Protein NRDE2-like protein

Overview
NameProtein NRDE2-like protein
Smed IDSMED30007098
Length (bp)3216
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein NRDE2-like protein (SMED30007098) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein NRDE2-like protein (SMED30007098) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein NRDE2-like protein (SMED30007098) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein NRDE2-like protein (SMED30007098) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Protein NRDE2-like protein vs. Ensembl Human
Match: NRDE2 (NRDE-2, necessary for RNA interference, domain containing [Source:HGNC Symbol;Acc:HGNC:20186])

HSP 1 Score: 129.413 bits (324), Expect = 1.368e-29
Identity = 87/346 (25.14%), Postives = 149/346 (43.06%), Query Frame = 2
Query:  554 PFDMEIKSNPTTQQQQGESIITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNNSAITD---------------RKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEP------DDPMERGIPFQLIQPVLITL 1528
            P + E K        +  ++       N  + ++P +   W+  +  Q +    P   AI +               +KLAI+E+A+  NQ+++ L L +L +  E W+P  L KEW ++IF H  +  LW+ Y+     Q   FS+ KI +LY KC      +  G   +    P T   +  LF   C +L  +G+SE+AI+ +QAM+++ FF P  ++      L     +  F+ FW + +   G   ARGW  +         V     +  +     +  + +      ++WL  E++R +  W P R +  +       +DP ER + F  I   LI L
Sbjct:  288 PPEQESKQPDAQPDSESAALKAKVEEFNRRVRENPRDTQLWMAFVAFQDEVMKSPGLYAIEEGEQEKRKRSLKLILEKKLAILERAIESNQSSVDLKLAKLKLCTEFWEPSTLVKEWQKLIFLHPNNTALWQKYLLFCQSQFSTFSISKIHSLYGKCLSTLSAVKDGSILSHPALPGTEEAMFALFLQQCHFLRQAGHSEKAISLFQAMVDFTFFKPDSVK-----DLPTKGQVEFFEPFWDSGEPRAGEKGARGWKAWMHQQERGGWVVINPDEDDDEPEEDDQEIKDKTLPRWQIWLAAERSRDQRHWRPWRPDKTKKQTEEDCEDP-ERQVLFDDIGQSLIRL 627          
BLAST of Protein NRDE2-like protein vs. Ensembl Human
Match: NRDE2 (NRDE-2, necessary for RNA interference, domain containing [Source:HGNC Symbol;Acc:HGNC:20186])

HSP 1 Score: 64.3142 bits (155), Expect = 8.824e-11
Identity = 51/210 (24.29%), Postives = 87/210 (41.43%), Query Frame = 2
Query:  941 FSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTV----------YELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEP------DDPMERGIPFQLIQPVLI 1522
            FS+ KI +LY KC      +  G   +    P T            ++  LF   C +L  +G+SE+AI+ +QAM+++ FF P  ++      L     +  F+ FW + +   G   ARGW  +         V     +  +     +  + +      ++WL  E++R +  W P R +  +       +DP ER + F  I   LI
Sbjct:    1 FSISKIHSLYGKCLSTLSAVKDGSILSHPALPGTEEAMFADSEHRMKVAALFLQQCHFLRQAGHSEKAISLFQAMVDFTFFKPDSVK-----DLPTKGQVEFFEPFWDSGEPRAGEKGARGWKAWMHQQERGGWVVINPDEDDDEPEEDDQEIKDKTLPRWQIWLAAERSRDQRHWRPWRPDKTKKQTEEDCEDP-ERQVLFDDIGQSLI 204          
BLAST of Protein NRDE2-like protein vs. Ensembl Zebrafish
Match: nrde2 (NRDE-2, necessary for RNA interference, domain containing [Source:ZFIN;Acc:ZDB-GENE-111117-3])

HSP 1 Score: 132.494 bits (332), Expect = 8.497e-31
Identity = 94/375 (25.07%), Postives = 173/375 (46.13%), Query Frame = 2
Query:  584 TTQQQQGESIITTTAV--LNESISKDPHNIDAWLRLINHQ------SQSFDQPNNS----------AITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEP------DDPMERGIPFQLIQPVLITLHNPQNISSSTPASIVSLNAKKKLILLFLNSLGVSWA 1636
            +T+ Q+  S + +  V   N ++ ++P +I  WL  ++ Q      S SF    +           A+ ++KL+I+++A+  N +++ L L +L +  ELW+P  LQKEW +++F H     LW+ Y+         FSV K+  ++ KC      +  G   +    P T  +L D+F   C +L  +G++E+A+  +QA++++ FF P +++     +L     +  F+ FW + +   G   ARGW  +         V   E    E     +S + +  + + ++WL +E +R    WLP R +  +       +DP +R + F  I P +I +                 + + +LIL FL  LG+  A
Sbjct:  282 STEAQESNSTLLSARVEEFNRNLRENPTDIKLWLDFVHFQDELAFGSGSFSSAGDCDAEMRKMSLRAVLEKKLSIMDRAVESNPSDVDLKLEKLRLCKELWEPAVLQKEWKKLVFIHPNSAPLWKKYLLFTQSHFSTFSVSKVNGVFGKCLSTLSAVQDGSMVSHPPLPGTQEDLLDIFLQQCHFLRQAGHTEKAVCLFQALLDFTFFKPDNVK-----NLATRQQVDFFEPFWDSGEPRIGERGARGWKAWMLQQEKGGWVIPPEPDDDEEEEQEDSEIKDKTWPKWKIWLDVEASREANQWLPWRPDKTKGQSEEDCEDP-DRQVLFDDIGPSMIRVDRA--------------DLQAQLILAFLQFLGLPGA 636          
BLAST of Protein NRDE2-like protein vs. Ensembl Zebrafish
Match: nrde2 (NRDE-2, necessary for RNA interference, domain containing [Source:ZFIN;Acc:ZDB-GENE-111117-3])

HSP 1 Score: 132.494 bits (332), Expect = 8.497e-31
Identity = 94/375 (25.07%), Postives = 173/375 (46.13%), Query Frame = 2
Query:  584 TTQQQQGESIITTTAV--LNESISKDPHNIDAWLRLINHQ------SQSFDQPNNS----------AITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEP------DDPMERGIPFQLIQPVLITLHNPQNISSSTPASIVSLNAKKKLILLFLNSLGVSWA 1636
            +T+ Q+  S + +  V   N ++ ++P +I  WL  ++ Q      S SF    +           A+ ++KL+I+++A+  N +++ L L +L +  ELW+P  LQKEW +++F H     LW+ Y+         FSV K+  ++ KC      +  G   +    P T  +L D+F   C +L  +G++E+A+  +QA++++ FF P +++     +L     +  F+ FW + +   G   ARGW  +         V   E    E     +S + +  + + ++WL +E +R    WLP R +  +       +DP +R + F  I P +I +                 + + +LIL FL  LG+  A
Sbjct:  282 STEAQESNSTLLSARVEEFNRNLRENPTDIKLWLDFVHFQDELAFGSGSFSSAGDCDAEMRKMSLRAVLEKKLSIMDRAVESNPSDVDLKLEKLRLCKELWEPAVLQKEWKKLVFIHPNSAPLWKKYLLFTQSHFSTFSVSKVNGVFGKCLSTLSAVQDGSMVSHPPLPGTQEDLLDIFLQQCHFLRQAGHTEKAVCLFQALLDFTFFKPDNVK-----NLATRQQVDFFEPFWDSGEPRIGERGARGWKAWMLQQEKGGWVIPPEPDDDEEEEQEDSEIKDKTWPKWKIWLDVEASREANQWLPWRPDKTKGQSEEDCEDP-DRQVLFDDIGPSMIRVDRA--------------DLQAQLILAFLQFLGLPGA 636          
BLAST of Protein NRDE2-like protein vs. Ensembl Xenopus
Match: nrde2 (NRDE-2, necessary for RNA interference, domain containing [Source:NCBI gene;Acc:780328])

