TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30007084
Uniprot Best hitTNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1 (E=7.05833e-18)
Length (bp)1511
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30007084) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30007084) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30007084) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30007084) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007084

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30007084SMESG000053469.1 PL06019A2E12ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30007084SMESG000053469.1 dd_Smed_v6_13061_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Category 2 cellSMED30007084SMESG000053469.1 dd_Smed_v4_13061_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
epidermisSMED30007084SMESG000053469.1 dd_Smed_v4_13061_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30007084SMESG000053469.1 dd_Smed_v4_13061_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
ventral epidermisSMED30007084SMESG000053469.1 dd_Smed_v4_13061_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 97.8265 bits (242), Expect = 4.102e-21
Identity = 107/490 (21.84%), Postives = 207/490 (42.24%), Query Frame = 2
Query:   65 LKCERSETEGVWIIIKQ---FNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELN-----RNLKNIQVKCLKKS--CDFKDKLCNIETHMKNCDRKFEDCPFYLIGGCIQTNISLDTMEH-----HLTSANFSHCKFLTRHI---YSLNQNFEQLQKNQ-IQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYE----NLHLNNQIYEFQ-------------RILKKENEF------------IWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVSTN 1390
            LK     + G  + + +   + ++   ++ +++ C+ C  +L +  Q  CG ++CESC+    S  S       P+CT  +  +V D         R +  +Q+ C  +S  C  +  L ++  H+KN D  FE+ P  +   C +  +  D  +H         A  SHCK     I    SL QN E ++KN+ IQ ++         +E+            + ++  +  +    ++ ++  ++KL+E++ +I  +RQN +    ++  +E  +N   E E  +     +  N  + E Q             R+   +  F            IW + ++K++   A  G+  ++YS  FY+   G K+  R+  NG    K  +LS+FF +++G++D ++ WP K  V + ++DQ + + H+  +F      D +   F +P      ++            V  N     DD I    +V T+
Sbjct:   19 LKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSS-------PKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKN-DCHFEELPC-VRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQVSLLQN-ESVEKNKSIQSLHNQICSFEIEIER-----------QKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFK----PDPNSSSFKKPT---GEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTS 480          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 80.1073 bits (196), Expect = 2.349e-15
Identity = 74/299 (24.75%), Postives = 132/299 (44.15%), Query Frame = 2
Query:  407 HMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNF---EQLQKNQIQEMNKLNLDIMKNLEK---TYXXXXXXXXXXXXVITYSRE----EARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYENLHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLD 1273
            H+K C +    C F+ IG C++T       EH +        ++L  H+  L  +    + L  +Q    ++L L   ++LEK   T+E I   +      +  + E    + R  +  +E LS K++++E  I +       +        E K   +E   Y+ +                  FIW + +F +K   A +G+   I+SP FY+ + G K+ LR+  NG    +  +LS+FF ++KG  D ++ WP    V + ++DQ+ R+ H+  +F  +  S      F RP+ D
Sbjct:  205 HVKTCGKCRVPCRFHAIG-CLETVEGEKQQEHEV--------QWLREHLAMLLSSVLEAKPLLGDQSHAGSEL-LQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADL--------EQKVLEMEASTYDGV------------------FIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNRE-HVIDAFRPDVTSSS----FQRPVND 462          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 80.1073 bits (196), Expect = 2.890e-15
Identity = 106/534 (19.85%), Postives = 211/534 (39.51%), Query Frame = 2
Query:   65 LKCERSETEGVWIIIKQ---FNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKC-------------------LKKSCDFKDKLC------------NIETHM-KNCD------------------RKFED--CPFYLIGG----CIQTNISLDT----MEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYE----NLHLNNQIYEFQ-------------RILKKENEF------------IWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVSTN 1390
            LK     + G  + + +   + ++   ++ +++ C+ C  +L +  Q  CG ++CESC+    S  S  C   +   +  + +V  D    R +  +Q+ C                   LK  C F++  C            ++  H+ K C                   +K ED  CP  ++       +QT +  +     ++ H  S+   H   L     SL +    LQ N+  E NK     +++L       + +IE  + ++  +  +    ++ ++  ++KL+E++ +I  +RQN +    ++  +E  +N   E E  +     +  N  + E Q             R+   +  F            IW + ++K++   A  G+  ++YS  FY+   G K+  R+  NG    K  +LS+FF +++G++D ++ WP K  V + ++DQ + + H+  +F      D +   F +P      ++            V  N     DD I    +V T+
Sbjct:   19 LKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQE--SIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQ-NESVEKNK----SIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFK----PDPNSSSFKKPT---GEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTS 538          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 80.1073 bits (196), Expect = 2.890e-15
Identity = 106/534 (19.85%), Postives = 211/534 (39.51%), Query Frame = 2
Query:   65 LKCERSETEGVWIIIKQ---FNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKC-------------------LKKSCDFKDKLC------------NIETHM-KNCD------------------RKFED--CPFYLIGG----CIQTNISLDT----MEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYE----NLHLNNQIYEFQ-------------RILKKENEF------------IWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVSTN 1390
            LK     + G  + + +   + ++   ++ +++ C+ C  +L +  Q  CG ++CESC+    S  S  C   +   +  + +V  D    R +  +Q+ C                   LK  C F++  C            ++  H+ K C                   +K ED  CP  ++       +QT +  +     ++ H  S+   H   L     SL +    LQ N+  E NK     +++L       + +IE  + ++  +  +    ++ ++  ++KL+E++ +I  +RQN +    ++  +E  +N   E E  +     +  N  + E Q             R+   +  F            IW + ++K++   A  G+  ++YS  FY+   G K+  R+  NG    K  +LS+FF +++G++D ++ WP K  V + ++DQ + + H+  +F      D +   F +P      ++            V  N     DD I    +V T+
Sbjct:   19 LKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQE--SIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQ-NESVEKNK----SIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFK----PDPNSSSFKKPT---GEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTS 538          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 78.1814 bits (191), Expect = 8.932e-15
Identity = 46/155 (29.68%), Postives = 81/155 (52.26%), Query Frame = 2
Query:  932 FIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRL---MPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVST 1387
            +IW + NF   L   +  +   I+SP FY+ K G K+ +RL   +P   R A   Y+S+F   ++G++D  + WP +  +++ I+DQS   V  +H    ++    + + F RP +  +P  F G   F+ L+ + +  F+  DD ++  C VST
Sbjct:  353 YIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCAN--YISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKP--ELLAFQRPTIPRNPKGF-GYVTFMHLEALRQRTFIK-DDTLLVRCEVST 501          

HSP 2 Score: 54.6842 bits (130), Expect = 3.122e-7
Identity = 32/113 (28.32%), Postives = 52/113 (46.02%), Query Frame = 2
Query:  107 IKQFNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCP 445
            I+ ++ +    L  ++ C IC   L  A Q PCG ++C++CI        H CP           Q+  D    R + ++ VKC  + C  K +L ++E H  +C+    DCP
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE--ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCP 163          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 67.0106 bits (162), Expect = 1.211e-11
Identity = 44/148 (29.73%), Postives = 78/148 (52.70%), Query Frame = 2
Query:  929 EFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTR---KVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKI 1363
            + IW ++  +Q+ + AKSG +  I+S  F S + G K+       G  ++  K +S++  LLKG+FDP + WP    +KI+++DQ+ R   +V+I++  +       +K L  RP  + +  + +G   F  L  + +N     DDKI
Sbjct:  264 QLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFL-ARPRGERN--AAFGSQSFCSL-AILQN--YVKDDKI 405          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 57.7658 bits (138), Expect = 1.235e-8
Identity = 33/145 (22.76%), Postives = 67/145 (46.21%), Query Frame = 2
Query:  926 NEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTR--KVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTID 1354
               +W + ++  K+  A+      + SP FY+ + G K+Q  +  NG    ++ ++SV+  +L G++D ++ WP   ++   + +Q  +  +  ++ SF      D     F RP  +   + F G   FI  + +   PF+  D
Sbjct:  322 GTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESF----VPDPTWENFQRPSNEPDQLGF-GFPRFISHELLHSRPFIKGD 461          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 57.3806 bits (137), Expect = 1.780e-8
Identity = 33/145 (22.76%), Postives = 67/145 (46.21%), Query Frame = 2
Query:  926 NEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTR--KVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTID 1354
               +W + ++  K+  A+      + SP FY+ + G K+Q  +  NG    ++ ++SV+  +L G++D ++ WP   ++   + +Q  +  +  ++ SF      D     F RP  +   + F G   FI  + +   PF+  D
Sbjct:  331 GTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESF----VPDPTWENFQRPSNEPDQLGF-GFPRFISHELLHSRPFIKGD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074275)

HSP 1 Score: 54.299 bits (129), Expect = 1.596e-7
Identity = 51/198 (25.76%), Postives = 91/198 (45.96%), Query Frame = 2
Query:  806 VQGIRCFLEEYKNFRLEKEFYENLH----LNNQIYEFQRILKKEN---EFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKN-GCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDD---SPISFYGKYDFIELDEVFRNPFLTIDDKII 1366
            V+ I C  EE  + +L++  ++ +     L  Q+   QRI   +N     IW ++++ +KL+ +K  Q + I     +S K  G  ++L +  NG    K + +     +L G++DP+++WP +   +I I DQ T         N   A D  K +F R   DD   S   F+  +  I      RN  + I+ +++
Sbjct:  288 VKNIVCETEERCD-KLDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESK--QYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCT---------NVADAEDYVKTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRVL 473          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074273)

