVCCLLYLRY--KCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKITVNLQKLLNVVLQD 495          
The following BLAST results are available for this feature:
BLAST of slc7a-7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A61.367e-11941.04solute carrier family 7 member 6 [Source:HGNC Symb... [more]
SLC7A61.367e-11941.04solute carrier family 7 member 6 [Source:HGNC Symb... [more]
SLC7A71.634e-11741.36solute carrier family 7 member 7 [Source:HGNC Symb... [more]
SLC7A71.634e-11741.36solute carrier family 7 member 7 [Source:HGNC Symb... [more]
SLC7A71.634e-11741.36solute carrier family 7 member 7 [Source:HGNC Symb... [more]
back to top
BLAST of slc7a-7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aat-14.871e-12144.21Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-14.871e-12144.21Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-34.667e-11543.09Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-38.333e-11543.09Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-21.991e-10041.05Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of slc7a-7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG16071.189e-14849.31gene:FBgn0039844 transcript:FBtr0085785[more]
CG16071.189e-14849.31gene:FBgn0039844 transcript:FBtr0085786[more]
CG16073.558e-14848.41gene:FBgn0039844 transcript:FBtr0334550[more]
CG16073.558e-14848.41gene:FBgn0039844 transcript:FBtr0334549[more]
mnd3.357e-11944.69gene:FBgn0002778 transcript:FBtr0075626[more]
back to top
BLAST of slc7a-7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a63.136e-12140.78solute carrier family 7 member 6 [Source:NCBI gene... [more]
slc7a68.711e-12141.85solute carrier family 7 member 6 [Source:NCBI gene... [more]
slc7a52.088e-12045.44solute carrier family 7 member 5 [Source:ZFIN;Acc:... [more]
slc7a73.862e-11941.49solute carrier family 7 member 7 [Source:ZFIN;Acc:... [more]
slc7a73.862e-11941.49solute carrier family 7 member 7 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc7a-7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a74.696e-12742.17solute carrier family 7 (amino acid transporter li... [more]
slc7a77.638e-12542.68solute carrier family 7 (amino acid transporter li... [more]
dpm31.305e-12344.98dolichyl-phosphate mannosyltransferase polypeptide... [more]
dpm31.384e-12344.98dolichyl-phosphate mannosyltransferase polypeptide... [more]
slc7a72.147e-12342.30solute carrier family 7 (amino acid transporter li... [more]
back to top
BLAST of slc7a-7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc7a61.727e-12041.25solute carrier family 7 (cationic amino acid trans... [more]
Slc7a82.505e-11943.37solute carrier family 7 (cationic amino acid trans... [more]
Slc7a72.586e-11641.39solute carrier family 7 (cationic amino acid trans... [more]
Slc7a72.586e-11641.39solute carrier family 7 (cationic amino acid trans... [more]
Slc7a72.586e-11641.39solute carrier family 7 (cationic amino acid trans... [more]
back to top
BLAST of slc7a-7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BGK6|YLAT2_MOUSE1.208e-11941.25Y+L amino acid transporter 2 OS=Mus musculus OX=10... [more]
sp|Q59I64|YLAT2_DANRE1.937e-11941.63Y+L amino acid transporter 2 OS=Danio rerio OX=795... [more]
sp|Q9WVR6|LAT2_RAT2.376e-11944.26Large neutral amino acids transporter small subuni... [more]
sp|Q92536|YLAT2_HUMAN6.567e-11941.04Y+L amino acid transporter 2 OS=Homo sapiens OX=96... [more]
sp|Q9QXW9|LAT2_MOUSE1.752e-11843.37Large neutral amino acids transporter small subuni... [more]