HSP 1 Score: 143.28 bits (360), Expect = 5.895e-34
Identity = 89/335 (26.57%), Postives = 161/335 (48.06%), Query Frame = 2
Query:  611 IITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNNSAIT---------------DRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNH--PVNDVESQ--LLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNN------NEPDDPMERGIPFQLIQPVLITLHNPQ 1540
            I+      N+ I + P++I  W+  ++ Q +   QP+  + +               ++KLAI+E+A+  N  + +L L +L +  E W+   L KEW ++IF H  D  LW+ Y+     Q   FSV K+ ++Y KC      +  G   + +  PDT   + D+F   C +L  +G++E+ I+ +QA+ ++ F+ P  ++   +   +D      F+ FW + +  FG   A+GW+ +           +N++E    L E  S+ E ++   N    ++WL +E +R    WLP R +       +E +DP ER + F  I P +  + +PQ
Sbjct:  295 ILAKVEDYNKRIRECPNDIQLWMEFVSFQDELVKQPSMYSTSKGELDGHRTSVKLLLEKKLAILERAIESNPGSTELKLAKLKLCEEFWEAPTLLKEWQKLIFLHPNDSQLWQKYLLFCQGQFSTFSVSKMNSIYGKCLSTLAAVQDGIMLSHNALPDTESNMYDIFLQQCQFLRQAGHTEKVISLFQALTDFTFYKPDSVKDMTTKEQVD-----FFEPFWDSGEPRFGEKGAKGWSSWMRQQERGGWIIINNLEDTDLLPEQESDEELSIRGKNCPRYKIWLDVECSREARHWLPWRPDTTKKQTEDECEDP-ERQVLFDDIGPSMFKITSPQ 623          
BLAST of Protein NRDE2-like protein vs. Ensembl Xenopus
Match: nrde2 (NRDE-2, necessary for RNA interference, domain containing [Source:NCBI gene;Acc:780328])

HSP 1 Score: 134.42 bits (337), Expect = 3.465e-31
Identity = 85/333 (25.53%), Postives = 156/333 (46.85%), Query Frame = 2
Query:  611 IITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNNSAIT---------------DRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNH--PVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNN------NEPDDPMERGIPFQLIQPVLITLHNPQ 1540
            I+      N+ I + P++I  W+  ++ Q +   QP+  + +               ++KLAI+E+A+  N  + +L L +L +  E W+   L KEW ++IF H  D  LW+ Y+     Q   FSV K+ ++Y KC      +  G   + +  PDT   + D+F   C +L  +G++E+ I+ +QA+ ++ F+ P  ++   +   +D      F+ FW + +  FG   A+GW+ +           +N++     +      S +   N    ++WL +E +R    WLP R +       +E +DP ER + F  I P +  + +PQ
Sbjct:  293 ILAKVEDYNKRIRECPNDIQLWMEFVSFQDELVKQPSMYSTSKGELDGHRTSVKLLLEKKLAILERAIESNPGSTELKLAKLKLCEEFWEAPTLLKEWQKLIFLHPNDSQLWQKYLLFCQGQFSTFSVSKMNSIYGKCLSTLAAVQDGIMLSHNALPDTESNMYDIFLQQCQFLRQAGHTEKVISLFQALTDFTFYKPDSVKDMTTKEQVD-----FFEPFWDSGEPRFGEKGAKGWSSWMRQQERGGWIIINNLVEDDEDEADEELS-IRGKNCPRYKIWLDVECSREARHWLPWRPDTTKKQTEDECEDP-ERQVLFDDIGPSMFKITSPQ 618          
BLAST of Protein NRDE2-like protein vs. Ensembl Xenopus
Match: nrde2 (NRDE-2, necessary for RNA interference, domain containing [Source:NCBI gene;Acc:780328])

HSP 1 Score: 134.42 bits (337), Expect = 3.592e-31
Identity = 86/334 (25.75%), Postives = 157/334 (47.01%), Query Frame = 2
Query:  611 IITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNNSAIT---------------DRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESALL---NSNYEEVEMWLKLEQARHEAFWLPDRSNN------NEPDDPMERGIPFQLIQPVLITLHNPQ 1540
            I+      N+ I + P++I  W+  ++ Q +   QP+  + +               ++KLAI+E+A+  N  + +L L +L +  E W+   L KEW ++IF H  D  LW+ Y+     Q   FSV K+ ++Y KC      +  G   + +  PDT   + D+F   C +L  +G++E+ I+ +QA+ ++ F+ P  ++   +   +D      F+ FW + +  FG   A+GW+ +         +  + + L+E   +     L     N    ++WL +E +R    WLP R +       +E +DP ER + F  I P +  + +PQ
Sbjct:  295 ILAKVEDYNKRIRECPNDIQLWMEFVSFQDELVKQPSMYSTSKGELDGHRTSVKLLLEKKLAILERAIESNPGSTELKLAKLKLCEEFWEAPTLLKEWQKLIFLHPNDSQLWQKYLLFCQGQFSTFSVSKMNSIYGKCLSTLAAVQDGIMLSHNALPDTESNMYDIFLQQCQFLRQAGHTEKVISLFQALTDFTFYKPDSVKDMTTKEQVD-----FFEPFWDSGEPRFGEKGAKGWSSWMRQQERGGWI--IINNLVEDDEDEADEELSIRGKNCPRYKIWLDVECSREARHWLPWRPDTTKKQTEDECEDP-ERQVLFDDIGPSMFKITSPQ 620          
BLAST of Protein NRDE2-like protein vs. Ensembl Xenopus
Match: nrde2 (NRDE-2, necessary for RNA interference, domain containing [Source:NCBI gene;Acc:780328])

HSP 1 Score: 134.035 bits (336), Expect = 4.268e-31
Identity = 85/333 (25.53%), Postives = 156/333 (46.85%), Query Frame = 2
Query:  611 IITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNNSAIT---------------DRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNH--PVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNN------NEPDDPMERGIPFQLIQPVLITLHNPQ 1540
            I+      N+ I + P++I  W+  ++ Q +   QP+  + +               ++KLAI+E+A+  N  + +L L +L +  E W+   L KEW ++IF H  D  LW+ Y+     Q   FSV K+ ++Y KC      +  G   + +  PDT   + D+F   C +L  +G++E+ I+ +QA+ ++ F+ P  ++   +   +D      F+ FW + +  FG   A+GW+ +           +N++     +      S +   N    ++WL +E +R    WLP R +       +E +DP ER + F  I P +  + +PQ
Sbjct:  295 ILAKVEDYNKRIRECPNDIQLWMEFVSFQDELVKQPSMYSTSKGELDGHRTSVKLLLEKKLAILERAIESNPGSTELKLAKLKLCEEFWEAPTLLKEWQKLIFLHPNDSQLWQKYLLFCQGQFSTFSVSKMNSIYGKCLSTLAAVQDGIMLSHNALPDTESNMYDIFLQQCQFLRQAGHTEKVISLFQALTDFTFYKPDSVKDMTTKEQVD-----FFEPFWDSGEPRFGEKGAKGWSSWMRQQERGGWIIINNLVEDDEDEADEELS-IRGKNCPRYKIWLDVECSREARHWLPWRPDTTKKQTEDECEDP-ERQVLFDDIGPSMFKITSPQ 620          
BLAST of Protein NRDE2-like protein vs. Ensembl Mouse
Match: Nrde2 (nrde-2 necessary for RNA interference, domain containing [Source:MGI Symbol;Acc:MGI:2670969])

HSP 1 Score: 127.102 bits (318), Expect = 4.640e-29
Identity = 93/380 (24.47%), Postives = 166/380 (43.68%), Query Frame = 2
Query:  554 PFDMEIKSNPTTQQQQGESIITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNNSAITDRK---------------LAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLIS-FQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEP------DDPMERGIPFQLIQPVLITLHNPQNISSSTPASIVSLNAKKKLILLFLNSLGV 1627
            P + E K   + Q ++  ++       N  + ++P +   W+  +  Q +    P   A+ + +               LA++E+A+  N  +++L L +L + +E W+P  L KEW +++F H  +  LW+ Y++    Q   FSV K+ +LY KC      +  G   +  + P T   +  LF   C +L  +G+SE+ I+ +QAM+++ FF P      DS   L   + +  F+ FW + +   G   ARGW  +         V     +  E     +  + +      ++WL +E++R +  W P R +  +       +DP ER + F  I   LI L +P              + + +LI  FL  LGV
Sbjct:  297 PAEQESKQPDSQQDRENAALKARVEEFNRRVRENPWDTQLWMAFVAFQDEVMRSPGIYALGEGEQEKHRKSLKLLLEKKLAVLERAIESNPGSVELKLAKLQLCSEFWEPSALAKEWQKLLFLHPNNTSLWQRYLSFCQSQFGTFSVSKLHSLYGKCLSTLSAVKDGSMLSHPVLPGTEEAMFGLFLQQCHFLRQAGHSEKVISLFQAMVDFTFFKP------DSVKELPTKVQVEFFEPFWDSGEPRVGEKGARGWRAWMHQQERGGWVLITPDEDDEEPEEEDQEIKDKTLPRWQIWLAVERSRDQRHWRPWRPDKTKKQTEEDCEDP-ERQVLFDDIGQSLIRLSSP--------------DLQFQLIQAFLQFLGV 655          
BLAST of Protein NRDE2-like protein vs. UniProt/SwissProt
Match: sp|Q9H7Z3|NRDE2_HUMAN (Nuclear exosome regulator NRDE2 OS=Homo sapiens OX=9606 GN=NRDE2 PE=1 SV=3)