HSP 1 Score: 53.9138 bits (128), Expect = 2.241e-7
Identity = 51/198 (25.76%), Postives = 91/198 (45.96%), Query Frame = 2
Query:  806 VQGIRCFLEEYKNFRLEKEFYENLH----LNNQIYEFQRILKKEN---EFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKN-GCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDD---SPISFYGKYDFIELDEVFRNPFLTIDDKII 1366
            V+ I C  EE  + +L++  ++ +     L  Q+   QRI   +N     IW ++++ +KL+ +K  Q + I     +S K  G  ++L +  NG    K + +     +L G++DP+++WP +   +I I DQ T         N   A D  K +F R   DD   S   F+  +  I      RN  + I+ +++
Sbjct:  266 VKNIVCETEERCD-KLDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESK--QYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCT---------NVADAEDYVKTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRVL 451          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 52.7582 bits (125), Expect = 4.623e-7
Identity = 51/198 (25.76%), Postives = 91/198 (45.96%), Query Frame = 2
Query:  806 VQGIRCFLEEYKNFRLEKEFYENLH----LNNQIYEFQRILKKEN---EFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKN-GCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDD---SPISFYGKYDFIELDEVFRNPFLTIDDKII 1366
            V+ I C  EE  + +L++  ++ +     L  Q+   QRI   +N     IW ++++ +KL+ +K  Q + I     +S K  G  ++L +  NG    K + +     +L G++DP+++WP +   +I I DQ T         N   A D  K +F R   DD   S   F+  +  I      RN  + I+ +++
Sbjct:  209 VKNIVCETEERCD-KLDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESK--QYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCT---------NVADAEDYVKTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRVL 394          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: unm_sa808 (un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21])

HSP 1 Score: 83.9593 bits (206), Expect = 1.310e-17
Identity = 59/271 (21.77%), Postives = 117/271 (43.17%), Query Frame = 2
Query:  464 CIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNKLNLDI---MKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYENLHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPL 1267
            C+ + +  + +  H  +    H   L  +I  +  + E L+K ++ ++ +   D+       E     +  ++E     +  S  + R  +  +E LS K+ ++E ++ +       ++G           RL +                     +  FIW + +F +K   A +G+   ++SP FY+ K G K+ LR+  NG    +  +LS+FF +++G  D ++ WP    V + ++DQS R+ HI  +F  +  S      F RP+
Sbjct:    1 CLPSKVEKEKIHEHERACAHEHLNLLLHYIMGMKVSLEGLEKTKVADLGRRCQDLEVKAGTFEDVVCVLNREVERFATTMEASNRQHRLDQDKIEALSNKVRQLERQVGVKDLTVAEMEG-----------RLREMSATTF---------------DGVFIWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGMSDALLKWPFNQKVTLMLLDQSNRE-HIIDAFRPDITSSS----FQRPV 240          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 85.5001 bits (210), Expect = 3.254e-17
Identity = 56/194 (28.87%), Postives = 94/194 (48.45%), Query Frame = 2
Query:  839 KNFRLEKEFYENLHLNNQIYEFQRILK------KENE--------------FIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRP-----LLDDSPI-----SFYGKYDFIELDEVF 1330
            +  RL++E  ENL  +N++ + +R L        E+E              FIW +  F ++   A +G+   ++SP FYS K G K+ LRL  NG    +  +LS+FF ++KGK+D ++ WP    V + ++DQ+ R+ HI  +F  + +S      F RP     +    P+        GK  ++  D +F
Sbjct:  336 RQHRLDQEKIENL--SNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNRE-HIIDAFRPDVSSTS----FQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIF 522          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 85.5001 bits (210), Expect = 3.254e-17
Identity = 56/194 (28.87%), Postives = 94/194 (48.45%), Query Frame = 2
Query:  839 KNFRLEKEFYENLHLNNQIYEFQRILK------KENE--------------FIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRP-----LLDDSPI-----SFYGKYDFIELDEVF 1330
            +  RL++E  ENL  +N++ + +R L        E+E              FIW +  F ++   A +G+   ++SP FYS K G K+ LRL  NG    +  +LS+FF ++KGK+D ++ WP    V + ++DQ+ R+ HI  +F  + +S      F RP     +    P+        GK  ++  D +F
Sbjct:  336 RQHRLDQEKIENL--SNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNRE-HIIDAFRPDVSSTS----FQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIF 522          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 85.1149 bits (209), Expect = 3.991e-17
Identity = 56/194 (28.87%), Postives = 94/194 (48.45%), Query Frame = 2
Query:  839 KNFRLEKEFYENLHLNNQIYEFQRILK------KENE--------------FIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRP-----LLDDSPI-----SFYGKYDFIELDEVF 1330
            +  RL++E  ENL  +N++ + +R L        E+E              FIW +  F ++   A +G+   ++SP FYS K G K+ LRL  NG    +  +LS+FF ++KGK+D ++ WP    V + ++DQ+ R+ HI  +F  + +S      F RP     +    P+        GK  ++  D +F
Sbjct:  349 RQHRLDQEKIENL--SNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNRE-HIIDAFRPDVSSTS----FQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIF 535          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf1 (TNF receptor-associated factor 1 [Source:ZFIN;Acc:ZDB-GENE-071120-4])

