Si:dkey-32e6.3

Overview
NameSi:dkey-32e6.3
Smed IDSMED30007085
Length (bp)1269
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Si:dkey-32e6.3 (SMED30007085) t-SNE clustered cells

Violin plots show distribution of expression levels for Si:dkey-32e6.3 (SMED30007085) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Si:dkey-32e6.3 (SMED30007085) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Si:dkey-32e6.3 (SMED30007085) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007085

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30007085h1SMcG0009619 dd_Smed_v4_4351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30007085h1SMcG0009619 dd_Smed_v4_4351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007085h1SMcG0009619 dd_Smed_v4_4351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007085h1SMcG0009619 dd_Smed_v4_4351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007085h1SMcG0009619 dd_Smed_v4_4351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007085h1SMcG0009619 dd_Smed_v4_4351_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Si:dkey-32e6.3 vs. Ensembl Zebrafish
Match: si:dkey-32e6.3 (si:dkey-32e6.3 [Source:ZFIN;Acc:ZDB-GENE-081104-408])

HSP 1 Score: 170.244 bits (430), Expect = 1.617e-48
Identity = 107/361 (29.64%), Postives = 172/361 (47.65%), Query Frame = 3
Query:  120 SNKLILHFDARNTLFVSDFNSRFTTEKALNTYISGLAWGSIVEDQWQMSHQEISTDRPDSSLISFYKYMENIMVRTPEDRPKLREKLGKFTQENGIAFQEIYFEHLEKLEWNYEYQPD--LTVKGNCDKLYHYILPTFFQTISHLYKNKRDFAIIIRTFGLDIPPILRAIK-AFINGKHPMFP----TEMNINLCDWQNELVMDTNNKEYIYKFKSCNDHEIETTSD-EEEIVSHWNSISGIAAVKDDFQYWCNHNFHYTASKPLWINHKFEASDNICHHIFFDDCIRPRDTDSIVHLRYLKTSRADPSIPSNGVRNKCSVLDQQQTEKYLNINLVQSDLLDCIRNNNYFIDKINNCEKNF 1178
            S +++LHFD  NT+ VSD  +R  T  AL  ++S + WG + + +W+   +  S   P    +S+Y     +   T              T   G  F+++  EHLE L W      D  L+VKG   KLYH+ILP+FFQ +  L     +F+++ RTFG D+P +L A+K A  +G HP+FP     ++ +N+        M    +  +         E  +T D E  +  + +S  G+   +D+F +W  + +     KPLWI+      D+   HIF DD IR  D D+IVH +          +   G++ + +      T +  ++ LVQ+DLL  I   +YF  +I  C +N+
Sbjct:   41 SRRVVLHFDLNNTILVSDAVTRQGTVAALEYFLSTVTWGRMTKGKWEWLSEAPSLLPPCEGAVSYYSQFGRVAAFT--------------TVGPGRRFRKVLEEHLELLSWPSHLPADKELSVKGEDGKLYHWILPSFFQMLQDLASQGIEFSVLFRTFGTDLPRVLAAVKNAVEHGSHPLFPDLPALKLKVNM--------MAGRIRCSVKGVSLTRGEEHASTRDGERSVYQYLSSAEGLGGFQDNFDWWARNTYSILGGKPLWID----PFDSNVQHIFIDDNIRQNDEDTIVHPKVF--------LERGGLQTRTAC-----TSELYDLCLVQNDLLKAISEPDYFTRRIQICMENY 362          
BLAST of Si:dkey-32e6.3 vs. Ensembl Xenopus
Match: ENSXETT00000053743.1 (uncharacterized LOC100488455 [Source:NCBI gene;Acc:100488455])

HSP 1 Score: 179.874 bits (455), Expect = 5.276e-52
Identity = 109/356 (30.62%), Postives = 178/356 (50.00%), Query Frame = 3