HSP 1 Score: 129.413 bits (324), Expect = 6.572e-29
Identity = 87/346 (25.14%), Postives = 149/346 (43.06%), Query Frame = 2
Query:  554 PFDMEIKSNPTTQQQQGESIITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNNSAITD---------------RKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEP------DDPMERGIPFQLIQPVLITL 1528
            P + E K        +  ++       N  + ++P +   W+  +  Q +    P   AI +               +KLAI+E+A+  NQ+++ L L +L +  E W+P  L KEW ++IF H  +  LW+ Y+     Q   FS+ KI +LY KC      +  G   +    P T   +  LF   C +L  +G+SE+AI+ +QAM+++ FF P  ++      L     +  F+ FW + +   G   ARGW  +         V     +  +     +  + +      ++WL  E++R +  W P R +  +       +DP ER + F  I   LI L
Sbjct:  288 PPEQESKQPDAQPDSESAALKAKVEEFNRRVRENPRDTQLWMAFVAFQDEVMKSPGLYAIEEGEQEKRKRSLKLILEKKLAILERAIESNQSSVDLKLAKLKLCTEFWEPSTLVKEWQKLIFLHPNNTALWQKYLLFCQSQFSTFSISKIHSLYGKCLSTLSAVKDGSILSHPALPGTEEAMFALFLQQCHFLRQAGHSEKAISLFQAMVDFTFFKPDSVK-----DLPTKGQVEFFEPFWDSGEPRAGEKGARGWKAWMHQQERGGWVVINPDEDDDEPEEDDQEIKDKTLPRWQIWLAAERSRDQRHWRPWRPDKTKKQTEEDCEDP-ERQVLFDDIGQSLIRL 627          
BLAST of Protein NRDE2-like protein vs. UniProt/SwissProt
Match: sp|Q80XC6|NRDE2_MOUSE (Nuclear exosome regulator NRDE2 OS=Mus musculus OX=10090 GN=Nrde2 PE=1 SV=3)