HSP 1 Score: 84.7297 bits (208), Expect = 4.884e-17
Identity = 69/241 (28.63%), Postives = 117/241 (48.55%), Query Frame = 2
Query:  728 QGLEILSQKLEEIE------------TKIDIYRQNQDP------VQGIRCFLEEYKNFRLEKEFYENLHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNP--FLTIDDKIIFTCLVSTN 1390
            Q L+ L QK++ IE            T+I +   N+D       +Q +   + E +   + K+    +    Q    Q+ +  +  F W V +  QK   A + Q  + YSP FY+ + G K+ LRL  NG    K  ++S+FF ++KG++DP++SWP K  V   ++DQ+ R+ H+  +F  + +S    + F++P+ D +  S  G   F  L +  R+P      DD I   C+V T+
Sbjct:  320 QQLDALQQKVQVIENIISALNREVEKTQISVVAMNRDHCNSQQIIQHLEATVAELQQRLVRKDIL--ISSLQQSISAQQDVSYDGTFYWRVCDVSQKQREAANSQKISQYSPAFYTARYGFKVCLRLYLNGDGAGKGSHISLFFVIMKGEYDPILSWPFKHKVTFFLLDQNQRE-HVIDAFRPDLSS----MSFHQPVSDMNVAS--GCPLFFPLKK-LRSPKHAYCKDDTIYIKCVVDTS 550          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 81.2629 bits (199), Expect = 9.464e-16
Identity = 108/514 (21.01%), Postives = 199/514 (38.72%), Query Frame = 2
Query:  116 FNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKC-------------------LKKSCDFKDKLC------------NIETHM-KNCD------------------RKFED--CPFYLIG--------GCIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEAR--KTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKN--FRLEKEFYENLHLNNQIYEFQ-------------RILKKENEF------------IWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVSTN 1390
            + ++    + E++ C+ C+ +L N  Q  CG ++CE+C+N   S  S  C     E   ++ +V  D    R +  +Q+ C                   LK  C F++  C            ++  H+ K C                   +K ED  CP  +I           +++  +   ++ H  S+   H   +      L      LQ N+  E NK ++ I+ N   ++E   E+ +           EAR  + ++ +E  + KL++++ +I   RQ  D   G++   E  +N   +LE         N  + E Q             R+   +  F            IW + ++K++   A  G+  ++YS  FY+   G K+  R+  NG    K  +LS+FF +++G++D ++ WP K  V + ++DQ   + H+  +F      D +   F +P      ++            V  N     DD I    +V T+
Sbjct:   34 YKERFLKPVEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMAC--EDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQ-NESSEKNK-SIQILHNQMCSFEIEIERHKEQ-----LRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFK----PDPNSSSFKKPT---GEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTS 531          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 77.7962 bits (190), Expect = 1.464e-14
Identity = 104/511 (20.35%), Postives = 197/511 (38.55%), Query Frame = 2
Query:  107 IKQFNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCD--------------------RKFEDCPFYLI--GGCIQTNISLDTMEHHLTSA-NFSHCKFLTRHI--------YSLNQNF-------------EQLQKN----QIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYEN--LHLNNQIYEFQRILKKE------NEFIWIVENFKQKLDTAKSGQNENIY-----------------------SPTFYSLKNGCKIQLRL---MPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVL-FNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVSTN 1390
            ++ ++ +    L  ++ C IC   L  A Q PCG ++C++CI        H CP      +    Q+  D    R + +++VKC  + C    +L ++E H+  CD                     KFE+CP   I    C       D + H  T    +  C++   ++        YS++                E++Q+N     +QE  + ++ +M    +++         +  +                    + E     +     +  P Q      +E +N R   E  E   +  ++QI E   I K E      NE    + +   +L   +S Q   I+                       S  FY+ K G K+ LRL   +P+  R A   Y+S+F   ++G++D ++ WP++  ++++I+DQS     ++     E    + ++L F RP +  +P  F G   F+ L  + +  ++  +D ++  C V+T+
Sbjct:   55 VQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVDNE--SLMENQLFPDNFAKREILSLRVKCPSQGCTETMELRHLERHLVRCDFAGVECSQCQSSFPKYSLQKHKFEECPRRQIFCENCALAMALEDKLNHDQTCPLAYVTCEYCQTNLIREQMPAHYSMDCTMAPIPCMYYEFGCTEKMQRNDLARHLQEFTQAHMRMMAQTLRSFSSSVTPTSHMPDISFCD--------------PSQFEPAPPSVATVHSSHTPSQND--CTQETRNLRETIEQLEGRLVRQDHQIREL--IAKMETQCTYVNELKHTIRSLDNRLGEMESQQCSGIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSAQRCA--NYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSE---GVAMQDQEEVMDTKPELLAFQRPTVARNPKGF-GYVTFMHLQALKQRQYVK-NDTLLVRCSVTTH 538          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 76.6406 bits (187), Expect = 2.130e-14
Identity = 51/178 (28.65%), Postives = 92/178 (51.69%), Query Frame = 2
Query:  851 LEKEFYENLHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQS----TRKVHISHSFNYE-SASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIF 1369
            + ++  E L L  Q+ E    +  E   IW + ++ +K+  AK   N   +SP FY+ K G K+Q+    NG  + +  YLSV+  +L G++D ++ WP    V  +++DQS    ++  HI+ +FN + +  +  K   +R  LD+S + F G   FI  +++ +  +  + D  IF
Sbjct:  285 VSRQRQEILELRKQVEELS--VSSEGVLIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFNPDPNWKNFQKPTGSRNSLDESTLGF-GYPKFISHEDIRKRNY--VRDNAIF 457          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 75.485 bits (184), Expect = 6.036e-14
Identity = 36/113 (31.86%), Postives = 64/113 (56.64%), Query Frame = 2
Query:  926 NEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRP 1264
             + IW + ++++K   A  G+  +I+S  FY+   G ++  R   NG  + K  +LS++F ++KG+FD ++ WP K  V + ++DQS +K HI+  F     +D +   F RP
Sbjct:  383 GKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFR----ADPNSSSFKRP 491          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 75.485 bits (184), Expect = 7.882e-14
Identity = 36/113 (31.86%), Postives = 64/113 (56.64%), Query Frame = 2
Query:  926 NEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRP 1264
             + IW + ++++K   A  G+  +I+S  FY+   G ++  R   NG  + K  +LS++F ++KG+FD ++ WP K  V + ++DQS +K HI+  F     +D +   F RP
Sbjct:  384 GKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFR----ADPNSSSFKRP 492          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 90.1225 bits (222), Expect = 1.009e-18
Identity = 88/448 (19.64%), Postives = 178/448 (39.73%), Query Frame = 2
Query:  128 LKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVI-------DYELNRNLKNIQVKCLKKSCDFKDKL-----------------------------------------------CNIETHMKNCDRKFEDCPFYLIG--GCIQTNISLDTMEHHLTSANFSHCKFLTR-HIYSLNQNFEQ--LQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSR--EEARKTKQGLE-ILSQKLEEIETKIDI----YRQNQDPVQGIRCFLEEYKNFRLEKEFYENLHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLD 1273
            L   L  +++C  CK IL   +Q  CG +YC  C+    S     C     E     G  ++       D    R ++++   C    C +K  L                                               C       + +  +E CP + +   GC +  I  +T + H+ +   S C+ L R H    ++  E   LQ +++Q + +    ++ +  +         +    ++   +  E+   T + +  +L++++E +    +     +R +QD ++ +   +++ +     K+      L  ++ E + +   +  FIW + +F +K   A +G+   I+SP FY+ + G K+ LR+  NG    +  +LS+FF ++KG  D ++ WP    V + ++D + R+ H+  +F  +  S      F RP+ D
Sbjct:   24 LGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRAC--SKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDL-AMADLEQKVSELE-VSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNRE-HVIDAFRPDVTSSS----FQRPVSD 462          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 84.7297 bits (208), Expect = 6.436e-17
Identity = 108/538 (20.07%), Postives = 212/538 (39.41%), Query Frame = 2
Query:   65 LKCERSETEGVWIIIKQ--FNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELN-----RNLKNIQVKC-------------------LKKSCDFKDKLC------------NIETHM-KNCD------------------RKFED--CPFYLIGG----CIQTNISLDT----MEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYE---------------------------NLHLNNQIYEFQRILKKE--NEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVSTN 1390
            LK +     G  ++ +Q  + ++   ++ +++ C+ C+ +L N  Q  CG ++CESC+    S  S       P+CT  +  ++ D         R +  +QV C                   LK  C F++  C            ++  H+ K C                   +K ED  CP  ++       +QT +  +     ++ H  S+   H   L     SL +    LQ N+  E NK     +++L       + +IE  + ++  +  +    ++ ++  ++KL+E++ +I  +RQN +    ++  +E  +N   E E  +                           ++ L +    FQ +         IW + ++K++   A  G+  ++YS  FY+   G K+  R+  NG    K  +LS+FF +++G++D ++ WP K  V + ++DQ + + H+  +F      D +   F +P      ++            V  N     DD I    +V T+
Sbjct:   19 LKLQPDRGAGSVLVPEQGGYKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSS-------PKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQ-NESVEKNK----SIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFK----PDPNSSSFKKPT---GEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTS 537          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 84.7297 bits (208), Expect = 6.436e-17
Identity = 108/538 (20.07%), Postives = 212/538 (39.41%), Query Frame = 2
Query:   65 LKCERSETEGVWIIIKQ--FNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELN-----RNLKNIQVKC-------------------LKKSCDFKDKLC------------NIETHM-KNCD------------------RKFED--CPFYLIGG----CIQTNISLDT----MEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYE---------------------------NLHLNNQIYEFQRILKKE--NEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVSTN 1390
            LK +     G  ++ +Q  + ++   ++ +++ C+ C+ +L N  Q  CG ++CESC+    S  S       P+CT  +  ++ D         R +  +QV C                   LK  C F++  C            ++  H+ K C                   +K ED  CP  ++       +QT +  +     ++ H  S+   H   L     SL +    LQ N+  E NK     +++L       + +IE  + ++  +  +    ++ ++  ++KL+E++ +I  +RQN +    ++  +E  +N   E E  +                           ++ L +    FQ +         IW + ++K++   A  G+  ++YS  FY+   G K+  R+  NG    K  +LS+FF +++G++D ++ WP K  V + ++DQ + + H+  +F      D +   F +P      ++            V  N     DD I    +V T+
Sbjct:   19 LKLQPDRGAGSVLVPEQGGYKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSS-------PKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQ-NESVEKNK----SIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFK----PDPNSSSFKKPT---GEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTS 537          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 84.3445 bits (207), Expect = 7.162e-17
Identity = 79/368 (21.47%), Postives = 166/368 (45.11%), Query Frame = 2
Query:  206 GCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCPFYLIG--GCIQTNISLDTMEHHLTSANFSHCKFLTR-HIYSLNQNFEQ--LQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSR--EEARKTKQGLE-ILSQKLEEIETKIDI----YRQNQDPVQGIRCFLEEYKNFRLEKEFYENLHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLD 1273
            GC + +  +  Y S     CP    EC   +G V     L+    + + +C K+S     + C       + +  +E CP + +   GC +  I  +T + H+ +   S C+ L R H    ++  E   LQ +++Q + +    ++ +  +         +    ++   +  E+   T + +  +L++++E +    +     +R +QD ++ +   +++ +     K+      L  ++ E + +   +  FIW + +F +K   A +G+   I+SP FY+ + G K+ LR+  NG    +  +LS+FF ++KG  D ++ WP    V + ++D + R+ H+  +F  +  S      F RP+ D
Sbjct:  118 GCTW-KGTLKEYESCHEGLCPFLLTECPACKGLV----RLSEKEHHTEQECPKRS--LSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRAC--SKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDL-AMADLEQKVSELE-VSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNRE-HVIDAFRPDVTSSS----FQRPVSD 469          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 78.1814 bits (191), Expect = 7.529e-15
Identity = 44/155 (28.39%), Postives = 82/155 (52.90%), Query Frame = 2
Query:  932 FIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRL---MPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVST 1387
            +IW + NF   L + +  +   I+SP FY+ + G K+ +RL   +P   R A   Y+S+F   ++G++D  + WP +  +++ I+DQS   +  +H    ++    + + F RP +  +P  F G   F+ L+ + +  F+  DD ++  C VST
Sbjct:  361 YIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCAN--YISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKP--ELLAFQRPTIPRNPKGF-GYVTFMHLEALRQGTFIK-DDTLLVRCEVST 509          

HSP 2 Score: 51.9878 bits (123), Expect = 1.202e-6
Identity = 32/113 (28.32%), Postives = 52/113 (46.02%), Query Frame = 2
Query:  107 IKQFNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCP 445
            I+ ++ +    L  ++ C IC   L  A Q PCG ++C++CI        H CP           Q+  D    R + ++ VKC  K C  K +L ++E H  +C+    +CP
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE--ILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCP 163          
BLAST of TNF receptor-associated factor vs. UniProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 7.058e-18
Identity = 88/448 (19.64%), Postives = 178/448 (39.73%), Query Frame = 2
Query:  128 LKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVI-------DYELNRNLKNIQVKCLKKSCDFKDKL-----------------------------------------------CNIETHMKNCDRKFEDCPFYLIG--GCIQTNISLDTMEHHLTSANFSHCKFLTR-HIYSLNQNFEQ--LQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSR--EEARKTKQGLE-ILSQKLEEIETKIDI----YRQNQDPVQGIRCFLEEYKNFRLEKEFYENLHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLD 1273
            L   L  +++C  CK IL   +Q  CG +YC  C+    S     C     E     G  ++       D    R ++++   C    C +K  L                                               C       + +  +E CP + +   GC +  I  +T + H+ +   S C+ L R H    ++  E   LQ +++Q + +    ++ +  +         +    ++   +  E+   T + +  +L++++E +    +     +R +QD ++ +   +++ +     K+      L  ++ E + +   +  FIW + +F +K   A +G+   I+SP FY+ + G K+ LR+  NG    +  +LS+FF ++KG  D ++ WP    V + ++D + R+ H+  +F  +  S      F RP+ D
Sbjct:   24 LGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRAC--SKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDL-AMADLEQKVSELE-VSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNRE-HVIDAFRPDVTSSS----FQRPVSD 462          
BLAST of TNF receptor-associated factor vs. UniProt
Match: sp|A7XUJ6|TRAF6_PIG (TNF receptor-associated factor 6 OS=Sus scrofa OX=9823 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.273e-15
Identity = 46/155 (29.68%), Postives = 82/155 (52.90%), Query Frame = 2
Query:  932 FIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRL---MPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVST 1387
            +IW + NF   L + +  +   I+SP FY+ K G K+ +RL   +P   R A   Y+S+F   ++G++D  + WP +  +++ I+DQS   +  +H    ++    + + F RP +  +P  F G   F+ LD + +  F+  DD ++  C VST
Sbjct:  372 YIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCAN--YISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPIRQNHEEIMDAKP--ELLAFQRPTIPRNPKGF-GYVTFMHLDALRQRTFIK-DDTLLVRCEVST 520          
BLAST of TNF receptor-associated factor vs. UniProt
Match: sp|Q3ZCC3|TRAF6_BOVIN (TNF receptor-associated factor 6 OS=Bos taurus OX=9913 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.140e-14
Identity = 46/155 (29.68%), Postives = 83/155 (53.55%), Query Frame = 2
Query:  932 FIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRL---MPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVST 1387
            +IW + NF   L + +  +   I+SP FY+ K G K+ +RL   +P+  R A   Y+S+F   ++G++D  + WP +  +++ I+DQS   V  +H    ++    + + F RP +  +P  F G   F+ L+ + +  F+  DD ++  C VST
Sbjct:  373 YIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPSAQRCAN--YISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAAVRQNHEEIMDAKP--ELLAFQRPTIPRNPKGF-GYVTFMHLEALRQRTFIK-DDTLLVRCEVST 521          
BLAST of TNF receptor-associated factor vs. UniProt
Match: sp|B6CJY4|TRAF6_CERAT (TNF receptor-associated factor 6 OS=Cercocebus atys OX=9531 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.218e-14
Identity = 47/155 (30.32%), Postives = 81/155 (52.26%), Query Frame = 2
Query:  932 FIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRL---MPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVST 1387
            +IW + NF   L   +  +   I+SP FY+ K G K+ +RL   +P   R A   Y+S+F   ++G++D  + WP +  +++ I+DQS   V  +H    ++    D + F RP +  +P  F G   F+ L+ + +  F+  DD ++  C VST
Sbjct:  353 YIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCAN--YISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKP--DLLAFQRPTIPRNPKGF-GYVTFMHLEALRQRTFIK-DDTLLVRCEVST 501          