Query:  126 KLILHFDARNTLFVSDFNSRFTTEKALNTYISGLAWGSIVE-DQWQMSHQEISTDRPDSSLISFY-KYMENIMVRTPEDRPKLREKLGKFTQENGIAFQEIYFEHLEKLEWNYEYQPDLTVKGNCDKLYHYILPTFFQTISHLYKNKRDFAIIIRTFGLDIPPILRAIKAFINGKHPMFPTEMNINLCDWQNELVMDTNNKEYIYKFKSCNDHEIETTSDEEEIVSHWNSISGIAAVKDDFQYWCNHNFHYTASKPLWINHKFEASDNICHHIFFDDCIRPRDTDSIVHLRYLKTSRADPSIPSNGVRNKCSVLDQQQTEKYLNINLVQSDLLDCIRNNNYFIDKINNCEKNFSLF 1187
            KL+LH D  NT+ VSD  +      ALN+Y+S + WG I E  +W      +S   P ++ +++Y ++  N              K+GK        F+EI+  H+  LEW  +     T K     +YH+ILP+FF  + +L++  R+F++++RTFG+D+P IL A+ + + G+HP FP    + L        +  + +E +  + S     I T +D+E I  ++NS++GI  ++D F +W  ++F     KP WI    + SD    HIF DD IR  + D+IV+ +     +  P               +  T +   I LVQ+DLL  I   +YF+D I  CE+N+  +
Sbjct:   34 KLVLHLDLNNTILVSDAATGQGPRAALNSYLSTVTWGQISETGEWMWLSDSVSVTAPCNNAVNYYTQFGRNAQFTD--------TKMGK-------RFKEIFDRHMRMLEWQGQANNMFTQKEGDGTVYHWILPSFFHLLENLHQQGREFSVLLRTFGVDLPLILPALHSALLGEHPHFPQLRKVPLNVGLTPGKIRCSTREVVMSWGS---DRISTKADKESIYKYFNSVTGIGGIQDHFDWWARNHFSGDGGKPFWI----DPSDRDTQHIFIDDNIRLNEEDTIVNCQVFMNQQHKPQP------------RKVTTSELYGICLVQNDLLRAIAEKDYFLDCIRVCEENYDRY 355          
BLAST of Si:dkey-32e6.3 vs. Ensembl Xenopus
Match: ENSXETT00000053745.1 (uncharacterized LOC100488455 [Source:NCBI gene;Acc:100488455])

HSP 1 Score: 179.489 bits (454), Expect = 7.547e-52
Identity = 109/356 (30.62%), Postives = 178/356 (50.00%), Query Frame = 3
Query:  126 KLILHFDARNTLFVSDFNSRFTTEKALNTYISGLAWGSIVE-DQWQMSHQEISTDRPDSSLISFY-KYMENIMVRTPEDRPKLREKLGKFTQENGIAFQEIYFEHLEKLEWNYEYQPDLTVKGNCDKLYHYILPTFFQTISHLYKNKRDFAIIIRTFGLDIPPILRAIKAFINGKHPMFPTEMNINLCDWQNELVMDTNNKEYIYKFKSCNDHEIETTSDEEEIVSHWNSISGIAAVKDDFQYWCNHNFHYTASKPLWINHKFEASDNICHHIFFDDCIRPRDTDSIVHLRYLKTSRADPSIPSNGVRNKCSVLDQQQTEKYLNINLVQSDLLDCIRNNNYFIDKINNCEKNFSLF 1187
            KL+LH D  NT+ VSD  +      ALN+Y+S + WG I E  +W      +S   P ++ +++Y ++  N              K+GK        F+EI+  H+  LEW  +     T K     +YH+ILP+FF  + +L++  R+F++++RTFG+D+P IL A+ + + G+HP FP    + L        +  + +E +  + S     I T +D+E I  ++NS++GI  ++D F +W  ++F     KP WI    + SD    HIF DD IR  + D+IV+ +     +  P               +  T +   I LVQ+DLL  I   +YF+D I  CE+N+  +
Sbjct:   34 KLVLHLDLNNTILVSDAATGQGPRAALNSYLSTVTWGQISETGEWMWLSDSVSVTAPCNNAVNYYTQFGRNAQFTD--------TKMGK-------RFKEIFDRHMRMLEWQGQANNMFTQKEGDGTVYHWILPSFFHLLENLHQQGREFSVLLRTFGVDLPLILPALHSALLGEHPHFPQLRKVPLNVGLTPGKIRCSTREVVMSWGS---DRISTKADKESIYKYFNSVTGIGGIQDHFDWWARNHFSGDGGKPFWI----DPSDRDTQHIFIDDNIRLNEEDTIVNCQVFMNQQHKPQP------------RKVTTSELYGICLVQNDLLRAIAEKDYFLDCIRVCEENYDRY 355          
BLAST of Si:dkey-32e6.3 vs. TrEMBL
Match: A0A267FFE8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012369g1 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 1.264e-70
Identity = 141/356 (39.61%), Postives = 189/356 (53.09%), Query Frame = 3