HSP 1 Score: 127.102 bits (318), Expect = 3.245e-28
Identity = 93/380 (24.47%), Postives = 166/380 (43.68%), Query Frame = 2
Query:  554 PFDMEIKSNPTTQQQQGESIITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNNSAITDRK---------------LAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLIS-FQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEP------DDPMERGIPFQLIQPVLITLHNPQNISSSTPASIVSLNAKKKLILLFLNSLGV 1627
            P + E K   + Q ++  ++       N  + ++P +   W+  +  Q +    P   A+ + +               LA++E+A+  N  +++L L +L + +E W+P  L KEW +++F H  +  LW+ Y++    Q   FSV K+ +LY KC      +  G   +  + P T   +  LF   C +L  +G+SE+ I+ +QAM+++ FF P      DS   L   + +  F+ FW + +   G   ARGW  +         V     +  E     +  + +      ++WL +E++R +  W P R +  +       +DP ER + F  I   LI L +P              + + +LI  FL  LGV
Sbjct:  297 PAEQESKQPDSQQDRENAALKARVEEFNRRVRENPWDTQLWMAFVAFQDEVMRSPGIYALGEGEQEKHRKSLKLLLEKKLAVLERAIESNPGSVELKLAKLQLCSEFWEPSALAKEWQKLLFLHPNNTSLWQRYLSFCQSQFGTFSVSKLHSLYGKCLSTLSAVKDGSMLSHPVLPGTEEAMFGLFLQQCHFLRQAGHSEKVISLFQAMVDFTFFKP------DSVKELPTKVQVEFFEPFWDSGEPRVGEKGARGWRAWMHQQERGGWVLITPDEDDEEPEEEDQEIKDKTLPRWQIWLAVERSRDQRHWRPWRPDKTKKQTEEDCEDP-ERQVLFDDIGQSLIRLSSP--------------DLQFQLIQAFLQFLGV 655          
BLAST of Protein NRDE2-like protein vs. UniProt/SwissProt
Match: sp|O42975|NRDE2_SCHPO (Protein NRDE2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC20F10.05 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 3.671e-17
Identity = 72/285 (25.26%), Postives = 125/285 (43.86%), Query Frame = 2
Query:  533 HQSFIPIPFDMEIKSNPTTQQQQGESIITTTAVLNESISKDPHNIDAWLRLINHQSQ----SFDQPNNSAITDR----------KLAIVEKALS--KNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYE-------LCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVN 1318
             Q FIP+  +    S+P+ +     +I+      +E I K+P     W+++  +Q +     F + N+  I  +          KL+I+EKAL   K  ++  L    L +G+E W  ++  +++ +++  H   ++LW  Y       S  F+ +  +N+++KCF      +S R   K  E   V         +  L    CD+L   GY E A + +QA +E  +F P +L+ K     LD     SF +FW +    F   +ARGW     ++ S    N
Sbjct:  137 QQGFIPLLVNR--NSDPSEKSTFSLNILKAIKETDEEIKKNPGKARLWIKMCEYQERLLFDEFRRSNSDDIKGKLKIENNSRSVKLSILEKALKEVKGCDHEILVSYYLQLGSEEWSKEETNQKFEEVLIEHPGYLNLWMKYAEYFTGIS-EFTFNDCLNMFSKCFKFLKQKLSDRKSCKERESTDVTSNFEVEEAILHLLIRLCDFLKNCGYYELAWSIFQANMELCYFYPRYLEKK-----LDSTFFESFSKFWNSDTPKFSEENARGWCNVLDDESSQQNQN 413          
BLAST of Protein NRDE2-like protein vs. TrEMBL
Match: A0A0B7BD89 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF175914 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.516e-41
Identity = 111/354 (31.36%), Postives = 178/354 (50.28%), Query Frame = 2
Query:  632 LNESISKDPHNIDAWLRLINHQS------QSFD----------QPNNSAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWL---PDRSNNN--EPDDPMERGIPFQLIQPVLITLHNPQNISSSTPASIVSLNAKKKLILLFLNSLGVS 1630
             NE    +P N+  WL  +  Q       +SF           QP  S I ++KLAI++KA+  N ++++L + +L +  ++W+ DKL+K W  ++F HS ++DLW+ Y+ + +     FS  +++  Y  CF     I+ G+ K  + + D   ++ DLFA YC++L  SGY+ERA++S+QAMIE+N   PA L    S   L+      F+ FW +S   FG P A+GWA++     S H + D  S +  +    E A++  N      WLK+E  R    W+   PD SN    E  + ++R + F+ I   +  L       S + + I       KL+  FL  LG+S
Sbjct:  329 FNERTRDEPQNVQLWLDFVEFQDVVAQVDKSFKGQTIRLREVYQPTKSVI-EKKLAILDKAIEVNSSSLELKMTQLELYQDVWETDKLEKAWRDLLFTHSANVDLWQHYLTKQHSHLSKFSFSRVVKCYHHCFKTIVPILDGQVKVLNKKEDMEEKVLDLFAQYCNFLHQSGYTERAVSSYQAMIEFNLLCPASLNISTSRERLN-----HFEEFWDSSVPRFGEPKAKGWAKWF---ESRHSIMDT-SLISANTEEQEDAIVLENLTRSNTWLKMETVRQNVHWIPWRPDLSNGETLESCEDLDRVVLFEDISRAVFRL-------SKSESCI-------KLVCTFLKFLGLS 658          
BLAST of Protein NRDE2-like protein vs. TrEMBL
Match: A0A2C9KH07 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055413 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 2.824e-41
Identity = 115/376 (30.59%), Postives = 187/376 (49.73%), Query Frame = 2
Query:  575 SNPTTQQQQGESIITTTAVLNESISKDPHNIDAWLRLINHQS------QSFD----------QPNNSAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYE-LCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSN--HPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAF---WLPDRSNNNEPDD--PMERGIPFQLIQPVLITLHNPQNISSSTPASIVSLNAKKKLILLFLNSLGVS 1630
            S P  +  +   I       N+   + PHN+  WL  I  Q       +SF           +P+ S I ++KLAI+EKA+  N ++++L L RL +  ++W+ D+ +K W  ++F ++ DIDLWR Y++    + + F+  KI+ LY KCF     I+ G+ K  + +PD + + L  LF  YCD+L+ +GY+ERAI+S+QA+IE+N F P  L    +   ++      FQ FW++  + FG P A+GWA +  N  +   H    V +  LE    +E    +        WLK+E+ R EA    W P+ +     DD   ++R + F  I+P L  +   ++                +LI +FL  LG+S
Sbjct:  294 SKPCEENIEMSEIFEKVRSYNQKTRESPHNVQLWLEFIQFQDVVAQEDKSFQSHVVRLRDIYRPSKSVI-EKKLAILEKAIEFNPSSLELKLARLELYQDIWEADQCEKAWQDLLFTYAADIDLWRQYLSNQQSRLVKFTFGKILKLYHKCFQTVVPILEGQVKVVN-KPDNMEDKLLGLFCQYCDFLNHTGYTERAISSFQALIEFNLFCPISLNLTTTKQRVE-----IFQTFWESGVTRFGEPKAKGWANWFQNKQTGSIHIPQTVNTDELEDKVILEKLTRSLT------WLKMEKIRQEAHMLPWKPNTAQGETEDDCEDLDRMVLFDDIKPALFKMTRSESCL--------------RLICMFLKFLGLS 642          
BLAST of Protein NRDE2-like protein vs. TrEMBL
Match: A0A3S3S3M2 (Protein NRDE2-like protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_07835 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.497e-38
Identity = 102/363 (28.10%), Postives = 180/363 (49.59%), Query Frame = 2
Query:  584 TTQQ----QQGESIITTTAVLNESISKDPHNIDAWLRLINHQSQS-------FDQPNNSAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPM---LISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEPDDPMERGIPFQLIQPVLITLHNPQNISSSTPASIVSLNAKKKLILLFLNSLGVS 1630
            TTQ+     Q + I   T  +N+ +S +PH+ID W+  IN Q ++       + +     I ++KLA+V+KAL  N  +  L++ RL I   LW+P+K+  EW  + F +     +W+ YI  +      F+V  +I ++ KC   +  ++ G  ++     +   EL  +   +C++L   G+SERA+A+WQA+IE+N + P  L        L+ P+   L  F+ FW +    FG   ++GW++  A   S    N+V      ++ ++E +++       E W+ LE+ R   +WLP ++ + E  D ++R + F  I+P+L  L  P              +AK +L+L FL  L  +
Sbjct:  251 TTQKPQLLSQKQLIYNKTQEMNKYLSSNPHDIDKWIEFINFQDEAIESQELDYGKTMKVRILEKKLAVVDKALESNPKDTTLNIKRLEILKNLWEPEKISDEWKNLAFVYPNIPSIWQGYIRFLQTHISYFTVSSVIKVFIKCISTYSKMLEGFFQSHQPPNNLEEELLIITFMFCEHLEQCGFSERALATWQALIEFNLYTPQSLD-------LNKPLSEWLEFFELFWDSGVPRFGENGSKGWSKLNAQSIS-QLSNNV------NIDDLEDSIICKTLSRTETWILLEELRESHYWLPPKAADAEEVDDVDRNVFFDDIEPILFRLRTP--------------DAKYRLVLYFLKFLRAT 585          
BLAST of Protein NRDE2-like protein vs. TrEMBL
Match: K1RDX3 (PAZ domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10027910 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 6.877e-38
Identity = 141/530 (26.60%), Postives = 235/530 (44.34%), Query Frame = 2
Query:  446 RYYAKLKHLKNENSIAITKRGLCDSHCICHQSFIPIPFDMEIKSNPTTQQQQGESIITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNN--------SAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEPD-----DPMERGIPFQLIQPVLITLHNPQNISSSTPASIVSLNAKKKLILLFLNSLGVSWAQASLQDSLSIHRVRWQQLEQIWCTDKLLNRSRLPSKLFADNFIRCSIKQLRNRLPGQSDWNAILSQLELSYVVKSNLSAGTWKQALTAIKLNAKSIMA--VNSGNTFLWISYADLLISLA 1990
            R  AK    K EN + I +R + DS     +    +  D ++    T Q+     +   TA  N    ++PHN+D WL  +  Q      P +        +A+ ++K+AI++KA+  NQ NI L L  L +     + D++ KE   +IF++ T+I LW  Y+     +   FSV K+  LY KC         G+  T ++  +   +L D+F   C +L  +G+ ERA+A++QAMIE N   P  L+   S  L D  +++  + FW +    FG   ARGW+ F+ ++    P     S+        E  +L    E+ E WL +E  R    WLP + N  E +     + ++R + F  I   L  +  P+N++S             +L++ FLN LG    Q      +     + +Q+  I+  +       L  + F   FI  +I+Q    L  Q D++  L+ L L Y  ++  S    +      K  A++++    N  +   W+ Y+ LL SL 
Sbjct:  571 RAGAKSSGEKGEN-VDIRERLMDDSTSHYVKGVGVVTEDQDVCLTETEQR-----LNKKTAEFNRRTREEPHNVDLWLEFLEFQDTVLRYPESEGHFKITKAAVLEKKIAIIKKAMESNQGNITLKLKYLQLCRGAMEADEVNKEMENLIFHNPTNISLWNQYLLFNQSRLATFSVSKMCKLYQKCITTLVKYQEGKLTTHTLPQNLSNDLLDIFVRLCSFLKQAGHKERAVAAFQAMIELNMCCPERLK---SAELTDKTIIL--ESFWDSGLPRFGEEGARGWS-FSMDNKDLLPTESENSEKDSSAEEEEQLILQQEKEKWEAWLHIETLRESVHWLPWKPNLTEGETMDDCEDIDRLVLFDDISHFLFCV--PENMTS-------------RLLIEFLNFLGFDNCQGI---EMEQENGKLKQIFDIFGLEDFQRSHLLQERAFLYKFIGNTIQQ--GLLKFQGDFHTKLAILWLRYQAQNENSK---RVDCKKFKKTARNVLKDPTNRNSKATWLEYSRLLSSLG 1065          
BLAST of Protein NRDE2-like protein vs. TrEMBL
Match: A0A2T7NXY4 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_13708 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.469e-37
Identity = 119/405 (29.38%), Postives = 189/405 (46.67%), Query Frame = 2
Query:  584 TTQQQQGESII------TTTAVLNESISKDPHNIDAWLRLINHQSQSFD------------------QPNNSAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPA--HLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTAND--PSNHPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLP-----DRSNNNEPDDPMERGIPFQLIQPVLITLHNPQNISSSTPASIVSLNAKKKLILLFLNSLGVSWAQASLQDSLSIHRVRWQQLEQI 1699
            +++Q   ESII         +  N  +S+DP N+  W   +N Q   F                   QP    I ++KLAI++KAL+ N +++QL + +L +  ++   + L KEW +++F+HS D+ LWR Y+     +   FSV + + LY +CF     IM G  K   +  +   E+ +LF  YC +L   G++E+A+AS+QA+IE+N F PA  +LQP        D + I F+ FW +    FG P A GWA +  +       P   ++ +  +   N+    L  N    E W+KLEQ R  A WLP      R    E  + ++R + +  + P L  +       SS+  +IV+         L L  LGV+      +D     +V+   L QI
Sbjct:  301 SSEQSTSESIIFMDETFEKISFYNRRLSEDPKNVKLWTEFVNFQDLVFQNAKFSSQQIPSRSLRDVFQPPRICI-EKKLAILDKALAANPSSLQLKIAKLELEQDIVDSETLMKEWDELLFSHSGDVHLWRHYLIFQQSRLSAFSVGRTVKLYHRCFKTLRPIMEGSVKVVKMMENLEDEMIELFVQYCTFLHHCGFTEKAVASYQALIEFNLFRPASLNLQPT------TDCISI-FESFWDSGVPRFGEPGALGWAAWVEDSKLTDAAPAKVIQVKTDQEQENI----LAQNDSVYETWIKLEQLRESAHWLPWRPDVSRGETEEDCEDLDRLVLYDDVAPTLFRVQK-----SSSCFTIVA-------AFLQLLGLGVTIDGCHCKD---FDQVKLNALHQI 678          
BLAST of Protein NRDE2-like protein vs. Ensembl Cavefish
Match: nrde2 (NRDE-2, necessary for RNA interference, domain containing [Source:ZFIN;Acc:ZDB-GENE-111117-3])