HSP 2 Score: 54.299 bits (129), Expect = 1.724e-6
Identity = 32/113 (28.32%), Postives = 52/113 (46.02%), Query Frame = 2
Query:  107 IKQFNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCP 445
            I+ ++ +    L  ++ C IC   L  A Q PCG ++C++CI        H CP           Q+  D    R + ++ VKC  + C  K +L ++E H  +C+    DCP
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE--ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCP 163          
BLAST of TNF receptor-associated factor vs. UniProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.273e-14
Identity = 47/155 (30.32%), Postives = 81/155 (52.26%), Query Frame = 2
Query:  932 FIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRL---MPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVST 1387
            +IW + NF   L   +  +   I+SP FY+ K G K+ +RL   +P   R A   Y+S+F   ++G++D  + WP +  +++ I+DQS   V  +H    ++    D + F RP +  +P  F G   F+ L+ + +  F+  DD ++  C VST
Sbjct:  353 YIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCAN--YISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKP--DLLAFQRPTIPRNPKGF-GYVTFMHLEALRQRTFIK-DDTLLVRCEVST 501          

HSP 2 Score: 54.299 bits (129), Expect = 1.608e-6
Identity = 32/113 (28.32%), Postives = 52/113 (46.02%), Query Frame = 2
Query:  107 IKQFNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCP 445
            I+ ++ +    L  ++ C IC   L  A Q PCG ++C++CI        H CP           Q+  D    R + ++ VKC  + C  K +L ++E H  +C+    DCP
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE--ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCP 163          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: gnl|BL_ORD_ID|23070540 (tr|T1E101|T1E101_9PLAT TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.839e-26
Identity = 108/476 (22.69%), Postives = 209/476 (43.91%), Query Frame = 2
Query:   80 SETEGVWIIIKQFN-DQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTS----RGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETK-IDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYEN-------LHLNNQIYEFQRIL---------------KKEN--------------EFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLV 1381
            S+ + V  ++ ++N  ++  S+  + +C +C  ++ +A +  CGC YC +CI  Y SQ  ++CPG K EC        G V  +  L+  +  I VKC    C++  +L  ++ H+  C  +  +CP   I GC +  +  D M  HLT     H + +      L        K++I   N+   + + +L++     K   +     + +  EE R     + +LSQ ++E++ + I +    +  ++ ++    + + FR E EF +N         + NQ+ + ++ +               +K N              +F+W +E + +K  T       ++YS +F S  +  K  L L   G        L ++  ++KG+ D  + WP++  V ++II+Q + K H +  F Y++    +K  F+RP  D+      G    +    +   P + ++D II  C+V
Sbjct:    4 SKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTI-GCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNEL--------KSEINHNNETTKEDISHLKEVLRVQKALNDEKTAQMEFLIEELRNKDNMILVLSQDIQEVKNEMITLLTSKESELKKLK---SDIQIFRQEIEFMKNDLEVVGSTDIKNQVKDLKKEIFGIKMNIDSNNEERERKMNNLIRLNKLCPNVDMDFMWRIEEYSKKRRTVT-----DVYSDSFQS--HNYKFCLNLYIYG------DNLGLWCVIMKGEKDDFLEWPMRRTVTLSIIEQDSLKTHKTTVFQYDTYQ-RNKKAFDRP-KDERNDYCIGTDSLVRYSYIKETPMILVNDSIIVACVV 452          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: gnl|BL_ORD_ID|167333943 (tr|A0A3L7HD98|A0A3L7HD98_CRIGR TNF receptor-associated factor OS=Cricetulus griseus OX=10029 GN=CgPICR_012378 PE=3 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.705e-25
Identity = 97/400 (24.25%), Postives = 184/400 (46.00%), Query Frame = 2
Query:  128 LKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVI-------DYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCPFYLIG--GCIQTNISLDTMEHHLTSANFSH--CKFLTRHIYSLNQNFEQLQKNQIQEMNK-LNLDIMKNLEKTYXXXXXXXXXXXXV-ITYSREEARKTKQGLE-ILSQKLEEIETKIDI----YRQNQDPVQGIRCFLEEYKNFRLEKEFYENLHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLD 1273
            L   L  +++C  C+ IL   +Q  CG +YC  C+N   S     C     E     G  ++       D    R ++++   C    C +K  L   E H       +E CP + +   GC +  IS +  + H+ S N     C+F T     + +N E+LQ ++++++ + L L +   LE    +  +     E++   +S E+   T + +  +L++++E +    +     +R +QD ++ +   +++ +     K+      L  ++ E +     +  FIW + +F +K   A +G+   I+SP FY+ + G K+ LR+  NG    +  +LS+FF ++KG  D ++ WP    V + ++DQ+ R+ H+  +F  +  S      F RPL D
Sbjct:   24 LGTKLEAKYLCSACRNILRRPFQAQCGHRYCSFCLNSILSSGPQNCAACVHEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYEVH-------YEVCPKFPLTCDGCGKKKISREKFQDHVRSCNKCRVPCRFHTVGCSEMVEN-EELQDHEVKKLREHLALLLSSFLESPASQGSQSQAGPEMLQRCHSLEQKTATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDL-AMADLEQKVSELE-ASTYDGVFIWKISDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNRE-HVIDAFRPDVTSSS----FQRPLSD 408          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: gnl|BL_ORD_ID|20347035 (tr|I1ZID8|I1ZID8_SCHMD TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.232e-23
Identity = 54/183 (29.51%), Postives = 100/183 (54.64%), Query Frame = 2
Query:   86 TEGVWIIIKQFNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPEC----TTSRGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNKLNL 622
             E +  ++  +N +++  +P+   C +CK +L NA Q  CGC++C  CI  Y S+ + +CPG   EC     T    +  DY +NR +  ++VKC +++C    +L +IE H++ C  K ++CPF+++ GC Q  + +  + +HL +  F H K +   I ++  +F  L   +++    +NL
Sbjct:    3 AEKINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVL-GCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLTTKEVELREDINL 184          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: gnl|BL_ORD_ID|174063853 (tr|A0A0P7UP01|A0A0P7UP01_SCLFO TNF receptor-associated factor OS=Scleropages formosus OX=113540 GN=Z043_109893 PE=3 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 1.533e-21
Identity = 101/448 (22.54%), Postives = 204/448 (45.54%), Query Frame = 2
Query:   62 NLKCERSETEGVW-----IIIKQFNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYF-SQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKCL-KKSCDFKDKLCNIETHMKNCDRKFEDCPFYLIGGCIQTNISLDTMEH----------------------HLTSANFSHCKFLTRHIY----SLNQNFEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYENLHLNNQIYEFQRILKKENEF---------IWIVENFKQKLDTAKSGQNEN--IYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLD 1273
             L  + S T G W     ++ ++F  +    L ++++C  C  ++ N +Q  CG  +C  CI  +  S  +  CP    +      +V  D    R + N+++ C    +C  K  LC ++ H+K C  +   CP     GC +T    D  +H                      HL   +  H   L  H +    SL  + E   K  +QEM + + +++  ++++ EE K++++S++L +   ++  R   Q L     +L ++   +D  +Q    ++G++  L   ++  +      N+H++    +FQR  ++  E          IW + ++++K + A +G+  +  + S  FY+ ++G K++ R   NG  + +  +LS++  L++G FD ++ WP +  V + ++DQS  +  ++  F  + AS      F+RP+ D
Sbjct:   15 GLSRQNSGTAGSWEFDAALMTREF--KFVEKLEDQYVCPTCGQVVLNPHQTGCGHIFCYQCIQGFLDSDITPKCP--IDDSFIKANEVFQDNCCKREIANLEIYCTNAPNCSSKVTLCRLQDHLKICQYESVQCPN---SGCSETLFRKDVGDHLDSQCRYRLEPCPYCRKHYAVIHLMIDDLQHSLVLKHHEFQERTSLAGSLENQVKPLVQEMTRCD-NMIGTVQRSLEEQKDRVDSVQLQL---QQLTRAFSQDLGC--TELAQLRGSLDSLKQQVSAIEGLKERLVMLEDNYMRHSRLLNIHVD----QFQRNEERFRELESTSYNGKLIWKIRDYQKKKEAAAAGEGRSPFMLSAPFYTSRSGYKLRARAYLNGDGSGRGTHLSLYIVLMRGDFDSLLPWPFQQPVSLTVLDQSGARKDVTIVFKPDLASSS----FHRPVSD 441          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: gnl|BL_ORD_ID|24092336 (tr|A0A3M6TI16|A0A3M6TI16_9CNID Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00023872 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 3.329e-21
Identity = 92/379 (24.27%), Postives = 164/379 (43.27%), Query Frame = 2
Query:  116 FNDQLKNSLPEEFICKICKTILANAYQ-GPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFS--HCKFLTRHIYSLNQ--NFEQLQKNQIQEMNKLNLD----------IMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYENLHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRN--------AKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQ 1183
            ++ +    +P ++ C +C   + +  Q   CG K C  C    F  PS FCP  +     SR Q+  D    R + ++ VKC    C +  +L  +E H  NC  K   CP      C +     D   H  +  ++   +C +  + I    Q  +F+  QK  +   NK  L+          I ++   T    + K    ++    S  +A       + L+  L  +ET     RQ +D  Q I   + + K+   +    E L    ++ +    L     F+W + NF+   + A SG+ ENI + TFY   NG ++++++  N YR         + + Y S++  ++ G+FDP++SWP K+ +++ +I+Q