Query:  120 SNKLILHFDARNTLFVSDFNSRFTTEKALNTYISGLAWGSIVEDQ-WQMSHQEISTDRPDSSLISFYKYMENIMVRTPEDRPKLREKLGKFT-QENGIAFQEIYFEHLEKLEWNYEYQPD-LTVKGNCDKLYHYILPTFFQTISHLYKNKRDFAIIIRTFGLDIPPILRAIKAFINGKHPMFPTEMNINLCDWQNELVMDTNNKEYIYKFKSCNDHEIETTSDEEEIVSHWNSISGIAAVKDDFQYWCNHNFHYTASKPLWINHKFEASDNICHHIFFDDCIRPRDTDSIVHLRYLKTSRADPSIPSNGVRNKCSVLDQQQTEKYLNINLVQSDLLDCIRNNNYFIDKINNCEKNF 1178
              KL+LHFDARNT+FV+D  SR T E ALNTYISG+ WG   +D  W       S   P   + S YK  E  +VR PEDR +LRE LG FT Q +G  F+ ++ E L +L W YE   D LTV G     YHY+LP+F   +  L  + R+F I+IRTFG D P IL A+     G+HP +P  +++ +      L  +   +    KF+      +E T  E ++  HW+S  G  AV DDF +W  +N+  +ASK LW    F+  D    HI FDD IR  D DSIVH R  +T+  + +         C     Q  E  L    V +DLL+   + NYFID++  CE N+
Sbjct:  140 GRKLVLHFDARNTIFVADLFSRITVEMALNTYISGVVWGEEQQDGGWHCISDAPSLYPPRPGVTSLYKLFERAIVRVPEDRQRLRETLGNFTEQPHGRRFRRLFQEKLRRLRWPYEAANDKLTVTGQDGSAYHYLLPSFLNLVQALEASGREFCIVIRTFGRDAPHILNALDMLAKGQHPGYPRRLDMKV-----NLEPERFQRLAADKFRYLRSDGVELTQ-ERQVYEHWSSSCGAMAVVDDFAFWQVNNYSSSASKLLW----FDPRDTRIQHIIFDDNIRVFDEDSIVHFRSFETATDEGT--------DCPPERLQSLENAL---FVTADLLESSSDANYFIDRVLQCEVNY 474          
BLAST of Si:dkey-32e6.3 vs. TrEMBL
Match: R7U3I0 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_125662 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.961e-70
Identity = 132/359 (36.77%), Postives = 206/359 (57.38%), Query Frame = 3
Query:  126 KLILHFDARNTLFVSDFNSRFTTEKALNTYISGLAWGSIVEDQWQMSHQEISTDRPDSSLISFYKYMENIMVRTPEDRPKLREKLGKFTQ-ENGIAFQEIYFEHLEKLEWNY-EYQPDLTVKGNCDKLYHYILPTFFQTISHLYKNKRDFAIIIRTFGLDIPPILRAIKAFINGKHPMFPTEMNINLCDWQNELVMDTNNK---EYIYKFKSCNDHEIETTSDEEEIVSHWNSISGIAAVKDDFQYWCNHNFHYTASKPLWINHKFEASDNICHHIFFDDCIRPRDTDSIVHLRYLKTSRADPSIPSNGVRNKCSVLDQQQTEKYLNINLVQSDLLDCIRNNNYFIDKINNCEKNFSLF 1187
            KLILHFD RNT+ V+D  ++   E+ALN++++ + WG+ V +QW+    E S  +P   +I++YK++E  +V+TP DR  LR+  G FTQ   G  F   + +HLE L+W +      +T++G     YHYILP FF+ + +L + KRDF I+ RT+GLD P +L   K  + G+HPMFP ++++ L      +    + K   E   K  +      +  + E +I +  N + GI+A  DDF  W N ++H+TA+KP WI+     +D   HHIFFDD IR  + DSIV +R +  S             +   LD ++T+ + ++ LVQ+DLL+   N +YFI+K+  CE N+S +
Sbjct:   12 KLILHFDVRNTVLVADSVTQVNVEQALNSFLTSVTWGNEVNNQWEWYSDEPSLVQPRPGVITYYKHLEKRLVKTPSDRALLRQVTGDFTQIPIGSRFLPHFQKHLEYLKWTHGPVAKVMTMEGRDGSPYHYILPAFFKFLFYLCEQKRDFCIVFRTYGLDAPNVLACTKLTLAGQHPMFPQKLHMELNPIPGRVFRTESGKIAFEDYSKTDANGKMNRKIFTSELDIYNMLNELKGISAFVDDFISWQNADYHHTAAKPFWIDR----TDQTVHHIFFDDNIRTNECDSIVDVRLINQS-----------TRQGRSLDMEETKVFEDMCLVQADLLESTSNIDYFINKLIQCENNYSKY 355          
BLAST of Si:dkey-32e6.3 vs. TrEMBL
Match: A0A267EPM0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014718g1 PE=4 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 6.112e-70
Identity = 139/359 (38.72%), Postives = 198/359 (55.15%), Query Frame = 3
Query:  114 SMSNKLILHFDARNTLFVSDFNSRFTTEKALNTYISGLAWG-SIVEDQWQMSHQEISTDRPDSSLISFYKYMENIMVRTPEDRPKLREKLGKFT-QENGIAFQEIYFEHLEKLEWNYEYQPD-LTVKGNCDKLYHYILPTFFQTISHLYKNKRDFAIIIRTFGLDIPPILRAIKAFINGKHPMFPTEMNINLCDWQNELVMDTNNKEYIYKFKSCNDHEIETTSDEEEIVSHWNSISGIAAVKDDFQYWCNHNFHYTASKPLWINHKFEASDNICHHIFFDDCIRPRDTDSIVHLRYLKTSRADPSIPSNGVRNKCSVLDQQQTEKYLNINLVQSDLLDCIRNNNYFIDKINNCEKNFS 1181