HSP 1 Score: 113.235 bits (282), Expect = 6.154e-25
Identity = 87/357 (24.37%), Postives = 155/357 (43.42%), Query Frame = 2
Query:  563 MEIKSNPTTQQQQGES------IITTTAVLNESISKDPHNIDAWLRLINHQSQ-------------------SFDQPNNSAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLIS-FQRFWQNSKSIFGHPSARGW-AEFTANDPSNHPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEP------DDPMERGIPFQLIQPVLITLHN 1534
            +E +  P T++ +         +   T   N ++ ++P +I  WL  I  Q +                      +    A+ +RKLAIVE+AL  N  +++L L++L +  ELW P  L KEW +++F H     LWR ++         FS  ++   Y KC      +  G   +    P T  EL ++F   C +L  +G SE+A++ +QA++++ F+ P      D+ + L+    +  F+ FW + +   G    RGW A     +     V        +     E  + + +  +  +WL +E +R    WLP R + ++       +DP +R + F  I P LI + +
Sbjct:  193 LEGRGRPKTEEPRPGGADSAALLTARTEEFNRNLRQNPTHIQLWLDFIRFQDEVSGGCGAALGAVAGAEGDGERGRLTVRALLERKLAIVERALEVNPGSMELKLVKLALCQELWDPPALLKEWKKLVFLHPNSSTLWRRFLLFTQTHFSSFSTSRVSAAYAKCLSTLSAVQDGTMLSHPPLPGTEEELLEIFLLQCHFLRQAGQSEKALSLFQALLDFTFYKP------DTVTHLNTRQQVEFFEPFWDSGEPRVGERGGRGWRAWMLQQERGGWVVPPETEDDDDDEDQDECEIRDKSEPKWRIWLDVETSREAKHWLPWRPDKSKGQSEEDCEDP-DRQVLFDDIGPSLIRVES 542          
BLAST of Protein NRDE2-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003583.1 (pep scaffold:Pmarinus_7.0:GL480526:1:10798:-1 gene:ENSPMAG00000003270.1 transcript:ENSPMAT00000003583.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.887 bits (346), Expect = 9.773e-34
Identity = 87/341 (25.51%), Postives = 156/341 (45.75%), Query Frame = 2
Query:  632 LNESISKDPHNIDAWLRLINHQSQSFDQPNN-------------------------SAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTAN---------DPSNHPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEP------DDPMERGIPFQLIQPVLITLHN 1534
            LN ++ +DP ++ +WL L   Q +     ++                          A+ ++KL+++E+ +  N +++ L L RL +G +LW+  +L  EW ++ F H  D +LWR Y+     Q   F V ++   Y K       ++ G   +  + P+T   + D+F   C +L  +G++E+AI+ +QAM+++NF+ P  L    +  L++      F+ FW + +  FG P ARGW+ +            DP   PV D + +        E  L  S+      WL +E++R    WLP R +  +       +DP +R + +  + P L TL  
Sbjct:  337 LNRAVREDPGDVASWLALARLQDELARDASSLLLMIDGGGGSTGGGGTEKSRKVAERAVLEKKLSVLERGVESNPSSMALRLARLELGRDLWESGRLASEWKKLSFLHPNDPELWRQYLLFAQSQYATFGVSRVNATYGKSLATLAGVVDGTLVSHPLLPNTESAMLDIFLQQCHFLRQAGHTEKAISLFQAMMDFNFYRPDTLAEVTTRGLVE-----FFETFWDSGEPRFGEPGARGWSAWMRQKERGGWVTLDP---PVGDDDGE------TPEEELAASSVPRWRAWLSVERSRERRQWLPWRPDKGKGQTETDCEDP-DRQVLYDDVGPSLFTLRT 662          
BLAST of Protein NRDE2-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009933.1 (pep scaffold:Pmarinus_7.0:GL476672:219190:220483:1 gene:ENSPMAG00000008985.1 transcript:ENSPMAT00000009933.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 8.536e-7
Identity = 30/106 (28.30%), Postives = 51/106 (48.11%), Query Frame = 2
Query: 2873 SGRTDRVRSTFLRLINL----RCMHWSYRLVMWHSYMQLESEQNSPKRDENTKGVFYRAITELPSQKSLYLSIITLVPSMLEEATMLMKNNHVRMFTPVEEIKLLI 3178
            SG ++R+RS   R +++    RC       + W  Y+     Q +  R E   G+ YRA+   P  K LY+  +   P  ++E T +M    +R+  P EE+ +L+
Sbjct:   15 SGLSNRLRSLLERALSVPSVARCP------LAWRLYLHFLRVQGTTSRSE---GILYRAVQACPWAKVLYMDAVRSFPERVQELTDMMTEKELRLRAPPEEVDILM 111          
BLAST of Protein NRDE2-like protein vs. Ensembl Nematostella
Match: EDO42981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZP5])

HSP 1 Score: 137.117 bits (344), Expect = 1.261e-32
Identity = 107/416 (25.72%), Postives = 182/416 (43.75%), Query Frame = 2
Query:  446 RYYA-KLKHLKNENSIAITKRGLCDSHCICHQSFIPIPFDMEIKSNPTTQQQ--------QG----ESIITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQP----------------NNSAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDV---------------ESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNN------NEPDDPMERGIPFQLIQPVLITLHNPQN 1543
            RY+  ++  L    S+A  KR   +      Q+++ +P D+    N    +Q        +G    E     T+ LN+ + ++PH+I AWL L++HQ +   +                 N + IT+++++++EKAL +N ++  L    L + +E+W  + L++ W +++F H   ++LW  Y+     +   FS  K    Y KC      +  G  ++   + D   ++ D+F  +C +L  SG+ E+A+AS QAMIE N F P ++      S      L   + FW + K  FG   A+GW  +    P  H  +D                       VS+ E  L+   Y + E W  +E +R      P R N        + +DP ER + F+ +   L  L NPQN
Sbjct:  328 RYWGVQIPPLSEVQSVAPQKRATTEFFSGNIQNYVYVPLDLPSGGNEANNRQVNAENLNDEGGTMEEYTSHYTSELNKKLRENPHDIAAWLELVDHQQEVVSKGQLRAGFTEALNEKKKRNQAVITEKQISVLEKALEQNPSSEILIHKHLELCSEIWSVEDLRQRWNKVVFTHPNKVNLWHEYLRFTQSRFSSFSFSKAQGAYAKCLSTLLALKEGTFQSHQAQGDIESDMLDVFHQFCLFLKQSGHMEKAVASLQAMIELNCFCPGNIVSNTPTS----GHLAFLETFWDSGKPRFGEDGAQGWKVWMEKSP--HRADDCFDLKKIFKYSDRNKRNDAGEGEVSDGEERLIQGLY-KAEAWRSIEISRDHTQVKPWRPNTLAGETEEDCEDP-ERLVLFEDVSACLFKLQNPQN 735          

HSP 2 Score: 51.2174 bits (121), Expect = 2.363e-6
Identity = 30/108 (27.78%), Postives = 55/108 (50.93%), Query Frame = 2
Query: 2870 FSGRTDRVRSTFLRL----INLRCMHWSYRLVMWHSYMQLESEQNSPKRDENTKGVFYRAITELPSQKSLYLSIITLVPSMLEEATMLMKNNHVRMFTPVEEIKLLIR 3181
             +G T R R+ F R+    +  +C      +++W  ++  E +Q S  +    K VFY+A+   P  KSLYL  +   P  + +   +M    +R+  P+EEI++L++
Sbjct: 1155 MTGVTHRQRALFERVASSSVGRQC------VLLWRMFVDFEMKQGSTDK---AKTVFYQAVHHCPWAKSLYLDAVKYFPEDVTDILDMMHEKGLRVRAPLEEIEILLQ 1253          
BLAST of Protein NRDE2-like protein vs. Ensembl Medaka
Match: nrde2 (NRDE-2, necessary for RNA interference, domain containing [Source:NCBI gene;Acc:101159398])

HSP 1 Score: 140.969 bits (354), Expect = 1.600e-33
Identity = 99/338 (29.29%), Postives = 156/338 (46.15%), Query Frame = 2
Query:  584 TTQQQQGESIITTTAVLNESISKDPHNIDAWLRLINHQSQ--------SFDQPNNSAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLIS-FQRFWQNSKSIFGHPSARGWAEFTANDPSNH----PVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNN------NEPDDPMERGIPFQLIQPVLITLHNPQ 1540
            T  ++    +   T   N  + + P +   WL+ I +Q +           + +  A+ ++KL+I E+A++ N   I L L RL I  ELW+P  L KEW +++F H     LWR Y+  I      F+V K+ + Y KC      ++ G   + S  P T  ++ DLF   C +L  +G+SE+AI+ +QAM+++ FF P      DS   L     +  F+ FW + ++  G   ARGW  +            P  D E +  E V N   A       + ++WL +E  R  A WLP R +        + DDP +R + F  I   LI L +P+
Sbjct:  223 TQVEESAAHVAGKTEEFNRHLREHPSDTQQWLQFIQYQVRLQGSESSECKSKSSYKAVLEKKLSIAERAVAINPTCISLQLERLRICQELWEPSVLAKEWKKLVFLHPNSAPLWRRYLLFIQSYFSNFTVSKVNSAYGKCLSTLSAVLDGSMVSHSALPGTEEDMLDLFIQQCQFLRQAGHSEKAISLFQAMMDFTFFKP------DSVKKLSTRQQVEFFEPFWDSGEARVGEVEARGWKAWMLQQERGGWLPPPTEDKEEEDEEEVKNRSQA-------KWKVWLDVESLREAAHWLPWRPDKAKGQTEEDCDDP-DRQVLFDDIGSSLICLSSPE 546          
BLAST of Protein NRDE2-like protein vs. Ensembl Medaka
Match: nrde2 (NRDE-2, necessary for RNA interference, domain containing [Source:NCBI gene;Acc:101159398])