Sbjct:   13 YDYEFTGRVPHDYECLVCHLPMKDPVQIVQCGHKLCNICKESLFRLPSPFCPADRQ--PLSREQIFPDTACRRKILDLTVKCFHSGCLWTGELREVEEHQSNCLLKVVQCPN---SRCTEKVTRQDMGNHMASECSWRIIYCGYCQKLIVFNQQKKHFDICQKFPVHCTNKCGLEEIPRGKLEFHIGEDCPATEVYCEFKKLGCDVKFPRSNTKAHLETHIEQHLNLALRSLET---TQRQVKDQSQQIEQLMAKDKDLSQQ---IERLTAQVKVQDQHIKLLNSPPFVWKISNFQAAYEKALSGK-ENILTSTFYLSSNGYRLRIQIFSNAYRMRWFPDDFLSSTTYFSIYICVIPGEFDPLLSWPFKEKLRVTLINQ 379          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 97.4413 bits (241), Expect = 3.271e-21
Identity = 108/504 (21.43%), Postives = 198/504 (39.29%), Query Frame = 2
Query:  143 PEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFC-------PGTKPECTT--SRGQVVIDYELNRNLKNIQVKCLKKSCDFKDKL----------------CNI-----------ETHM-KNCD------------------------------------RKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEE--YKNFRL------------EKEFYENLHLNN--QIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNP--FLTIDDKIIFTCLV 1381
            P  F+C  C  +L  A+Q  CG +YC +C+                  PG++ + +   +      D  +N+ ++ ++V C+ + C ++  L                CNI            TH+ K C                                     ++ E C F  IG   + N   D +  H  S+  +H   L   + ++  +     +  +Q      LD+  N  +   +  +   + + +  +  +   +  Q L  L Q+L+ +E  I    +  +  Q     LE   + N  L            ++   ++L +++  Q    Q+ +  +  F+W + +  QKL  A +GQ  + YSP FY+ + G K+ +RL   G    K  ++S+FF ++KG +DP++SWP K  V   +IDQ+ R+ H+  +F      D     F RP+ + +  S  G   F  L ++ R+P      DD +   C+V
Sbjct:   24 PVHFLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPCNIGCGLMVLRKTLATHLEKGCPNNKTTCQVCCSALTPAELQSVTYFSLFLKDSKQESPKRKETCVFSEIGCTFKGNP--DKVREHEVSSTSAHLHLLVEVVRNVQMSVPPPPERTVQYPA---LDLTLNGGELETDSGDTGANDKALSLHDDQAELEVGQQLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNMNLIQHLEAVVAEQQQRLIRKDLQISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQRE-HVVDAFR----PDLRSASFQRPVSEMNVAS--GCPLFFPLSKL-RSPKHAYVKDDTLFIKCVV 514          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 96.2857 bits (238), Expect = 7.593e-21
Identity = 104/453 (22.96%), Postives = 196/453 (43.27%), Query Frame = 2
Query:  140 LPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCPF------------YLIGGCIQTNISLDTMEHHLTSAN---FSHC-----KFLTRHIYSLNQNFEQLQKN----QIQEMNKLNL----DIMKNLEKTYXXXXXXXXXXXXVITYSR------EEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQ-GIRCFLEEYKNFRLEKEFYENLHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRL---MPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVS 1384
            L  ++ C IC   L +A Q PCG ++C  CI          CP        +  Q+  D    R + ++ V+C    C  K +L ++E H+ +C      CP             ++   C    I+      ++  A     SHC     K      +S+    E++ +N     +QE  ++++    D+++N  +T   +     +     T SR      E A +  Q L+ + + + E+E+++   RQ+    +  IR   +  +   L K+      L   + E Q   + +  ++W +E F   +   ++G    ++SP FY+ + G K+ LRL    PN  R   S Y+S+F   ++G+FD  +SWP++  +++ ++DQ+  + H+         +  D   F RP +  +P  F G   F++L  + +  F+  DD ++  C V+
Sbjct:   64 LESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVDNE--VLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQCQESVWKSELEEHINQECSHRLITCPDCAENIIYAEKQLASHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRN--QTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRL--VRQDHKLRELSIRNETQSTQMTELRKKLAS---LEESMRELQ-AQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRC--SNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVE-----VMETKPDLQAFQRPTVQRNPKGF-GYVTFMQLQALHQRGFVR-DDVLMVRCEVT 497          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 87.4261 bits (215), Expect = 6.422e-18
Identity = 83/348 (23.85%), Postives = 146/348 (41.95%), Query Frame = 2
Query:  398 IETHMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKN---QIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETK---------IDIYRQNQDPVQGIRCFLEEY-----KNFRLEKEFYENLHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVSTN 1390
            ++ H   C  +  DC  Y   GC   N       H  T  N  H   L      L +  +QLQ++   Q  E+ + NL ++ NL++   +    + +++  +   RE     K+ L+ L   LE   TK         +D  R+     Q +R  L         + RL     + L  + Q ++       + + IW V ++ +K +   +     + SP FY+  +G K+  R+   G   A+  +LS++  L++G FD ++ WP + NV + ++DQS  + H+S SF  + AS+     F RP  + +    + ++      E  RN     DD +     V T 
Sbjct:  210 LKDHADECPEQETDC-IYKKYGCTVRNKRGQVKVHEQTEFNH-HVLLLLESNSKLIKQVDQLQQDFAAQQGELKERNL-LVSNLKREVSKCDTTVSAMQRSVEEQRELVSSVKRELKDLRDVLEADLTKEELVSLRASLDSLREQVAMTQSLREHLGALGQTCQSHTRLLDIHVQQLQCSEQRFQQLESTSYDGKLIWKVHDYHRKKEAGTA-----LNSPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQSGNRNHVSLSFTPDLASNN----FRRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIKVKVDTT 545          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 85.5001 bits (210), Expect = 3.099e-17
Identity = 76/343 (22.16%), Postives = 141/343 (41.11%), Query Frame = 2
Query:  407 HMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNFEQLQ-------KNQIQEMNK------LNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEI-----------LSQKLEEIETKIDIYRQNQDPVQGIRCFL-EEYKNFRLEKEFYENLH---------LNNQIYEFQR--------ILKKENE------------FIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLD 1273
            H+K C +    C F+++G     ++  + +  H  + ++ H   L   I  +  N E LQ        ++IQE+++      L +  +                   + T            LE+           LS++ +E+E K+  +       + I C L  E +      E Y   H         LNN++ + +R        I++ E +            F+W + +F +K   A +G+   ++SP FY+ K G K+ LR+  NG    +  +LS+FF +++G  D ++ WP    V + ++DQ+ R+ HI  +F  + +S      F RP+ D
Sbjct:  205 HIKLCTKFRTPCRFHVVG--CDMSVEKEKIHDHERACSYEHLNLLLHFIMGIKVNLESLQPQSLELASHKIQELHQSLRELELKMGQLSAGAPVQGACAPPPPPPPTLATSFTPLPTTVGAALELQLHSEKTKVAELSRRCQELELKVGTF-------ENIVCVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNRE-HIIDAFRPDISSSS----FQRPVSD 533          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 85.1149 bits (209), Expect = 3.758e-17
Identity = 55/168 (32.74%), Postives = 88/168 (52.38%), Query Frame = 2
Query:  890 QIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSF--NYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNP--FLTIDDKIIFTCLV 1381
            Q    Q+ +  +  F+W + +  QKL  A +GQ  + YSP FY+ + G K+ +RL   G    K  ++S+FF ++KG +DP++SWP K  V   +IDQ+ R+ H+  +F  +  SAS      F RP+ + +  S  G   F  L +  R+P      DD +   C+V
Sbjct:  380 QSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQRE-HVVDAFRPDLRSAS------FQRPVSEMNVAS--GCPLFFPLSK-LRSPKHAYVKDDTLFIKCVV 537          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 4.873e-16
Identity = 42/180 (23.33%), Postives = 86/180 (47.78%), Query Frame = 2
Query:  725 KQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYENLHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRP 1264
            ++ +  L ++L  +E  +     N  P +  RC + E +   +     +      Q+ E         + +W + ++ ++   A SG+  ++YS  FY+   G K+  R   NG    +  +LS+FF +++G++D ++ WP +  V ++++DQ   + H+S +F  + AS      F RP
Sbjct:  210 RRDMATLRERLRALEAALG----NPGPCEE-RCHMHEQR-LTMHDGLLDTAERRLQVLE---TAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGS----FRRP 376          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 1.975e-14
Identity = 31/116 (26.72%), Postives = 62/116 (53.45%), Query Frame = 2
Query:  926 NEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLD 1273
             + +W + ++ ++   A SG+  ++YS  FY+   G ++  R   NG    +  +LS+FF +++G++D ++ WP +  V + ++DQ   +  +S +F  + AS      F RP  D
Sbjct:  325 GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSS----FRRPTSD 436          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 65.855 bits (159), Expect = 1.129e-11
Identity = 46/177 (25.99%), Postives = 83/177 (46.89%), Query Frame = 2
Query:  932 FIWIVENFKQKLDT------AKSGQNEN----IYSPTFYSLKNGCKIQLRL-------MPNGYRN------AKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTR-KVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVSTN 1390
            F W VE F + L        A  G + +    ++S  FY+   G ++ LRL       +P G  +       +  +L++F  LL+G +D  + WP K  ++I+++DQ  R  VH++   +    +D     F RP +  +P  F G  +F++++ +    +L  DD ++  C V T 
Sbjct:  395 FTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMD----ADPQLSAFQRPSVHRNPKGF-GYMNFMDINTLHHRSYLR-DDCLVVRCEVVTT 565          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK7])

