Fibrillin-2

Overview
NameFibrillin-2
Smed IDSMED30007075
Length (bp)3338
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007075

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30007075SMESG000081571.1 SMESG000081561.1 SMESG000081557.1 SMESG000081553.1 dd_Smed_v4_10142_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007075SMESG000081571.1 SMESG000081561.1 SMESG000081557.1 SMESG000081553.1 dd_Smed_v4_10142_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007075SMESG000081553.1 Contig35549newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007075SMESG000081553.1 Contig35549uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007075SMESG000081553.1 Contig34633newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007075SMESG000081553.1 Contig34633uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
body wall musculatureSMED30007075SMESG000081571.1 SMESG000081561.1 SMESG000081557.1 SMESG000081553.1 dd_Smed_v4_10142_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007075SMESG000081571.1 SMESG000081561.1 SMESG000081557.1 SMESG000081553.1 dd_Smed_v4_10142_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fibrillin-2 vs. Ensembl Human
Match: FBN3 (fibrillin 3 [Source:HGNC Symbol;Acc:HGNC:18794])

HSP 1 Score: 157.147 bits (396), Expect = 6.481e-38
Identity = 236/961 (24.56%), Postives = 351/961 (36.52%), Query Frame = 1
Query:  148 CCSGWIKNVYG--DCVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQ-YRRDQC--QLYGSSCGIFGKCVPTSDGQYT---CICIKP--YSVSFNGKSCIKKTNYNVCNYFKKLC---LPYGECQP---YGLSYYCS---------------------CPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEE------PDNSY---CLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICD-------LHREKCKT-GICY--PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CC GW +   G   CV   C   CG G C   N+C C D T+   +C  +    C+ +C N G C+   C+C+ GY G  C   I                                    C+ ++    C+     L  +K  CC+    AWG PC  C    + C +GF        C D+DECQ    +C  G C+N  GSF C+CP  H L +++ +C+ YR   C   L+G      G+C     G YT   C C +   ++     + C  + +    N F++LC   LP     P    GL  + S                      PS    + +  +  +N   DIC+       C  G C+     YRC CN    GY  D   VR    E +    C+ S     C  G CV++   Y+C+C  GF AT  R+ C+ ++    +C ++   C  GRC   + + ++C C  GF  S +G++C+       ST         C  GVC       + C C  G+  +    YC+      D CQ   I   C  G C +   S+RC C G      +G              R+C      S C G                   A E G         VT+       PD+ +   C L           C    +  F+ LC  G    +DGR      +++C  +  +C  G CE    S +RCVC         G  C          T   +  +N L C +G C N      C C PG+   +D + C  +++  S   ++ +             +Y C+C  G     +G  C+ S        I++S C+       L  E C T G  +  P  + +   AC  G+ + T        D  +C      C  G C +    + C C     +  +GR C+
Sbjct:   68 CCPGW-RTFPGRSQCVVPICRRACGEGFCSQPNLCTCADGTL-APSCGVSRGSGCSVSCMNGGTCRGASCLCQKGYTGTVCGQPICDRGCHNGGRCIGPNRCACVYGFMGPQCERDYRTGPCFGQVGPEGCQHQLTGLVCTKALCCATVGRAWGLPCELCPAQPHPCRRGFIPNIHTGACQDVDECQAVPGLCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFG------GRCAGDLAGHYTRRQCCCDRGRCWAAGPVPELCPPRGS----NEFQQLCAQRLPLLPGHPGLFPGLLGFGSNGMGPPLGPARLNPHGSDARGIPSLGPGNSNIGTATLNQTIDICR--HFTNLCLNGRCLPTPSSYRCECN---VGYTQD---VR---GECIDVDECTSSP----CHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVD----ECIVSGGLCHLGRCVNTEGS-FQCVCNAGFELSPDGKNCVDHNECATST--------MCVNGVCL-NEDGSFSCLCKPGFLLAPGGHYCMD----IDECQTPGI---CVNGHCTNTEGSFRCQCLGGLAVGTDG--------------RVCVDTHVRSTCYG-------------------AIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQL-----------CPAKDSAEFQALCSSGLGITTDGRD-----INECALDPEVCANGVCENLRGS-YRCVCNLGYEAGASGKDC----------TDVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSPCVSGVCRNLA-------GSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFARMT---GVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCV 910          