HSP 1 Score: 140.584 bits (353), Expect = 1.888e-33
Identity = 100/342 (29.24%), Postives = 155/342 (45.32%), Query Frame = 2
Query:  584 TTQQQQGESIITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNN------------SAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLIS-FQRFWQNSKSIFGHPSARGWAEFTANDPSNH----PVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNN------NEPDDPMERGIPFQLIQPVLITLHNPQ 1540
            T  ++    +   T   N  + + P +   WL+ I +Q     +P               A+ ++KL+I E+A++ N   I L L RL I  ELW+P  L KEW +++F H     LWR Y+  I      F+V K+ + Y KC      ++ G   + S  P T  ++ DLF   C +L  +G+SE+AI+ +QAM+++ FF P      DS   L     +  F+ FW + ++  G   ARGW  +            P  D E +  E V N   A       + ++WL +E  R  A WLP R +        + DDP +R + F  I   LI L +P+
Sbjct:  133 TQVEESAAHVAGKTEEFNRHLREHPSDTQQWLQFIQYQVNK-TKPKTCESSECKSKSSYKAVLEKKLSIAERAVAINPTCISLQLERLRICQELWEPSVLAKEWKKLVFLHPNSAPLWRRYLLFIQSYFSNFTVSKVNSAYGKCLSTLSAVLDGSMVSHSALPGTEEDMLDLFIQQCQFLRQAGHSEKAISLFQAMMDFTFFKP------DSVKKLSTRQQVEFFEPFWDSGEARVGEVEARGWKAWMLQQERGGWLPPPTEDKEEEDEEEVKNRSQA-------KWKVWLDVESLREAAHWLPWRPDKAKGQTEEDCDDP-DRQVLFDDIGSSLICLSSPE 459          
BLAST of Protein NRDE2-like protein vs. Planmine SMEST
Match: SMESG000021171.1 (SMESG000021171.1)

HSP 1 Score: 2102.02 bits (5445), Expect = 0.000e+0
Identity = 1052/1057 (99.53%), Postives = 1054/1057 (99.72%), Query Frame = 2
Query:   41 MMNKNWLLNSTYKSSEEYYAEDEEIPANEFMQSDSNDSSDADYLXXXXXXXXXXXXXSQIRKYFLNELPSITDDSSKFRNYNFLENMPKEDRSSNAFIDLKGNSQISRFGCIYEKHVSKYRXXXXXXXXXXXXXXRYYAKLKHLKNENSIAITKRGLCDSHCICHQSFIPIPFDMEIKSNPTTQQQQGESIITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNNSAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEPDDPMERGIPFQLIQPVLITLHNPQNISSSTPASIVSLNAKKKLILLFLNSLGVSWAQASLQDSLSIHRVRWQQLEQIWCTDKLLNRSRLPSKLFADNFIRCSIKQLRNRLPGQSDWNAILSQLELSYVVKSNLSAGTWKQALTAIKLNAKSIMAVNSGNTFLWISYADLLISLATHDLFSKSEKARLTLISEVSKIVEPLVQQVKSMSLPLSQKLHVFMLSLDLIGKKCSSEFNQSILATIVDTLYPAAFIFSALHSLPPPVDKSPNSLDGTFSEVISIISGSCDSLIQHWNQAVYFQIVSRLISLNSEKFREWIIDDCLLTICSIGSSCIWSQEYLYQLSQFLEYSLSFIGWFYRSQGRNDGSFLRSILTPIIHKLIQIQSNIKKPILEAVISPKLVQSSISNSEISEGQRFKLRNFLWSLLGSFETETFTKFNINCQASSVLLLSLEINRLNKLICDNTCQNLEAFSGRTDRVRSTFLRLINLRCMHWSYRLVMWHSYMQLESEQNSPKRDENTKGVFYRAITELPSQKSLYLSIITLVPSMLEEATMLMKNNHVRMFTPVEEIKLLIRIRQSKASTAT 3211
            MMNKNWLLNSTYKSSEEYYAE+EEIPANEFMQSDSNDSSDADYLKTRKKYRRKKIKTSQIRKYFLNELPSITDDSSKFRNYNFLENMPKEDRSSNAFIDLKGNSQISRFGCIYEKHVSKYRSSLNSKSLKEKLSERYYAKLKHLKNENSIAITKRGLCDSHCICHQSFIPIPFDMEIKSNPTTQQQQGESIITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNNSAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVES LLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEPDDPMERGIPFQLIQPVLITLHNPQNISSSTPASIVSLNAKKKLILLFLNSLGVSWAQASLQDSLSIHRVRWQQLEQIWCTDKLLNRSRLPSKLFADNFIRCSIKQLRNRLPGQSDWNAILSQLELSYVVKSNLSAGTWKQALTAIKLNAKSIMAV+SGNTFLWISYADLLISLATHDLFSKSEKARLTLISEVSKIVEPLVQQVKSMSLPLSQKLHVFMLSLDLIGKKC SEFNQSILATIVDTLYPAAFIFSALHSLPPPVDKSPNSLDGTFSEVISIISGSCDSLIQHWNQAVYFQIVSRLISLNSEKFREWIIDDCLLTICSIGSSCIWSQEYLYQLSQFLEYSLSFIGWFYRSQGRNDGSFLRSILTPIIHKLIQIQSNIKKPILEAVISPKLVQSSISNSEISEGQRFKLRNFLW LLGSFETETFTKFNINCQASSVLLLSLEINRLNKLICDNTCQNLEAFSGRTDRVRSTFLRLINLRCMHWSYRLVMWHSYMQLESEQNSPKRDENTKGVFYRAITELPSQKSLYLSIITLVPSMLEEATMLMKNNHVRMFTPVEEIKLLIRIRQSKASTAT
Sbjct:    1 MMNKNWLLNSTYKSSEEYYAENEEIPANEFMQSDSNDSSDADYLKTRKKYRRKKIKTSQIRKYFLNELPSITDDSSKFRNYNFLENMPKEDRSSNAFIDLKGNSQISRFGCIYEKHVSKYRSSLNSKSLKEKLSERYYAKLKHLKNENSIAITKRGLCDSHCICHQSFIPIPFDMEIKSNPTTQQQQGESIITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNNSAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESELLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEPDDPMERGIPFQLIQPVLITLHNPQNISSSTPASIVSLNAKKKLILLFLNSLGVSWAQASLQDSLSIHRVRWQQLEQIWCTDKLLNRSRLPSKLFADNFIRCSIKQLRNRLPGQSDWNAILSQLELSYVVKSNLSAGTWKQALTAIKLNAKSIMAVDSGNTFLWISYADLLISLATHDLFSKSEKARLTLISEVSKIVEPLVQQVKSMSLPLSQKLHVFMLSLDLIGKKCGSEFNQSILATIVDTLYPAAFIFSALHSLPPPVDKSPNSLDGTFSEVISIISGSCDSLIQHWNQAVYFQIVSRLISLNSEKFREWIIDDCLLTICSIGSSCIWSQEYLYQLSQFLEYSLSFIGWFYRSQGRNDGSFLRSILTPIIHKLIQIQSNIKKPILEAVISPKLVQSSISNSEISEGQRFKLRNFLWGLLGSFETETFTKFNINCQASSVLLLSLEINRLNKLICDNTCQNLEAFSGRTDRVRSTFLRLINLRCMHWSYRLVMWHSYMQLESEQNSPKRDENTKGVFYRAITELPSQKSLYLSIITLVPSMLEEATMLMKNNHVRMFTPVEEIKLLIRIRQSKASTAT 1057          
BLAST of Protein NRDE2-like protein vs. Planmine SMEST
Match: SMESG000021171.1 (SMESG000021171.1)