HSP 1 Score: 107.071 bits (266), Expect = 2.951e-25
Identity = 100/408 (24.51%), Postives = 174/408 (42.65%), Query Frame = 2
Query:  116 FNDQLKNSLPEEFICKICKTILANAYQ-GPCGCKYCESCINPY--FSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKCL--KKSCDFKDKLCNIETHMKNCDRKFEDCPFYLIGGCIQTN------ISLDTMEHHLTSA---NFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKID--IYRQNQDPVQGIRCFLEEYKNFRLEKEFYENLHLN---NQIYEFQ-RILKKENEFIWIVENFKQKLDTAKSGQNE-NIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDD 1276
            +  +    LPEE+ C IC+    +  Q   CG ++C+SC+            CP  +   ++++  V +D    R +  + VKC   K+ C++  +L NIE H KNC  +   C          TN      +   ++++HL S        C F T  +Y+         K  ++   +L ++ +                        REE          +   + E    +   +YR    P +G R  LEE+    +      + HLN    +I E + R L     F+W + N+K + D A +   E  I+SP FY+ + G K++L+   NG    K  +LS++  ++KG +D ++ WP K  +   +IDQS ++ H +H  +   +    KV+FNRP + +
Sbjct:   12 YEAEFVEPLPEEYECPICQLAFRDPIQIEECGHRFCQSCLQELRRLQGSPVLCPMDRRPISSTK--VFVDKAARRAILGLGVKCWNWKRKCEWTGELSNIEEHAKNCAHEDVHC----------TNPECNEVMPRRSLQYHLVSKCKWRIVSCHFCTE-MYTYKDG-----KTHMKSCKRLPIECVNKCGAK---------------DIPREE----------MPFHMSECPLAVHPCMYRDIGCPFKGRRDALEEHCKNAV------HTHLNIACQKIRENESRSLCTNGIFLWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQSEKQNHRTHLLSPNRSLPNIKVVFNRPTVKE 370          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 94.3597 bits (233), Expect = 1.193e-20
Identity = 102/479 (21.29%), Postives = 183/479 (38.20%), Query Frame = 2
Query:  140 LPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSH----------------------------FCPGTKPECTTSRG-QVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCPFYL---------------------IGGCIQTNISLDTMEHHLTS--------ANFS--HCKF------LTRH-----------IYSLNQNFEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYS-------REEARKTKQGLEILSQ-KLEEIETKI-----------DIYRQNQDPVQGIRCF-----LEEYKNFRLEKEFYENLHLNNQIYEFQRI--LKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVH-ISHSFNYESASDEDKVLFNRP 1264
            L  ++ C +C   L +  Q PCG ++CE C+ P    PS                             +CP  +  C   +  Q + ++  N   K +Q  C    C  K    ++E H++ C+ K  DC + L                        C    I  D + HH T+         +F+   C F      L  H           + +  QN E+ +     +++++  +  K  E+ YE+ +    + + + TY        R  A + ++  E+  + +L+E+E  I           +   +   P  G         LE  ++    +    ++ L     + Q +     +  +IW ++ + ++     SG+  +IYSP FY  + G K   R+ PNG    K  +LS+FF L++G+FD ++ WP +  V   ++DQ   +VH I  +F  +  S      F RP
Sbjct:   15 LDPKYRCPVCGNALKHPVQTPCGHRFCEGCLEPILRGPSKCPVDGEELKIDGVFKDVCCRREILCLACYCPNRQLGCEWMKDLQYLEEHRANCEYKGVQ--CHNPGCQEKVAKRDLEAHLERCEFKPSDCQYCLQRIPAASMEDHLQTCEKHPVVCPHCGAEGICRDELLHHQTNICEQAELPCSFAKHGCHFKGTREALETHFRDQASVHVNLLLTATQNEEKARSEMAAKLSQMEKERAKQQEQMYEQREALAVANQNLRTYQGKLNVIERSVAEQRRELAELKERIQLQEVEAAIREQDRRLGMIENEASRGAAPSSGPGSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQMLEATSYDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQD--RVHDIGDTFRPDPTSSS----FKRP 485          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 92.4337 bits (228), Expect = 5.370e-20
Identity = 48/146 (32.88%), Postives = 82/146 (56.16%), Query Frame = 2
Query:  827 LEEYKNFRLEKEFYENLHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRP 1264
            LE        K F E+L +     + Q+ +  +  F+W ++ F ++   AKSG   +IYS  FY+ + G K+  RL PNG  +A+  YLS+F AL++G++D ++ WP ++ + I +IDQ    ++IS +F+ +  S    + F RP
Sbjct:  352 LESSITIHKTKLFQEDLRI-----QIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDN-GMNISETFDPDPCS----ISFQRP 487          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO31690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX76])

HSP 1 Score: 83.1889 bits (204), Expect = 2.521e-17
Identity = 91/431 (21.11%), Postives = 178/431 (41.30%), Query Frame = 2
Query:  122 DQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHF-CPGTKPECTTSRGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFS--HCKFLTRHIYSLNQNFEQLQKNQIQEMNKLNLDIM----KNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYENLH-----LNNQIYEFQ-RILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLR--LMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIF 1369
            +Q +     E +C IC  ++       CG  +C  C N + +      CP    +  T+  Q + D +  R + ++ VKC+   C +K +L + + H+  C  +   C F    GC  T ++ ++ME H  +  +    C+F        +  + + ++  ++      L I+     ++  T+                   E R+        +     ++      R N   ++      +  K  R   +  E LH      N  I E + ++ K    F+W + ++K             IYSP+FY+ K G K+QL+  L  N +      +LS++  ++ G++D ++ WP +  + + +IDQS ++ H +   N +    + K  F+RP+  ++    YG   F+ L+E+    F  I D ++F
Sbjct:   15 EQFETPPSPELMCGICLMVVNKPVLTYCGHSFCNFCFNKWRNGKDVVTCPVDYKQLETN--QFMADKKTERQVLSLCVKCMNGPCSWKGELRDKKKHLTKCGHEVIKCVF---DGC-DTRLARNSMEKHEETCEWKIVTCEFC-------DVPYPKREEETVKHRGDCPLAILPCKFSDIGCTF-------------------EGRQHAHVAHCENAVQAHLDMACGTIRDNNKEIR------KNNKKIRGNNKEIETLHKELNTANQTIRELKGKMAKLIGTFVWRICDYKDLYG--------EIYSPSFYTSKYGYKVQLKANLRTNPFNGGT--HLSLYACIMVGEYDALLEWPFRRKITLYVIDQSDQRKHETLLINPDDVLPDRKKCFHRPITGNN--VGYGLTRFLSLEELTSGGF--IKDGVMF 393          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 78.9518 bits (193), Expect = 8.959e-16
Identity = 41/146 (28.08%), Postives = 78/146 (53.42%), Query Frame = 2
Query:  926 NEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQ---STRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTID 1354
            ++ IW +E++ +K+  AK+G  + ++SPTF + K+G ++   +  NG    K  ++SVF ++LKG FD ++ WP    V   ++DQ     ++ HI  S      +D +  L  RP L+ +  + +G   F + +E+    ++  D
Sbjct:  302 SQLIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFISVLKGAFDALLKWPFDYRVTFVLLDQNDDPAQRKHIRFSIKPNPCADNEPFL-GRPRLEKN--ASFGGAKFAKHEEIVSRNYIKED 444          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 102.064 bits (253), Expect = 5.817e-23
Identity = 91/409 (22.25%), Postives = 169/409 (41.32%), Query Frame = 2
Query:   92 GVWIIIKQFNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKCLKKS--CDFKDKLCNIETHMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANF--SHCKF---------LTRHIYSLNQNFEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYENLHLNNQIYEFQRILKKE--NEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLD 1273
            G   +   F D    +   ++ C+ C+ +L    Q  CG ++C SCIN   S P+  CP         + ++  D   +R +  ++V C  ++  C  +  L  I  H+  C      CP   +G C +  +  +  EH      +  S C+F         L +H  ++   F     N        +L   + L  ++ E   ++E     +   R+E    +  L+ +  +L  +E             QG R  LE   N   +      + L +    FQ +         IW + ++K++   A +G+  ++YS  FY+   G K+  R+  NG    K  +LS+FF +++G++D ++ WP K  V + ++DQ   + H+  +F  + +S      F RP+ +
Sbjct:   26 GFLPVRGGFRDHFVEAPEAKYCCEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPADME--PLFKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVCPFFEVPCP---LGKCKERMMRKEIPEHLAWKCKYRESTCEFCKNKMPLTELQKHKETVCPAFPVSCPNHC---TSSSLPRSEKLMSSHTEKLLELELELRSLRQLRDEMESLRGTLDTVRTRLSALE-------------QGGRASLETQLNRHDDMLSVHEIRLADMDLRFQVLETASYNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSS----FRRPVAE 409          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 86.6557 bits (213), Expect = 1.044e-17
Identity = 77/341 (22.58%), Postives = 153/341 (44.87%), Query Frame = 2
Query:  407 HMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQI----QEMNKLNLDI------MKNLEKTYXXXXXXXXXXXXVITYS------------REEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFL-EEYKNFRLEKEFYENLH---------LNNQIYEFQR--------ILKKENE------------FIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLD 1273
            H+K C +    C F+++G    T++  + +  H    ++ H   L   I  +  + E LQ  ++    Q++++L+  +      M  L ++     + + +  L  +++            + ++ KTK  +  LS++ +E+E K+  +       + I C L  E +      E Y   H         L+N++ + +R        I++ E +            FIW + +F +K   A +G+   ++SP FY+ K G K+ LR+  NG    +  +LS+FF +++G  D ++ WP    V + ++DQ+ R+ HI  +F  + +S      F RP+ D
Sbjct:  206 HIKFCSKFKAPCRFHVVG--CDTSVEKEKIHDHERQCSYEHLNLLLHFIMGIKVSLESLQPQRLEVASQKLHELHQSLRDLELRMSQLGRSGTAPLQGVCAATLATSFTPLHSAMGAALELQLQSEKTK--VAELSRRCQELELKVSTF-------ENIVCILNRELERSCATMEAYNRQHRLDQDKIEILSNKVRQLERTVSLRDLSIVEMEGKMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNRE-HIIDAFRPDISSSS----FQRPVSD 530          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000001369.2 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:101170323])