back to top
BLAST of slc7a-7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YIW30.000e+0100.00Slc7a-7 OS=Schmidtea mediterranea OX=79327 GN=slc7... [more]
A0A0H3YK320.000e+064.09Slc7a-9 OS=Schmidtea mediterranea OX=79327 GN=slc7... [more]
A0A0H3YJ060.000e+064.63Slc7a-10 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YEY50.000e+056.63Slc7a-6 OS=Schmidtea mediterranea OX=79327 GN=slc7... [more]
A0A1S3IH311.080e-16451.26large neutral amino acids transporter small subuni... [more]
back to top
BLAST of slc7a-7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a71.438e-11943.07solute carrier family 7 member 7 [Source:NCBI gene... [more]
slc7a72.014e-11943.07solute carrier family 7 member 7 [Source:NCBI gene... [more]
slc7a72.014e-11943.07solute carrier family 7 member 7 [Source:NCBI gene... [more]
slc7a8b2.269e-11844.17large neutral amino acids transporter small subuni... [more]
slc7a10b3.285e-11241.02asc-type amino acid transporter 1-like [Source:NCB... [more]
back to top
BLAST of slc7a-7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A113.020e-10540.17solute carrier family 7 member 11 [Source:HGNC Sym... [more]
ENSPMAT00000002665.11.161e-8038.50pep scaffold:Pmarinus_7.0:GL476806:119517:143089:1... [more]
slc7a75.304e-6647.28solute carrier family 7 member 7 [Source:ZFIN;Acc:... [more]
ENSPMAT00000000258.12.681e-4437.69pep scaffold:Pmarinus_7.0:GL477686:30307:38152:1 g... [more]
slc7a57.221e-3837.06solute carrier family 7 member 5 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc7a-7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
MUP11.891e-1321.15High affinity methionine permease; integral membra... [more]
MUP38.268e-1321.41Low affinity methionine permease; similar to Mup1p... [more]
back to top
BLAST of slc7a-7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO415452.100e-11040.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415944.289e-11039.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405514.184e-10740.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370741.795e-10639.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411481.379e-9734.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc7a-7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000006048.21.825e-12843.64large neutral amino acids transporter small subuni... [more]
slc7a51.074e-12344.77solute carrier family 7 member 5 [Source:NCBI gene... [more]
slc7a73.584e-12042.86solute carrier family 7 member 7 [Source:NCBI gene... [more]
slc7a61.891e-11541.60Y+L amino acid transporter 2 [Source:NCBI gene;Acc... [more]
slc7a10a2.713e-11541.36asc-type amino acid transporter 1 [Source:NCBI gen... [more]
back to top
BLAST of slc7a-7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044247.10.000e+0100.00SMESG000044247.1[more]
SMESG000025359.10.000e+064.30SMESG000025359.1[more]
SMESG000051755.10.000e+056.63SMESG000051755.1[more]
SMESG000081276.15.492e-10039.03SMESG000081276.1[more]
SMESG000017104.15.523e-9940.13SMESG000017104.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30007103
GenBankAKN21451.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007103 ID=SMED30007103|Name=slc7a-7|organism=Schmidtea mediterranea sexual|type=transcript|length=1638bp
CTTTACTCGAATTTGTATTTAAATCTCAACTCGCGTAGTTTTTCTTTTTA
GAAAATATATTTTAATAAGAAGAAATTTTTACTAATGAAGAAGAATTCTC
TTAACGAAAACGATAAAAAGTCAAATGATAGCAATGAGGATAAATGCCAA
CTAAAGAAAGAAATTACATTGATAAATGGAATAGGCATTGTTATTGGTTC
AATGATTGGATCAGGTATTTTTATAAGTCCGACTGGAGTATATTTGAAGG