HSP 1 Score: 2100.09 bits (5440), Expect = 0.000e+0
Identity = 1051/1056 (99.53%), Postives = 1053/1056 (99.72%), Query Frame = 2
Query:   44 MNKNWLLNSTYKSSEEYYAEDEEIPANEFMQSDSNDSSDADYLXXXXXXXXXXXXXSQIRKYFLNELPSITDDSSKFRNYNFLENMPKEDRSSNAFIDLKGNSQISRFGCIYEKHVSKYRXXXXXXXXXXXXXXRYYAKLKHLKNENSIAITKRGLCDSHCICHQSFIPIPFDMEIKSNPTTQQQQGESIITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNNSAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESALLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEPDDPMERGIPFQLIQPVLITLHNPQNISSSTPASIVSLNAKKKLILLFLNSLGVSWAQASLQDSLSIHRVRWQQLEQIWCTDKLLNRSRLPSKLFADNFIRCSIKQLRNRLPGQSDWNAILSQLELSYVVKSNLSAGTWKQALTAIKLNAKSIMAVNSGNTFLWISYADLLISLATHDLFSKSEKARLTLISEVSKIVEPLVQQVKSMSLPLSQKLHVFMLSLDLIGKKCSSEFNQSILATIVDTLYPAAFIFSALHSLPPPVDKSPNSLDGTFSEVISIISGSCDSLIQHWNQAVYFQIVSRLISLNSEKFREWIIDDCLLTICSIGSSCIWSQEYLYQLSQFLEYSLSFIGWFYRSQGRNDGSFLRSILTPIIHKLIQIQSNIKKPILEAVISPKLVQSSISNSEISEGQRFKLRNFLWSLLGSFETETFTKFNINCQASSVLLLSLEINRLNKLICDNTCQNLEAFSGRTDRVRSTFLRLINLRCMHWSYRLVMWHSYMQLESEQNSPKRDENTKGVFYRAITELPSQKSLYLSIITLVPSMLEEATMLMKNNHVRMFTPVEEIKLLIRIRQSKASTAT 3211
            MNKNWLLNSTYKSSEEYYAE+EEIPANEFMQSDSNDSSDADYLKTRKKYRRKKIKTSQIRKYFLNELPSITDDSSKFRNYNFLENMPKEDRSSNAFIDLKGNSQISRFGCIYEKHVSKYRSSLNSKSLKEKLSERYYAKLKHLKNENSIAITKRGLCDSHCICHQSFIPIPFDMEIKSNPTTQQQQGESIITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNNSAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVES LLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEPDDPMERGIPFQLIQPVLITLHNPQNISSSTPASIVSLNAKKKLILLFLNSLGVSWAQASLQDSLSIHRVRWQQLEQIWCTDKLLNRSRLPSKLFADNFIRCSIKQLRNRLPGQSDWNAILSQLELSYVVKSNLSAGTWKQALTAIKLNAKSIMAV+SGNTFLWISYADLLISLATHDLFSKSEKARLTLISEVSKIVEPLVQQVKSMSLPLSQKLHVFMLSLDLIGKKC SEFNQSILATIVDTLYPAAFIFSALHSLPPPVDKSPNSLDGTFSEVISIISGSCDSLIQHWNQAVYFQIVSRLISLNSEKFREWIIDDCLLTICSIGSSCIWSQEYLYQLSQFLEYSLSFIGWFYRSQGRNDGSFLRSILTPIIHKLIQIQSNIKKPILEAVISPKLVQSSISNSEISEGQRFKLRNFLW LLGSFETETFTKFNINCQASSVLLLSLEINRLNKLICDNTCQNLEAFSGRTDRVRSTFLRLINLRCMHWSYRLVMWHSYMQLESEQNSPKRDENTKGVFYRAITELPSQKSLYLSIITLVPSMLEEATMLMKNNHVRMFTPVEEIKLLIRIRQSKASTAT
Sbjct:    1 MNKNWLLNSTYKSSEEYYAENEEIPANEFMQSDSNDSSDADYLKTRKKYRRKKIKTSQIRKYFLNELPSITDDSSKFRNYNFLENMPKEDRSSNAFIDLKGNSQISRFGCIYEKHVSKYRSSLNSKSLKEKLSERYYAKLKHLKNENSIAITKRGLCDSHCICHQSFIPIPFDMEIKSNPTTQQQQGESIITTTAVLNESISKDPHNIDAWLRLINHQSQSFDQPNNSAITDRKLAIVEKALSKNQNNIQLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIGFSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLSLSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNSKSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESELLNSNYEEVEMWLKLEQARHEAFWLPDRSNNNEPDDPMERGIPFQLIQPVLITLHNPQNISSSTPASIVSLNAKKKLILLFLNSLGVSWAQASLQDSLSIHRVRWQQLEQIWCTDKLLNRSRLPSKLFADNFIRCSIKQLRNRLPGQSDWNAILSQLELSYVVKSNLSAGTWKQALTAIKLNAKSIMAVDSGNTFLWISYADLLISLATHDLFSKSEKARLTLISEVSKIVEPLVQQVKSMSLPLSQKLHVFMLSLDLIGKKCGSEFNQSILATIVDTLYPAAFIFSALHSLPPPVDKSPNSLDGTFSEVISIISGSCDSLIQHWNQAVYFQIVSRLISLNSEKFREWIIDDCLLTICSIGSSCIWSQEYLYQLSQFLEYSLSFIGWFYRSQGRNDGSFLRSILTPIIHKLIQIQSNIKKPILEAVISPKLVQSSISNSEISEGQRFKLRNFLWGLLGSFETETFTKFNINCQASSVLLLSLEINRLNKLICDNTCQNLEAFSGRTDRVRSTFLRLINLRCMHWSYRLVMWHSYMQLESEQNSPKRDENTKGVFYRAITELPSQKSLYLSIITLVPSMLEEATMLMKNNHVRMFTPVEEIKLLIRIRQSKASTAT 1056          
The following BLAST results are available for this feature:
BLAST of Protein NRDE2-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NRDE21.368e-2925.14NRDE-2, necessary for RNA interference, domain con... [more]
NRDE28.824e-1124.29NRDE-2, necessary for RNA interference, domain con... [more]
back to top
BLAST of Protein NRDE2-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein NRDE2-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein NRDE2-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nrde28.497e-3125.07NRDE-2, necessary for RNA interference, domain con... [more]
nrde28.497e-3125.07NRDE-2, necessary for RNA interference, domain con... [more]
back to top
BLAST of Protein NRDE2-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nrde25.895e-3426.57NRDE-2, necessary for RNA interference, domain con... [more]
nrde23.465e-3125.53NRDE-2, necessary for RNA interference, domain con... [more]
nrde23.592e-3125.75NRDE-2, necessary for RNA interference, domain con... [more]
nrde24.268e-3125.53NRDE-2, necessary for RNA interference, domain con... [more]
back to top
BLAST of Protein NRDE2-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nrde24.640e-2924.47nrde-2 necessary for RNA interference, domain cont... [more]
back to top
BLAST of Protein NRDE2-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9H7Z3|NRDE2_HUMAN6.572e-2925.14Nuclear exosome regulator NRDE2 OS=Homo sapiens OX... [more]
sp|Q80XC6|NRDE2_MOUSE3.245e-2824.47Nuclear exosome regulator NRDE2 OS=Mus musculus OX... [more]
sp|O42975|NRDE2_SCHPO3.671e-1725.26Protein NRDE2 homolog OS=Schizosaccharomyces pombe... [more]
back to top
BLAST of Protein NRDE2-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7BD891.516e-4131.36Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A2C9KH072.824e-4130.59Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A3S3S3M21.497e-3828.10Protein NRDE2-like protein OS=Dinothrombium tincto... [more]
K1RDX36.877e-3826.60PAZ domain-containing protein OS=Crassostrea gigas... [more]
A0A2T7NXY41.469e-3729.38Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Protein NRDE2-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nrde26.154e-2524.37NRDE-2, necessary for RNA interference, domain con... [more]
back to top
BLAST of Protein NRDE2-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003583.19.773e-3425.51pep scaffold:Pmarinus_7.0:GL480526:1:10798:-1 gene... [more]
ENSPMAT00000009933.18.536e-728.30pep scaffold:Pmarinus_7.0:GL476672:219190:220483:1... [more]
back to top
BLAST of Protein NRDE2-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein NRDE2-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO429811.261e-3225.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein NRDE2-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nrde21.600e-3329.29NRDE-2, necessary for RNA interference, domain con... [more]
nrde21.888e-3329.24NRDE-2, necessary for RNA interference, domain con... [more]
back to top
BLAST of Protein NRDE2-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000021171.10.000e+099.53SMESG000021171.1[more]
SMESG000021171.10.000e+099.53SMESG000021171.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007098 ID=SMED30007098|Name=Protein NRDE2-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3216bp
ATTGGCGCCAAAGGTTTGAAGAAAGTTTTCTTAATATTGAATGATGAATA
AAAATTGGCTACTCAATTCCACATATAAATCTTCTGAAGAATATTATGCT
GAAGATGAAGAAATTCCTGCAAATGAATTCATGCAATCAGATTCTAACGA
TAGTTCAGATGCGGATTATTTGAAAACAAGAAAGAAATACCGTCGAAAGA
AGATTAAAACAAGCCAGATTAGAAAATATTTTTTGAATGAATTACCATCG
ATCACTGATGATTCTTCCAAATTTCGCAATTATAATTTTCTCGAAAATAT
GCCCAAAGAAGATAGATCAAGCAATGCATTCATTGACCTTAAAGGAAATT
CTCAAATTAGTCGTTTTGGTTGTATTTATGAGAAACATGTTTCTAAGTAT
CGCTCAAGTTTGAATAGTAAAAGCTTGAAAGAAAAATTATCCGAACGATA
TTACGCAAAATTGAAGCATTTAAAAAATGAAAATTCAATAGCTATTACAA
AAAGAGGACTTTGTGATTCGCATTGTATTTGTCACCAGTCATTTATTCCA
ATACCATTCGACATGGAAATAAAATCCAATCCAACAACACAACAGCAACA
GGGCGAATCCATAATTACCACAACAGCCGTTCTCAATGAAAGCATCAGTA
AAGATCCCCACAATATCGATGCTTGGCTCCGGTTGATTAACCATCAATCT
CAATCATTTGACCAACCCAACAATAGCGCAATCACTGACCGCAAATTAGC
AATTGTAGAGAAAGCTCTCAGCAAAAACCAAAACAATATCCAACTGCATT
TATTGCGGTTAATAATTGGGGCAGAATTGTGGCAACCAGACAAGCTGCAA
AAAGAATGGGCACAGATGATATTCAACCACAGCACTGATATCGATCTCTG
GCGCTTCTACATCGCCCAAATCAATCGACAGTCAATTGGATTTTCCGTGG
ACAAGATCATTAATCTCTATACGAAATGCTTCGGTATCTTTTTTAACATT
ATGTCAGGAAGAACAAAAACGAAATCGATTGAACCGGATACTGTTTATGA
GCTTTGCGACCTTTTCGCTGACTATTGTGATTATTTGTCATTATCTGGAT
ATAGCGAACGTGCTATAGCTTCGTGGCAAGCAATGATCGAATACAACTTT
TTTGCTCCTGCTCATTTGCAACCGAAAGATTCTGGAAGTCTCCTCGATGA
TCCAATGTTGATTTCTTTTCAACGGTTTTGGCAAAACTCCAAATCGATAT
TTGGCCACCCGTCGGCGAGAGGCTGGGCGGAATTTACGGCCAACGATCCT
TCCAATCACCCAGTAAATGATGTCGAATCGCAACTACTGGAACACGTGTC
AAATGTCGAATCAGCACTTCTGAATAGCAACTACGAAGAAGTTGAGATGT
GGTTGAAACTCGAGCAGGCGCGCCACGAGGCCTTCTGGTTGCCGGACAGA
TCCAATAACAACGAGCCAGACGACCCAATGGAACGAGGCATTCCTTTCCA
ACTGATCCAACCGGTTCTCATAACTCTCCACAATCCACAGAACATTTCCA
GTTCAACCCCGGCTTCAATCGTATCGCTAAACGCCAAAAAGAAGCTGATA
CTGCTTTTCCTGAATTCATTGGGGGTCTCCTGGGCACAGGCGTCACTCCA
GGACAGCTTGAGCATCCACAGAGTCCGATGGCAGCAATTGGAGCAGATTT
GGTGTACTGATAAACTGCTCAACAGATCTCGACTGCCCAGCAAGCTGTTT
GCCGACAATTTCATCCGCTGCTCCATCAAACAGTTACGGAACCGGTTGCC
AGGCCAATCAGATTGGAATGCAATCCTGTCGCAGCTGGAACTGTCATACG
TGGTCAAATCAAATCTCTCAGCCGGAACATGGAAGCAAGCACTGACAGCA
ATCAAACTCAACGCCAAATCGATTATGGCAGTCAACAGCGGCAACACGTT
TCTATGGATATCCTATGCAGATCTTTTGATCTCATTGGCTACTCATGATT
TATTCTCGAAATCCGAGAAAGCTCGATTGACATTGATCAGTGAAGTGTCG
AAGATTGTTGAACCGCTGGTGCAGCAAGTTAAATCGATGTCGCTCCCACT
CAGTCAGAAATTGCATGTTTTTATGCTGTCTCTCGATCTCATCGGCAAGA
AATGCAGCTCAGAATTCAATCAATCGATATTGGCCACCATAGTTGACACC
CTCTACCCAGCAGCATTCATCTTTTCTGCGCTTCACTCGTTGCCACCACC
AGTCGATAAATCTCCCAATAGCTTAGACGGAACATTTTCAGAAGTCATTT
CTATCATCAGTGGTTCCTGTGACTCTCTTATCCAACACTGGAATCAAGCT
GTCTATTTCCAAATTGTTTCTCGGCTTATCTCATTGAATTCTGAAAAATT
TCGGGAATGGATTATAGATGACTGCCTTTTGACAATTTGCAGTATTGGTT
CCTCCTGCATCTGGTCACAAGAGTATCTTTATCAGTTATCACAATTCTTA
GAATATAGCTTAAGTTTTATTGGCTGGTTTTATCGCTCTCAAGGTCGAAA
TGATGGATCCTTCTTGCGATCTATTCTTACTCCAATCATTCACAAACTAA
TACAAATTCAATCGAATATAAAAAAGCCCATCCTTGAGGCGGTAATTTCT
CCCAAATTAGTTCAAAGTTCTATTAGTAATAGTGAAATTTCCGAAGGTCA
ACGTTTTAAATTAAGAAACTTTTTATGGAGTCTCTTAGGCTCATTTGAAA
CAGAAACATTTACGAAATTCAATATCAATTGTCAGGCTTCTTCTGTTCTT
CTTTTGAGCTTAGAAATAAACCGACTGAATAAATTGATATGTGATAATAC
CTGCCAGAATCTCGAGGCATTTAGTGGTCGCACTGATCGCGTACGATCTA
CCTTCTTACGTTTAATCAATTTACGTTGCATGCACTGGAGCTATCGCCTT
GTTATGTGGCATTCTTACATGCAGCTTGAATCTGAACAAAACTCCCCAAA
AAGAGATGAAAACACAAAAGGTGTATTCTACAGAGCTATAACAGAACTAC
CGTCACAAAAAAGCCTGTATTTGTCTATAATAACATTGGTACCGAGCATG
TTGGAGGAAGCAACGATGCTAATGAAAAATAATCATGTGAGAATGTTCAC
ACCAGTAGAGGAGATCAAATTATTAATAAGAATCAGACAGTCGAAGGCAT
CGACAGCCACTTGAGG
back to top