            S   KL+LHFDARNT+FV+D  SR T E ALNTYISG+ WG S  +  W+   + IS   P   + S YK  E  +VR PEDR  LRE LG FT Q +G  F+ I+  +L KL W Y+   D LTV G     YHY+LP+F   +  L  + R+F +++RTFG D P IL A+     G HP +  +++  + + + E        E+ Y FKS    +      E  +  HWNS +GI AV DDF+YW  + +HYTA+K LW    ++ +D+   H+ FDD IR  D D+I++++           P+      C   +  + E  L    V ++L+D I + NYFID+++ CE N+S
Sbjct:   51 SQGRKLVLHFDARNTIFVADLFSRITVEMALNTYISGVVWGVSESDSHWRCISETISIHPPQPGVTSLYKLFEKDIVRVPEDRQLLRETLGNFTEQPHGRKFRPIFEANLAKLRWPYKKIDDRLTVTGRDGSAYHYLLPSFLNLVHALDASGREFCVVVRTFGRDAPHILNALDLLRQGLHPGYDKQLSARI-NLKPESFDRIGRDEFKY-FKS----DGSVLRSERAVYEHWNSCTGIMAVVDDFEYWQANQYHYTAAKFLW----YDPNDSDHQHVMFDDNIRLHDEDNIINVKVFDG-------PNWEAARDCRPDETAKLEDSL---FVPANLIDSIGDPNYFIDRVSQCEANYS 389          
BLAST of Si:dkey-32e6.3 vs. TrEMBL
Match: A0A267GQ85 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031419g1 PE=4 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 1.044e-69
Identity = 139/359 (38.72%), Postives = 197/359 (54.87%), Query Frame = 3
Query:  114 SMSNKLILHFDARNTLFVSDFNSRFTTEKALNTYISGLAWGSIVED-QWQMSHQEISTDRPDSSLISFYKYMENIMVRTPEDRPKLREKLGKFT-QENGIAFQEIYFEHLEKLEWNYEYQPD-LTVKGNCDKLYHYILPTFFQTISHLYKNKRDFAIIIRTFGLDIPPILRAIKAFINGKHPMFPTEMNINLCDWQNELVMDTNNKEYIYKFKSCNDHEIETTSDEEEIVSHWNSISGIAAVKDDFQYWCNHNFHYTASKPLWINHKFEASDNICHHIFFDDCIRPRDTDSIVHLRYLKTSRADPSIPSNGVRNKCSVLDQQQTEKYLNINLVQSDLLDCIRNNNYFIDKINNCEKNFS 1181
            S   KL+LHFDARNT+FV+D  SR T E ALNTYISG+ WG    D  W+   + IS   P   + S YK  E  +VR PEDR  LRE LG FT Q +G  F+ I+  +L KL W Y+   D LTV G     YHY+LP+F   +  L  + R+F +++RTFG D P IL A+     G HP +  +++  + + + E        E+ Y FKS    +      E  +  HWNS +GI AV DDF+YW  + +HYTA+K LW    ++ +D+   H+ FDD IR  D D+I++++           P+      C   +  + E  L    V ++L+D I + NYFID+++ CE N+S
Sbjct:   51 SQGRKLVLHFDARNTIFVADLFSRITVEMALNTYISGVVWGVSENDSHWRCISETISIHPPQPGVTSLYKLFEKDIVRVPEDRQLLRETLGNFTEQPHGRKFRPIFEANLAKLRWPYKKIDDRLTVTGRDGSAYHYLLPSFLNLVHALDASGREFCVVVRTFGRDAPHILNALDLLRQGLHPGYDKQLSARI-NLKPESFDRIGRDEFKY-FKS----DGSVLRSERAVYEHWNSCTGIMAVVDDFKYWQANQYHYTAAKFLW----YDPNDSDHQHVMFDDNIRLHDEDNIINVKVFDG-------PNWEAARDCRPDETAKLEDSL---FVPANLIDSIGDPNYFIDRVSQCEANYS 389          
BLAST of Si:dkey-32e6.3 vs. TrEMBL
Match: A0A267GCS3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014718g2 PE=4 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 2.006e-69
Identity = 139/359 (38.72%), Postives = 197/359 (54.87%), Query Frame = 3
Query:  114 SMSNKLILHFDARNTLFVSDFNSRFTTEKALNTYISGLAWG-SIVEDQWQMSHQEISTDRPDSSLISFYKYMENIMVRTPEDRPKLREKLGKFT-QENGIAFQEIYFEHLEKLEWNYEYQPD-LTVKGNCDKLYHYILPTFFQTISHLYKNKRDFAIIIRTFGLDIPPILRAIKAFINGKHPMFPTEMNINLCDWQNELVMDTNNKEYIYKFKSCNDHEIETTSDEEEIVSHWNSISGIAAVKDDFQYWCNHNFHYTASKPLWINHKFEASDNICHHIFFDDCIRPRDTDSIVHLRYLKTSRADPSIPSNGVRNKCSVLDQQQTEKYLNINLVQSDLLDCIRNNNYFIDKINNCEKNFS 1181