HSP 1 Score: 84.3445 bits (207), Expect = 6.834e-17
Identity = 85/402 (21.14%), Postives = 165/402 (41.04%), Query Frame = 2
Query:  263 CPGTK---PECTTSRGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNKLNLD--IMKNLEKTYXXXXXXXXXXXXVI-----TYSREEARKTKQGLEI------LSQKLEEI---ETKIDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYENLH-----LNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELD--EVFRNPFLTIDDKIIFTCLVSTN 1390
            CP  +   P C       VI   +  +   ++V C    C        +  H ++C     DC F + G  ++       ++ H  +A   H   + +    L Q    +QK  +    ++  D  ++ +L++    + ++  S E ++     T SR+E   +   L++      +   L+E+   +T +D   Q     + +R  +   +  R        LH     LN Q  +   +   +   IW +++F+++ +   +GQ+  + S  F++ + G K+ ++   NG    +  +LS++  L+ G FD ++ WP K  V ++++DQS  + H   SFN+    D     F++P  + +     G   FI LD  E   N     DD +     V T 
Sbjct:  186 CPHRRESCPHCLQPFQLSVIQDHVQSSCPEVKVGC-PDGCSTLVPRNRLTEHGESCPEVHTDCSFKMFGCSVKGK--RRKVKLHEEAAVCHHVLLVLKSSAHLEQQVVFVQKEALLRQQEVQTDTLLLSDLQEQLGSVLQQSRSQEHIVATAQRTLSRQEDALSSVQLDLQQVSCGMGSGLDELRRFKTSLDGVMQELLAAETLREHIATLEENRKRHSGLLELHVAQLALNKQHLQELELTSYDGRLIWKIKDFQKRREAEATGQHPCLSSVPFHTGRCGYKMAMKAYLNGDGEGRGTHLSLYVVLMPGDFDALLPWPFKQTVSLSVLDQSGARNH--QSFNFR--PDPTNTCFHQPAAESASNVAVGFPCFISLDALEAPGNAVYVKDDTLFVKVKVDTT 580          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 83.5741 bits (205), Expect = 9.722e-17
Identity = 84/348 (24.14%), Postives = 150/348 (43.10%), Query Frame = 2
Query:  407 HMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQN-FEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKN-FRLEKEFYENLHLNNQIYEFQRILK------KENE--------------FIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVF-RNPFLTIDDKIIFTCLV 1381
            H K+C +    CPF  +G   ++ +    +  H  S+   H + L   + S+ +   +     + QE + L L         Y    +   +   V +               L +K+  +E  + +  +    V+     LE + +  RL++E  ENL  +N+I + +R L        E E              F+W + +F  +   A SG+   ++SP FYS K G K+ LRL  NG    +  +LS+FF +++ K+D ++ WP    V + ++DQ+ R+ HI  +F  +  S      F RP+ + +  S  G   F  L ++  ++P+L  DD I    +V
Sbjct:  208 HAKSCAKSKSACPFSEVG--CKSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGL---------YRAPDDGCGAAASVPSVD-------------LDKKVSALENIVCVLNRE---VERSSLTLEAFSHQHRLDQEKIENL--SNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNRE-HIIDAFRPDITSTS----FQRPVSEMNIAS--GCPLFCPLAKLAGKSPYLR-DDTIFIKAIV 518          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 83.5741 bits (205), Expect = 1.099e-16
Identity = 84/348 (24.14%), Postives = 150/348 (43.10%), Query Frame = 2
Query:  407 HMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQN-FEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKN-FRLEKEFYENLHLNNQIYEFQRILK------KENE--------------FIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVF-RNPFLTIDDKIIFTCLV 1381
            H K+C +    CPF  +G   ++ +    +  H  S+   H + L   + S+ +   +     + QE + L L         Y    +   +   V +               L +K+  +E  + +  +    V+     LE + +  RL++E  ENL  +N+I + +R L        E E              F+W + +F  +   A SG+   ++SP FYS K G K+ LRL  NG    +  +LS+FF +++ K+D ++ WP    V + ++DQ+ R+ HI  +F  +  S      F RP+ + +  S  G   F  L ++  ++P+L  DD I    +V
Sbjct:  201 HAKSCAKSKSACPFSEVG--CKSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGL---------YRAPDDGCGAAASVPSVD-------------LDKKVSALENIVCVLNRE---VERSSLTLEAFSHQHRLDQEKIENL--SNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNRE-HIIDAFRPDITSTS----FQRPVSEMNIAS--GCPLFCPLAKLAGKSPYLR-DDTIFIKAIV 511          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000053469.1 (SMESG000053469.1)

HSP 1 Score: 867.84 bits (2241), Expect = 0.000e+0
Identity = 433/447 (96.87%), Postives = 439/447 (98.21%), Query Frame = 2
Query:   50 MSIINLKCERSETEGVWIIIKQFNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYENLHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVSTN 1390
            MSIINLKCERSETEGVWIIIKQFNDQLKNSLPEEFICKICKTILANAYQG CGCKYCE+CINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCN+ETHMKNCDRKFEDCPFYLIGGC QTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNK+ LDIMKNLEKTYEEIKEKI+ LEL  TYSREEAR+TKQGLEILSQKLEEIETK DIYRQNQDPVQGIRCFLEEYKNFRLEKEFYE+LHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYS KNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVSTN
Sbjct:    1 MSIINLKCERSETEGVWIIIKQFNDQLKNSLPEEFICKICKTILANAYQGTCGCKYCETCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNMETHMKNCDRKFEDCPFYLIGGCKQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNKMKLDIMKNLEKTYEEIKEKIKRLELAKTYSREEARETKQGLEILSQKLEEIETKNDIYRQNQDPVQGIRCFLEEYKNFRLEKEFYEDLHLNNQIYEFQRILKKENEFIWIVENFKQKLDTAKSGQNENIYSPTFYSRKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVSTN 447          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000014923.1 (SMESG000014923.1)

HSP 1 Score: 227.254 bits (578), Expect = 9.818e-69
Identity = 148/442 (33.48%), Postives = 233/442 (52.71%), Query Frame = 2
Query:   89 EGVWIIIKQFNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTS----RGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLE----EYKNFRLEKEFYENLHLNNQIYEFQRILKKEN--EFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVS 1384
            E +W I+ ++       +  + IC ICK +L NA  GPCGC+YC  CI  Y  Q   FCP    EC          +++D   N  +  I VKC + SC+F D+L  I  H+  CD+K   CP++ IG C +  ++ + +  HL   N++H K L   I +L +N   L K   +E+ K+  +  K     Y+   +  E     I  S E     K  L+    KLE++  ++D+ +QN    Q I   LE    +YK+   ++ F E LH   +  E + +  K++     W ++NF +K   A+SG   +IYS  FYS KNG K+ L+L P+G++  K   LSVFF +++G+ D ++ WP+K  V I II+Q +  +H S+ FNY+   D+ + LF++P  D   I+    YDFI+LDE+ +N  L  +D+I+  C+V+
Sbjct:    7 ENIWRILSEYRVNSMTEISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEELLNIDRNILLDNAANSRISRIIVKCPEPSCEFHDELRKIGDHINACDKKIVKCPYFDIG-CSEGKVASERINDHLIVDNYTHAKTLVNCIQNL-KNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQKSDENIH-LKLKLQQTEHKLEDLRHQLDM-KQNATENQMIELLLENEKLKYKSDENQR-FSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSHKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTD---INVGYGYDFIKLDELIKNNKLLKNDRIVLKCVVA 440          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000067216.1 (SMESG000067216.1)

HSP 1 Score: 191.43 bits (485), Expect = 5.702e-55
Identity = 138/467 (29.55%), Postives = 224/467 (47.97%), Query Frame = 2
Query:   89 EGVWIIIKQFNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTS----RGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFSHCKFLTRHI-------YSLNQNFEQLQKNQIQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEI---------LSQKLEEIETKIDIYRQNQDP--------VQGIRCFLEEYKNF--RLEKEFYENL-HLNNQIYEFQRILKKEN--EFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVSTN 1390
            E +W  +K+        +  E  C ICK+I+ NA+ GPCGC YC  CI  Y S+   FCPG   EC          +V+D   N ++  + VKC  K+C FKD+L  IE H++ C+ K E CP++ I GC ++ IS + +  H+     +H K L   I        SL +  E+LQ  + Q   ++ L ++  + K     + K    E V  ++       K+   +          ++   E   ++     ++ P        V G +C  E +  F  +  K    ++ +L +QI + +  L+KEN  EF+WI+EN+ +K   AK G   + +S  F++ K G K+ LR+ P G    K  +LSVFF ++ G+FD  + WP K ++   + DQ +   H+  S +YES  +     + +P  D +     G   FIE+ E+F N  L+ D+K+   C V+ N
Sbjct:    2 ESLWETMKKMAFVSCQPVNHELTCLICKSIVINAHSGPCGCLYCFECIVTYLSKGIRFCPGNTEECQVKTLNINEDIVVDRSSNVSVSKLVVKCPNKNCSFKDELRQIENHLRICNMKCEKCPYFEI-GCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEAANRVKGKSNSEQPMKDKSSNEVTGAQC--EGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSS--YRKPTSDKNI--GIGIPKFIEIKELFSNINLSSDNKLFIRCSVNIN 461          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025794.1 (SMESG000025794.1)

HSP 1 Score: 188.348 bits (477), Expect = 6.504e-54
Identity = 132/474 (27.85%), Postives = 227/474 (47.89%), Query Frame = 2
Query:   80 SETEGVWIIIKQFNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTS----RGQVVIDYELNRNLKNIQVKCLKKSCDFKDKLCNIETHMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQ----------IQEMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQDPVQGIRCFLEEYKNFRLEK-------EFYENLHLNNQIYEFQRILKKE-------------NEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSF---NYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVSTN 1390
            S+ E VW I++ +N +    +  + +C +CK +L NA   PCGC++C +CI+ +       CPG   EC          + +DY +N  +  +QVKC + SC + D+L  +E H + C  +   CP+  IG C + NIS D +  HL S  F+H K L   + + N   E L+ N             E+N+L LD                     +    R+ A + ++ +E+L+   E+I    ++ R   D + G++  +E  +   ++K       +  +   ++N+I +    + ++              EF+W ++ F  K+  AK+G N  IYS +F + KNG K+ LR+ P+G    K  +LSVFF L+KG+FD ++ WP + +V   +I+Q TR  H+S +    NY +    DK L  +P   ++ + F     F+  +E+  NP L  +++I   C V  +
Sbjct:    4 SKLENVWQIMRDYNYESVTEIQNDMLCFLCKKLLVNARCAPCGCRFCFTCISDFLDHKEKICPGDTEECKQEMLHLNENICVDYPMNIKISKLQVKCKEMSCVYVDELRKMEDHSRTCKYRSVACPYSNIG-CDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLD--------------GERRRVEIADLQRKCADQAEE-IELLN---EDIPALRNVDRNVSDRLDGLQLIIEGNQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFMWKLDKFTDKMADAKNGINTRIYSESFLTHKNGFKMCLRVDPDGNGGGKGTHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSKTVKCANYPN----DKALI-QPTDRNAGLGF---PKFVSHEELSSNPDLMRNNQIFIKCSVDID 450          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000067336.1 (SMESG000067336.1)