protein sequence of SMED30007098-orf-1

>SMED30007098-orf-1 ID=SMED30007098-orf-1|Name=SMED30007098-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1058bp
MMNKNWLLNSTYKSSEEYYAEDEEIPANEFMQSDSNDSSDADYLKTRKKY
RRKKIKTSQIRKYFLNELPSITDDSSKFRNYNFLENMPKEDRSSNAFIDL
KGNSQISRFGCIYEKHVSKYRSSLNSKSLKEKLSERYYAKLKHLKNENSI
AITKRGLCDSHCICHQSFIPIPFDMEIKSNPTTQQQQGESIITTTAVLNE
SISKDPHNIDAWLRLINHQSQSFDQPNNSAITDRKLAIVEKALSKNQNNI
QLHLLRLIIGAELWQPDKLQKEWAQMIFNHSTDIDLWRFYIAQINRQSIG
FSVDKIINLYTKCFGIFFNIMSGRTKTKSIEPDTVYELCDLFADYCDYLS
LSGYSERAIASWQAMIEYNFFAPAHLQPKDSGSLLDDPMLISFQRFWQNS
KSIFGHPSARGWAEFTANDPSNHPVNDVESQLLEHVSNVESALLNSNYEE
VEMWLKLEQARHEAFWLPDRSNNNEPDDPMERGIPFQLIQPVLITLHNPQ
NISSSTPASIVSLNAKKKLILLFLNSLGVSWAQASLQDSLSIHRVRWQQL
EQIWCTDKLLNRSRLPSKLFADNFIRCSIKQLRNRLPGQSDWNAILSQLE
LSYVVKSNLSAGTWKQALTAIKLNAKSIMAVNSGNTFLWISYADLLISLA
THDLFSKSEKARLTLISEVSKIVEPLVQQVKSMSLPLSQKLHVFMLSLDL
IGKKCSSEFNQSILATIVDTLYPAAFIFSALHSLPPPVDKSPNSLDGTFS
EVISIISGSCDSLIQHWNQAVYFQIVSRLISLNSEKFREWIIDDCLLTIC
SIGSSCIWSQEYLYQLSQFLEYSLSFIGWFYRSQGRNDGSFLRSILTPII
HKLIQIQSNIKKPILEAVISPKLVQSSISNSEISEGQRFKLRNFLWSLLG
SFETETFTKFNINCQASSVLLLSLEINRLNKLICDNTCQNLEAFSGRTDR
VRSTFLRLINLRCMHWSYRLVMWHSYMQLESEQNSPKRDENTKGVFYRAI
TELPSQKSLYLSIITLVPSMLEEATMLMKNNHVRMFTPVEEIKLLIRIRQ
SKASTAT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR011990TPR-like_helical_dom_sf
IPR013633NRDE-2
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013633siRNA-mediated silencing protein NRDE-2PFAMPF08424NRDE-2coord: 195..529
e-value: 4.8E-67
score: 226.4
IPR013633siRNA-mediated silencing protein NRDE-2PANTHERPTHR13471TETRATRICOPEPTIDE-LIKE HELICALcoord: 32..649
coord: 918..1044
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 200..462