            S   KL+LHFDARNT+FV+D  SR T E ALNTYISG+ WG S  +  W+   + IS   P   + S YK  E  +VR PEDR  LRE LG FT Q +G  F+ I+  +L KL W Y+   D LTV G     YHY+LP+F   +  L  + R+F +++RTFG D P IL A+     G HP +  +++  + + + E        E+ Y FKS    +      E  +  HWNS +GI AV DDF+YW  + +HYTA+K LW    ++ +D+   H+ FDD IR  D D+I++++           P+      C      +T K  +   V ++L+D I + NYFID++  CE N+S
Sbjct:   51 SQGRKLVLHFDARNTIFVADLFSRITVEMALNTYISGVVWGVSESDSHWRCISETISIHPPQPGVTSLYKLFEKDIVRVPEDRQLLRETLGNFTEQPHGRKFRPIFEANLAKLRWPYKKIDDRLTVTGRDGSAYHYLLPSFLNLVHALDASGREFCVVVRTFGRDAPHILNALDLLRQGLHPGYDKQLSARI-NLKPESFDRIGRDEFKY-FKS----DGSVLRSERAVYEHWNSCTGIMAVVDDFEYWQANQYHYTAAKFLW----YDPNDSDHQHVMFDDNIRLHDEDNIINVKVFDG-------PNWEAARDCR---PDETAKLEDSLFVPANLIDSIGDPNYFIDRVLQCEANYS 389          
BLAST of Si:dkey-32e6.3 vs. Ensembl Cavefish
Match: si:dkey-32e6.3 (uncharacterized LOC103047798 [Source:NCBI gene;Acc:103047798])

HSP 1 Score: 177.948 bits (450), Expect = 1.896e-51
Identity = 108/367 (29.43%), Postives = 178/367 (48.50%), Query Frame = 3
Query:   87 SIADNNFFNSMSNKLILHFDARNTLFVSDFNSRFTTEKALNTYISGLAWGSIVEDQWQMSHQEISTDRPDSSLISFYKYMENIMVRTPEDRPKLREKLGKFTQENGIAFQEIYFEHLEKLEWNYEYQPD--LTVKGNCDKLYHYILPTFFQTISHLYKNKRDFAIIIRTFGLDIPPILRAI-KAFINGKHPMFPTEMNINLCDWQNELVMDTNNKEYIYKFKSCNDHEIETTSDEEEIVSHWNSISGIAAVKDDFQYWCNHNFHYTASKPLWINHKFEASDNICHHIFFDDCIRPRDTDSIVHLRYLKTSRADPSIPSNGVRNKCSVLDQQQTEKYLNINLVQSDLLDCIRNNNYFIDKINNCEKNF 1178
             +A +N  +    K+++HFD  NT+ VSD  ++  T  AL  Y+S + WG + + +W+   +  +   P    +++Y +      R P            FT   G  F+++  EHLE L+W    QPD  L++KG   KLYH+ILP+FFQ +  L     +F+I+ RTFG D+P +L  + +A   G HP+FP    + L        +  +NK  +  +    +  +     E  +    +S  G++  +D F +W  + +     KPLWI+      D+   HIF DD IR  D D+IVH +       DP     G + + +      T +  ++ LVQ+DL   I + +YFI +I+ C +N+
Sbjct:   35 GVALSNLPSVKKKKIVIHFDLNNTILVSDAVTKQGTVAALEYYLSTVTWGRMAKGRWEWMCETPTLLPPCEGAVTYYSHFG----RVP-----------GFTSGPGKRFRKVLEEHLELLQWPSHLQPDKELSIKGEDGKLYHWILPSFFQLLQDLASQGLEFSIVFRTFGTDLPRVLLVVQRALEQGTHPLFPDLPALKLSVNVTAGRIRCSNKGAVLTY---GEERLSARDGERSLYQFMSSSQGLSGFQDHFDWWAQNTYSILGGKPLWID----PFDSAVQHIFIDDNIRQNDEDTIVHPKVF----LDP----EGSQTRTA-----STSELYDLCLVQNDLFRAISDPSYFIQRIHICMENY 366          
BLAST of Si:dkey-32e6.3 vs. Ensembl Nematostella
Match: EDO34947 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMX2])

HSP 1 Score: 145.206 bits (365), Expect = 6.840e-39
Identity = 114/391 (29.16%), Postives = 187/391 (47.83%), Query Frame = 3
Query:   78 ITISIADNNFF------NSMSNKLILHFDARNTLFVSDFNSRFTT-EKALNTYISGLAWGSI-VEDQWQMSHQEISTDRPDSSLISFYKYMENIMVRTPEDRPKLREKLGKFT-QENGIAFQEIYFEHLEKLEWNYEYQPDLTVKGNCDKL--------YHYILPTFFQTISHLYKNKRDFAIIIRTFGLDIPPILRAIKAFINGKHPMFPTEMNINLCDWQNELVMDTNNKEYIYKFKSCNDHEIETTSD------EEEIVSHWNSISGIAAVKDDFQYWCNHNFHYTASKPLWINHKFEASDNICHHIFFDDCIRPRD-TDSIVHLRYLKTSRADPSIPSNGVRNKCSVLDQQQTEKYLNINLVQSDLLDCIRNNNYFIDKINNCEKNF 1178