CAGGCAGCAGTGGTGCAGCCCTTGTTATTTGGATGTTGTGCGGTGTTTTC
TCCATGATTGGAGCATATTGTTACATTGAACTGGGTTGCATAATTAAAAG
ATCCAGTGGAGATTATGCCTATATTTATCAAGCATTTGGGCCATTTTTAG
CGTTTGTCCGATTATGGATTGATGTAATTGTAACAAGACCTTGTTGTATA
GCAATTGTCTCATTGACTTTTGCTGAATATATATTAGAGCCAATGTTTCT
TAATTGCGTACAACCGATTATGGCTCGAAGATGTTTGGCAGCATCCTGCA
TATTGCTGCTGACATTCATCAATTGTTGGTCGGTCAAAGCATCTACTCGG
GTTCAAGATATTTTTACATTCGCAAAACTGTTGGCGTTGGTTATTGTCAT
TTTAACTGGAGTAGTAAAATTATGCATGGGATTCACATCCAATTGGGAAA
GTCCATTTAGTGATACAAATACTGATATCGGACAACTGACAATGGGATTT
TACAACGGATTATTTGCATATTGCGGGTGGAATTATTTAAATTGTATGAT
GGAGGAAATGAAAAATCCAGTAAAAGATTTACCGAAGGCTGTCCTAATTT
CATGTTCAATTGTTACAGTCGTCTATATGTTAGCCAATGTCTCATATTTC
ACCATTTTGTCACCCATCGAAATCAAGTTGACAAACGCAGTTGCAGTGAG
AATCGGCCTGGACAATTTCAGCGTAATGTGGTGGGTCATACCGATGTTTG
TGTCGATGTCAACATTTGGCGGTGTTAATGGAATCATCATGACCACCTCA
AGAATGTTTCTAGTAGCTGCACAGAGCGATCAAATGCCTGCCTCATTGGC
AATGATAAGCACAAGTTTAAGTACTCCAATTCCGTCAGTGATATTTGTGT
CTCTCGTCTCAATGGTATATTTGGTATATCCAGACATGTATGTCCTTATG
AATTATGTTGGATTCGTAACATGGTTGACATTTGCATTTGCAATCTTAGC
GCTTTTGTACTTCCGATTTTCTAAGAAATATCAAAAATTAGAAAGACCAT
TTACGGTACATTTGATATTCCCAATTGTTTATCTATTAGTGTCAGCATTC
ATAATTGTTTTCGCCTTCGTTGGGGGATTTTATGAATCAATGATGGGGAC
GATAATAATGTTGACGGCAGTTCCGGTTTATTTGATCGGAGTCAAATGGA
AAAAGCCTAAGTCGTTCAATCGGAAATTAGGTGATTTTACTAAATTCGTT
CAAAAGCTTTTCATTGTCGTAGCTACGGAACCTGATGAATCTCTGAAATT
GTCCTAAAAACCATATTAGCGATAAGAAATGTCTTATTTTGTGTTTTGGT
GTTTAAAGTCGTAAAAATATGATTATTTCTATTGTGGT
back to top

protein sequence of SMED30007103-orf-1

>SMED30007103-orf-1 ID=SMED30007103-orf-1|Name=SMED30007103-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=491bp
MKKNSLNENDKKSNDSNEDKCQLKKEITLINGIGIVIGSMIGSGIFISPT
GVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQA
FGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRC
LAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGF
TSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLP
KAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWW
VIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIP
SVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQ
KLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYL
IGVKWKKPKSFNRKLGDFTKFVQKLFIVVATEPDESLKLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0015171amino acid transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0003333amino acid transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0000478pharynx musculature
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR002293AA/rel_permease1
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1740.10coord: 22..473
e-value: 4.0E-85
score: 288.1
NoneNo IPR availablePANTHERPTHR11785AMINO ACID TRANSPORTERcoord: 14..485
NoneNo IPR availablePANTHERPTHR11785:SF389LD25378Pcoord: 14..485
NoneNo IPR availableTMHMMTMhelixcoord: 431..453
NoneNo IPR availableTMHMMTMhelixcoord: 178..200
NoneNo IPR availableTMHMMTMhelixcoord: 295..317
NoneNo IPR availableTMHMMTMhelixcoord: 64..86
NoneNo IPR availableTMHMMTMhelixcoord: 370..392
NoneNo IPR availableTMHMMTMhelixcoord: 338..360
NoneNo IPR availableTMHMMTMhelixcoord: 107..129
NoneNo IPR availableTMHMMTMhelixcoord: 405..427
NoneNo IPR availableTMHMMTMhelixcoord: 27..49
NoneNo IPR availableTMHMMTMhelixcoord: 215..232
NoneNo IPR availableTMHMMTMhelixcoord: 144..166
NoneNo IPR availableTMHMMTMhelixcoord: 253..275
IPR002293Amino acid/polyamine transporter IPIRSFPIRSF006060AA_transportercoord: 2..471
e-value: 3.2E-68
score: 227.6
IPR002293Amino acid/polyamine transporter IPFAMPF13520AA_permease_2coord: 28..441
e-value: 1.5E-55
score: 188.8