HSP 1 Score: 186.037 bits (471), Expect = 9.215e-53
Identity = 138/485 (28.45%), Postives = 236/485 (48.66%), Query Frame = 2
Query:   89 EGVWIIIKQFNDQLKNSLPEEFICKICKTILANAYQGPCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQVKCL-----KKSCDFKDKLCNIETHMKNCDRKFEDCPFYLIGGCIQTNISLDTMEHHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQ-----EMNKLNLDIMKNLEKTYXXXXXXXXXXXXVITYSREEARKTKQGLEILSQKLEEIETKID------------------IYRQNQDPVQGI--RCFLEEYKNFRLEKEF------YENLHLNN----------------QIYEFQRILKKE--NEFIWIVENFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSVFFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKVLFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLV 1381
            E +W I+K+ N Q+   + +EF C IC+ ++  A  GPCGC+YC  C   Y +     CP +K  C  S   +  + EL+R + N+ + CL     K  C FKD L  +E H K C+ +  +CPF  + GC      L+ +E HL   N+ H K L   I +++   E L++  I+     ++ K  L I+K    + +    ++++   +    R+E    KQ +  L +K + ++T+ID                   Y ++ D  + +  R    +YK+  + K +      ++NLH  +                ++ E +   KK   NEF+W +EN+K K+  AKSG    ++S  FY  +NG K+ LR+ PNG  + +  ++S+FF L+KG +D  + WP +++V ++I + STR  + S +  +    D+  V + RP+ D S     G   FI L E+ ++  L  +D+I+  C V
Sbjct:    7 EEIWRIMKENNFQVYQQIADEFKCSICRKLMVKACNGPCGCRYCWECARSYLNGEERPCPNSKKFCKDSLLNIHQNIELDRAV-NVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDV-GCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEF---KQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHVSLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFN--DDKQSVAYERPVHDTSACG-RGYPQFISLSELIKHSDLIQNDRILIKCKV 483          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF34.102e-2121.84TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF22.349e-1524.75TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF32.890e-1519.85TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.890e-1519.85TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF68.932e-1529.68TNF receptor associated factor 6 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trf-11.211e-1129.73TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf41.235e-822.76gene:FBgn0026319 transcript:FBtr0334401[more]
Traf41.780e-822.76gene:FBgn0026319 transcript:FBtr0077429[more]
Traf-like1.596e-725.76gene:FBgn0030748 transcript:FBtr0074275[more]
Traf-like2.241e-725.76gene:FBgn0030748 transcript:FBtr0074273[more]
Traf-like4.623e-725.76gene:FBgn0030748 transcript:FBtr0308606[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unm_sa8081.310e-1721.77un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21... [more]
traf2b3.254e-1728.87Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b3.254e-1728.87Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b3.991e-1728.87Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf14.884e-1728.63TNF receptor-associated factor 1 [Source:ZFIN;Acc:... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh29.464e-1621.01slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
egf1.464e-1420.35epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
sytl22.130e-1428.65synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
slc12a16.036e-1431.86solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a17.882e-1431.86solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf21.009e-1819.64TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf36.436e-1720.07TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf36.436e-1720.07TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf27.162e-1721.47TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf67.529e-1528.39TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39429|TRAF2_MOUSE7.058e-1819.64TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|A7XUJ6|TRAF6_PIG9.273e-1529.68TNF receptor-associated factor 6 OS=Sus scrofa OX=... [more]
sp|Q3ZCC3|TRAF6_BOVIN1.140e-1429.68TNF receptor-associated factor 6 OS=Bos taurus OX=... [more]
sp|B6CJY4|TRAF6_CERAT1.218e-1430.32TNF receptor-associated factor 6 OS=Cercocebus aty... [more]
sp|B6CJY5|TRAF6_MACMU1.273e-1430.32TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|230705402.839e-2622.69tr|T1E101|T1E101_9PLAT TRAF-6 OS=Dendrocoelum lact... [more]
gnl|BL_ORD_ID|1673339433.705e-2524.25tr|A0A3L7HD98|A0A3L7HD98_CRIGR TNF receptor-associ... [more]
gnl|BL_ORD_ID|203470351.232e-2329.51tr|I1ZID8|I1ZID8_SCHMD TNF receptor associated fac... [more]
gnl|BL_ORD_ID|1740638531.533e-2122.54tr|A0A0P7UP01|A0A0P7UP01_SCLFO TNF receptor-associ... [more]
gnl|BL_ORD_ID|240923363.329e-2124.27tr|A0A3M6TI16|A0A3M6TI16_9CNID Uncharacterized pro... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf13.271e-2121.43TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf67.593e-2122.96TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf56.422e-1823.85TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf2a3.099e-1722.16TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf13.758e-1732.74TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002130.14.873e-1623.33pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.11.975e-1426.72pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
traf61.129e-1125.99TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495452.951e-2524.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494641.193e-2021.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352375.370e-2032.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316902.521e-1721.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328518.959e-1628.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf35.817e-2322.25TNF receptor associated factor 3 [Source:NCBI gene... [more]
ENSORLT00000020861.21.044e-1722.58TNF receptor-associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000001369.26.834e-1721.14TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf2b9.722e-1724.14TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b1.099e-1624.14TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053469.10.000e+096.87SMESG000053469.1[more]
SMESG000014923.19.818e-6933.48SMESG000014923.1[more]
SMESG000067216.15.702e-5529.55SMESG000067216.1[more]
SMESG000025794.16.504e-5427.85SMESG000025794.1[more]
SMESG000067336.19.215e-5328.45SMESG000067336.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007084 ID=SMED30007084|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1511bp
AAAAGATAGTGCAATATTGATTTTACACTTAATATAATTTCAGTTTATCA
TGTCTATAATAAATTTGAAATGTGAAAGATCAGAAACGGAAGGAGTTTGG
ATAATTATTAAACAATTCAACGATCAACTAAAAAATTCTCTTCCAGAGGA
ATTCATTTGTAAAATTTGCAAAACAATACTAGCCAATGCTTATCAAGGTC
CTTGTGGATGCAAATATTGCGAAAGTTGTATCAATCCGTATTTCTCACAA
CCGTCACATTTTTGCCCCGGCACGAAACCTGAATGTACAACCAGCCGGGG
CCAGGTTGTGATAGATTACGAATTAAACAGAAATTTGAAAAACATTCAAG
TTAAATGTTTAAAAAAATCCTGTGATTTCAAAGACAAATTGTGTAATATC
GAAACCCACATGAAAAATTGTGATCGGAAATTTGAAGATTGCCCATTTTA
CCTGATAGGAGGATGTATACAAACTAATATTTCCTTAGATACTATGGAAC
ATCACCTTACTAGTGCCAATTTTAGCCATTGTAAATTTTTGACTAGACAT
ATATATAGTTTGAATCAGAACTTCGAACAGCTTCAAAAGAATCAAATTCA
GGAAATGAATAAACTGAATTTAGATATCATGAAGAATCTTGAAAAAACCT
ATGAAGAAATAAAAGAGAAAATTGAGAGCCTTGAACTTGTAATAACTTAC
AGCAGAGAAGAAGCAAGGAAAACAAAACAGGGATTGGAAATCCTTTCCCA
AAAATTGGAAGAAATTGAAACCAAAATCGATATTTACCGACAAAATCAAG
ACCCTGTCCAGGGAATTCGGTGTTTTTTGGAAGAATACAAGAACTTTAGA
TTGGAAAAGGAGTTTTATGAAAACTTGCACTTAAATAACCAAATCTATGA
GTTTCAGAGAATATTAAAGAAAGAGAACGAATTTATTTGGATTGTCGAAA
ATTTCAAACAAAAATTAGATACGGCTAAATCGGGACAAAATGAAAATATT
TACAGTCCAACGTTTTATTCGCTGAAAAATGGTTGTAAAATCCAATTAAG
ATTGATGCCGAATGGATATCGCAACGCTAAATCGAAATATTTATCGGTTT
TCTTCGCTTTATTGAAGGGAAAATTCGACCCCATGATTAGCTGGCCCATT
AAAGATAATGTTAAAATAAATATAATTGATCAGAGTACCCGCAAAGTTCA
CATTTCACATTCTTTTAATTATGAATCGGCTTCAGATGAGGATAAAGTAT
TATTCAACCGACCTCTGTTGGATGACTCCCCAATTAGTTTTTACGGGAAA
TATGACTTCATCGAACTTGATGAAGTATTTAGGAATCCATTTCTTACAAT
AGATGATAAAATTATTTTTACATGTTTAGTAAGTACAAATTAAACATTTT
AAAAGACTTTTGGTGATATTTTACACAATTTTCATTCATGAGATATTTCA
GTTTTATAAGAAACTTTTATCAATATTTTTCATGATTCTTTTCGTACTAA
TGAAAACTGAG
back to top

protein sequence of SMED30007084-orf-1

>SMED30007084-orf-1 ID=SMED30007084-orf-1|Name=SMED30007084-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=448bp
MSIINLKCERSETEGVWIIIKQFNDQLKNSLPEEFICKICKTILANAYQG
PCGCKYCESCINPYFSQPSHFCPGTKPECTTSRGQVVIDYELNRNLKNIQ
VKCLKKSCDFKDKLCNIETHMKNCDRKFEDCPFYLIGGCIQTNISLDTME
HHLTSANFSHCKFLTRHIYSLNQNFEQLQKNQIQEMNKLNLDIMKNLEKT
YEEIKEKIESLELVITYSREEARKTKQGLEILSQKLEEIETKIDIYRQNQ
DPVQGIRCFLEEYKNFRLEKEFYENLHLNNQIYEFQRILKKENEFIWIVE
NFKQKLDTAKSGQNENIYSPTFYSLKNGCKIQLRLMPNGYRNAKSKYLSV
FFALLKGKFDPMISWPIKDNVKINIIDQSTRKVHISHSFNYESASDEDKV
LFNRPLLDDSPISFYGKYDFIELDEVFRNPFLTIDDKIIFTCLVSTN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000096ventral epidermis
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR002083MATH/TRAF_dom
IPR008974TRAF-like
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 187..249
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 29..407
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 29..98
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 297..407
e-value: 3.2E-4
score: 30.0
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 292..444
score: 17.45
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 19..132
e-value: 1.4E-13
score: 52.8
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 265..447
e-value: 2.6E-37
score: 130.1
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 293..444
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 29..407