            ++ S AD   F       S   KL+LH D  NT+FV D  ++ T  E  LN Y++ + WG    ED+W      IS+     ++IS+YKY E       + R + +E   +FT +E G  F+    +  E+LE +        V G  D L        Y+ I+P+FF+ I++L +  ++F+II+RTFG D    L+A+K FI+G HP+F      +L         D +     Y+   C +     TSD       E++   ++  +G+    DD+++W    +  +A KPL ++     +D+  HHI FDD IR  D +D+IV+L   K  +     P          LD        ++ LV++ L + + + +YFI+K+  C+ N+
Sbjct:  101 VSQSFADVTLFFKCFLMASKQRKLVLHIDVNNTMFVGDSKTKLTALEGVLNEYMTEIVWGRKNEEDEWVPVENPISSKPASENVISYYKYAEEKYQNAGKPRSEFKEHARQFTFEEIGKRFRPYVEKVKERLECDAP-----VVDGIIDPLILKEPHGIYYRIVPSFFKLITNLIEKGQEFSIILRTFGGDGETALQAVKLFIDGLHPVFGFPEGKSL---------DVSFTP--YQITGCEEGLSVRTSDNKKLNCPEKVYVLFSEKAGVHLFLDDYEWWKKQGYVSSAGKPLLVD----PTDSSIHHIMFDDNIRAWDPSDNIVNLMVRKEGKFQECDPKE--------LD--------DVCLVRTQLFESVLDEDYFIEKVEMCQHNY 455          
BLAST of Si:dkey-32e6.3 vs. Ensembl Medaka
Match: si:dkey-32e6.3 (uncharacterized LOC105354325 [Source:NCBI gene;Acc:105354325])

HSP 1 Score: 167.548 bits (423), Expect = 1.828e-47
Identity = 105/358 (29.33%), Postives = 169/358 (47.21%), Query Frame = 3
Query:  114 SMSNKLILHFDARNTLFVSDFNSRFTTEKALNTYISGLAWGSIVEDQWQMSHQEISTDRPDSSLISFYKYMENIMVRTPEDRPKLREKLGKFTQENGIAFQEIYFEHLEKLEWNYEYQPD--LTVKGNCDKLYHYILPTFFQTISHLYKNKRDFAIIIRTFGLDIPPILRAI-KAFINGKHPMFPTEMNINLCDWQNELVMDTNNKEYIYKFKSCNDHEIETTSDEEEIVSHWNSISGIAAVKDDFQYWCNHNFHYTASKPLWINHKFEASDNICHHIFFDDCIRPRDTDSIVHLRYLKTSRADPSIPSNGVRNKCSVLDQQQTEKYLNINLVQSDLLDCIRNNNYFIDKINNCEKNF 1178
            S   KL+LH D  NT+ VSD  +   T  AL  +++ + WG + + QW+      S   P S+  S+Y +    +                FT   G  F+    EHL+ L W    + D  L+++G    LYH+ILP+FFQ +  L +   DFA++ RTFG D+P +LRA+ +    G HP+FP    + L        + ++ K  +    +  D    +   E  +  + +S+ G+   +D+F++W  + F     KPLWI    +  D    HIF DD IR  D DS+V+ +       DP    +  R  C       T +  +I L+Q+DLL  I + +YF  +++ C +N+
Sbjct:   48 SRRRKLVLHVDLNNTILVSDAVTAQGTVAALEYFLTTVTWGRMYKGQWEWLSDTPSLLPPHSNAESYYSHFGRTV---------------GFTSGAGRRFRGALDEHLQMLRWPEGMKKDKELSIRGEDGCLYHWILPSFFQLLKDLTQEGLDFAVVFRTFGTDLPRVLRAMSRVLQEGLHPLFPDLPELKLSVDVEPGDISSSRKGVVL---TRGDLSRSSRDGERSLYQYLSSLEGLGGFRDNFEWWAANKFSSRGGKPLWI----DPFDQQVQHIFIDDNIRQNDEDSVVNPKVF----LDPG--GSETRTAC-------TSELFDIALIQNDLLRAISDRSYFTQRVHICMENY 370          
BLAST of Si:dkey-32e6.3 vs. Planmine SMEST
Match: SMESG000051626.1 (SMESG000051626.1)

HSP 1 Score: 739.954 bits (1909), Expect = 0.000e+0
Identity = 355/359 (98.89%), Postives = 357/359 (99.44%), Query Frame = 3
Query:  117 MSNKLILHFDARNTLFVSDFNSRFTTEKALNTYISGLAWGSIVEDQWQMSHQEISTDRPDSSLISFYKYMENIMVRTPEDRPKLREKLGKFTQENGIAFQEIYFEHLEKLEWNYEYQPDLTVKGNCDKLYHYILPTFFQTISHLYKNKRDFAIIIRTFGLDIPPILRAIKAFINGKHPMFPTEMNINLCDWQNELVMDTNNKEYIYKFKSCNDHEIETTSDEEEIVSHWNSISGIAAVKDDFQYWCNHNFHYTASKPLWINHKFEASDNICHHIFFDDCIRPRDTDSIVHLRYLKTSRADPSIPSNGVRNKCSVLDQQQTEKYLNINLVQSDLLDCIRNNNYFIDKINNCEKNFSLFYF 1193
            MSNKLILHFDARNTLFVSDFNSRFTTEKALNTYISGLAWGSIVEDQWQMSHQEISTDRPDSSLISFYKYMEN MVRTPEDRPKLREKLGKFTQENGIAFQEIYFEHLEKLEWNYEYQPDLTVKGNCDKLYHYILPTFFQTISHLYKNKRDFAIIIRTFGLDIPPILRAIKAFINGKHPMFPTEMNINLCDWQNELVMDTNNKEYIYKFKSCND EIETTSDEEEIV+HWNSISGIAAVKDDFQYWCNHNFHYTASKPLWIN+KFEASDNICHHIFFDDCIRPRDTDSIVHLRYLKTSRADPSIPSNGVRNKCSVLDQQQTEKYLNINLVQSDLLDCIRNNNYFIDKINNCEKNFSLFYF
Sbjct:    1 MSNKLILHFDARNTLFVSDFNSRFTTEKALNTYISGLAWGSIVEDQWQMSHQEISTDRPDSSLISFYKYMENKMVRTPEDRPKLREKLGKFTQENGIAFQEIYFEHLEKLEWNYEYQPDLTVKGNCDKLYHYILPTFFQTISHLYKNKRDFAIIIRTFGLDIPPILRAIKAFINGKHPMFPTEMNINLCDWQNELVMDTNNKEYIYKFKSCNDREIETTSDEEEIVNHWNSISGIAAVKDDFQYWCNHNFHYTASKPLWINYKFEASDNICHHIFFDDCIRPRDTDSIVHLRYLKTSRADPSIPSNGVRNKCSVLDQQQTEKYLNINLVQSDLLDCIRNNNYFIDKINNCEKNFSLFYF 359          
BLAST of Si:dkey-32e6.3 vs. Planmine SMEST
Match: SMESG000028811.1 (SMESG000028811.1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.810e-12
Identity = 29/34 (85.29%), Postives = 31/34 (91.18%), Query Frame = 1
Query:  145 MLATLCSCRILIPVLRQKKHSILIFPVWHGDQLL 246
            MLATLCSCRILIPVLRQKK SILIFPVWHG + +
Sbjct:    1 MLATLCSCRILIPVLRQKKRSILIFPVWHGRECI 34          
BLAST of Si:dkey-32e6.3 vs. Planmine SMEST
Match: SMESG000045843.1 (SMESG000045843.1)

HSP 1 Score: 63.1586 bits (152), Expect = 3.838e-12
Identity = 28/30 (93.33%), Postives = 29/30 (96.67%), Query Frame = 1
Query:  145 MLATLCSCRILIPVLRQKKHSILIFPVWHG 234
            MLATLCSCR+LIPVLRQKK SILIFPVWHG
Sbjct:    1 MLATLCSCRVLIPVLRQKKRSILIFPVWHG 30          
The following BLAST results are available for this feature:
BLAST of Si:dkey-32e6.3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-32e6.3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-32e6.3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-32e6.3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-32e6.31.617e-4829.64si:dkey-32e6.3 [Source:ZFIN;Acc:ZDB-GENE-081104-40... [more]
back to top
BLAST of Si:dkey-32e6.3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000053743.15.276e-5230.62uncharacterized LOC100488455 [Source:NCBI gene;Acc... [more]
ENSXETT00000053745.17.547e-5230.62uncharacterized LOC100488455 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Si:dkey-32e6.3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-32e6.3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-32e6.3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FFE81.264e-7039.61Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
R7U3I02.961e-7036.77Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A267EPM06.112e-7038.72Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GQ851.044e-6938.72Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GCS32.006e-6938.72Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Si:dkey-32e6.3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-32e6.31.896e-5129.43uncharacterized LOC103047798 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Si:dkey-32e6.3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-32e6.3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-32e6.3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO349476.840e-3929.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Si:dkey-32e6.3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-32e6.31.828e-4729.33uncharacterized LOC105354325 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Si:dkey-32e6.3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000051626.10.000e+098.89SMESG000051626.1[more]
SMESG000028811.12.810e-1285.29SMESG000028811.1[more]
SMESG000045843.13.838e-1293.33SMESG000045843.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007085 ID=SMED30007085|Name=Si:dkey-32e6.3|organism=Schmidtea mediterranea sexual|type=transcript|length=1269bp
CACATTTCAATATCGTGGATAAAATCTATCATTAGGTTTTATTTTAGATT
TTATAATATATCAATTGACCAAACTTTATCACAATTTCAATTGCGGATAA
TAATTTTTTCAATTCCATGAGTAATAAGCTAATTTTACATTTTGATGCTC
GCAACACTTTGTTCGTGTCGGATTTTAATTCCCGTTTTACGACAGAAAAA
GCACTCAATACTTATATTTCCGGTTTGGCATGGGGATCAATTGTTGAAGA
CCAATGGCAAATGTCTCACCAGGAAATTAGTACTGACCGGCCAGATAGTT
CTCTTATTTCCTTTTACAAATATATGGAAAATATAATGGTTAGAACGCCA
GAAGATCGACCAAAATTAAGAGAAAAGTTAGGGAAGTTTACTCAGGAAAA
TGGAATAGCATTTCAAGAGATATATTTTGAGCATTTGGAAAAACTTGAGT
GGAACTATGAATATCAACCGGATCTTACGGTTAAAGGAAATTGTGACAAA
CTCTATCATTATATTTTGCCTACTTTTTTTCAAACAATTTCCCATTTATA
TAAAAACAAAAGAGATTTTGCAATTATCATTCGGACTTTTGGTTTAGACA
TTCCTCCGATTCTTAGAGCCATTAAAGCGTTTATCAACGGTAAACATCCA
ATGTTTCCAACAGAGATGAACATTAATCTTTGTGACTGGCAAAATGAATT
GGTTATGGACACAAATAATAAAGAATATATTTACAAGTTTAAGAGCTGCA
ATGACCATGAAATCGAAACAACTTCCGACGAAGAGGAAATTGTTAGTCAC
TGGAACTCTATAAGCGGAATAGCCGCTGTAAAGGATGACTTTCAATATTG
GTGCAACCACAATTTTCACTACACAGCTTCCAAGCCATTGTGGATTAACC
ATAAATTTGAGGCATCAGACAATATTTGTCATCACATATTTTTTGATGAC
TGCATTCGTCCAAGGGACACCGACAGCATAGTGCATTTACGTTACTTGAA
GACGAGCAGAGCAGATCCTTCGATTCCGTCGAATGGCGTTCGGAACAAGT
GTTCGGTTCTAGATCAGCAACAGACAGAAAAGTACCTGAACATAAATTTG
GTACAGTCGGATTTGCTTGACTGCATTCGTAACAATAATTATTTCATTGA
CAAAATCAACAACTGTGAAAAAAATTTTTCCCTTTTTTATTTTTGAATTT
TTTTTTATGGTGTTAGAATCGTTTTTGATTTGAGAACTTTATTCTTTTAT
GATTATTCTGAAATAGCGG
back to top

protein sequence of SMED30007085-orf-1

>SMED30007085-orf-1 ID=SMED30007085-orf-1|Name=SMED30007085-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=360bp
MSNKLILHFDARNTLFVSDFNSRFTTEKALNTYISGLAWGSIVEDQWQMS
HQEISTDRPDSSLISFYKYMENIMVRTPEDRPKLREKLGKFTQENGIAFQ
EIYFEHLEKLEWNYEYQPDLTVKGNCDKLYHYILPTFFQTISHLYKNKRD
FAIIIRTFGLDIPPILRAIKAFINGKHPMFPTEMNINLCDWQNELVMDTN
NKEYIYKFKSCNDHEIETTSDEEEIVSHWNSISGIAAVKDDFQYWCNHNF
HYTASKPLWINHKFEASDNICHHIFFDDCIRPRDTDSIVHLRYLKTSRAD
PSIPSNGVRNKCSVLDQQQTEKYLNINLVQSDLLDCIRNNNYFIDKINNC
EKNFSLFYF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR36960FAMILY NOT NAMEDcoord: 3..354