HSP 2 Score: 129.413 bits (324), Expect = 2.036e-29
Identity = 219/954 (22.96%), Postives = 344/954 (36.06%), Query Frame = 1
Query:  310 NNCSNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKI----DRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELD----NNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLC-------SKWEYYSLCQGG--------ECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCL----LQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNN--ENICT-----------------PGR--------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRC--KGGYCYDIVDGYLCIC-VGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHEC 2913
            N C++   C NG CI   G +             G  C       C+++     D G+  S    + +++  CC     AWGNPC  C        R  CP G   + NR     +DIDECQ    +C  G+C+N  GSF+C+CPP ++L E+T  C+   D+C  +   CG  G C  T  G YTC+C   Y     G +C+         ++   C    E         C C     Q+ ++         + C +P   +             Y+ LC  +  G+  D       T +PL    C   E  ++C  G C++    + C+C  GF        C  ++    +C   +  CQ    Q  D      +Y C+C RG+  S  G +C+     R   ++C         G C       Y+C C  G+  S D+  C+      D C  Q     C  G C +   SY C+C   ++ ++NG +CV + +      ++C       +   ++ LCQ G         CVDTN              +N     R       +  + +C+      E  + C+ G C  +    F+CLC PGF  + +G  C       C        C+                 PG         C + G++ F+ +CP+       GH  +     +      C    N   C +G CVN     RC C  GY     G  C   ++ S      Q  C            +EC C +G+       +C   +   +   +C     +C         +  Y+C C  GY    D   C  +D  +CA  +  C  +G  C +++  + C+C  G   +  +G  C          D +E   Q              + C  G+CV     ++C C   F+ +    EC
Sbjct: 1447 NECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICE-DIDECSTHSGICGP-GTCYNTL-GNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTC--QNELAFNVTRKMCCCSYNIGQAWNRPC-------EACPTPISPD-------------YQILCGNQAPGFLTDIH-----TGKPLDIDECG--EIPAICANGICINQIGSFRCECPAGFNYNSILLACEDVD----ECGSRESPCQ----QNADCINIPGSYRCKCTRGYKLSPGG-ACVGRNECREIPNVC-------SHGDCMDTE-GSYMCLCHRGFQASADQTLCMD----IDECDRQP----CGNGTCKNIIGSYNCLCFPGFVVTHNG-DCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGTCT-NSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPF-------GHGAVPGPDDSREDVNEC--AENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCGQGTCTNVI------GGFECACADGFEPGLM-MTCEDIDECSLNPLLCAF---RCHNT------EGSYLCTCPAGYTLREDGAMCRDVD--ECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGC---------TDDNECHAQP-------------DLCVNGRCVNTAGSFRCDCDEGFQPSPTLTEC 2292          

HSP 3 Score: 116.701 bits (291), Expect = 1.622e-25
Identity = 225/978 (23.01%), Postives = 352/978 (35.99%), Query Frame = 1
Query:  319 SNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKG-------FTQKENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPT------------------------------------------SDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCR---GG---SCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYS----QSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLIN-----YVTTEPTTK-----YCDILVNRLR----CASGNCVNDRCICGPGYKSSE-----DGKECYKIEKVSSIXXXXXXXXXXXXXXXXDD-----NNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDI----VDGYLCICVGNYTVTENGRDCIL---------KIIAVKSVD--ISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTN 2895
            S  G C NG+C+  +G F             G  C    +  C+++ D   C  T          CCSI  V WG  C  C         + CP+G       F        D++EC+ F  +C +G C N  GSF C C     LD    +C    D+C++    CG  G CV T                                          +DG Y C C   + ++  G +C    + + C+    LC P+G+C     ++ CSC +GF  + D++ C+     DI         CR   GG    C++    YRC C   Y    + + C      E          E   +C+ G C ++   + C C +GF AT + R C+ ++    +C LN   C  G C+     ++ C C  G++  +    C   +        CE+ GH C +       P  + C CL G+     +  D   C+         Q    S R   G C++   SYRC C   +  + +G  C    +            E   LC  G+C++    Y C+C  G+  TE+ R C  +++                 + C  G C       F+C+C  G+     G +C    +++C +  N C  G C  +  S + C CP    L+  G  C+       ++ T            +I V   R    C+ G    + C   P   ++E      G E ++  +++ I        +  G  +  D      +++C+C  GY  SE+ R C   +        C  H   C  G CY    N Y C C   Y Q     +C+ M    C    +R   G C +     V   +C C  N     N R C           +I+        ++++    P     C   EI   C  G C+ +   ++C+CP  F  N
Sbjct:  875 SFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAV-WGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCT-DIDECRISPDLCGQ-GTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTAC---EDIDECSLSDGLC-PHGQCVNVIGAFQCSCHAGFQSTPDRQGCV-----DI-------NECRVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDECE----------ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVD----ECDLNPHICLHGDCENT-KGSFVCHCQLGYMVRKGATGCSDVDE-------CEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVS--------QEHRCSPR---GDCLNVPGSYRCTCRQGF--AGDGFFCEDRDECA----------ENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQG-------------NLCAFGSCENLPGM-FRCICNGGYELDRGGGNC--TDINECADPVN-CINGVCINTPGS-YLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDE-------CSTHSGICGPGTCYNTLGN-YTCVCPAEYLQVNGGNNCMDMRKSVC----FRHYNGTCQNELAFNVTRKMCCCSYNIGQAWN-RPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDEC--GEIPAICANGICINQIGSFRCECPAGFNYN 1755          

HSP 4 Score: 108.612 bits (270), Expect = 4.332e-23
Identity = 238/1052 (22.62%), Postives = 366/1052 (34.79%), Query Frame = 1
Query:  340 NGKCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQV--AWGNPCVFCDRNYCP----------KGFTQ--KENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGY--NNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIE---TITSQCALNQ---------------FQCQGGRCQELDN-----------------NNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK--------------------NEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYL--SRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCE-RSGNSNFRCVCPY-YASLSKDGHSCLI-NYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKK---------------SICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFC--TRKEIIEKCQPG-------------------------KCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC--PY-CFYGCFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTCRTKSLNRTLN 3105
            N  C+C + Y     G +C     S C+   + G C++      ++++ CC  + +  AW  PC  C     P           GF       +  DIDEC +  +IC NG CIN+ GSFRC+CP     +   ++C+   D+C    S C     C+    G Y C C + Y +S  G +C+ +   N C     +C  +G+C     SY C C  GF  S D+  C+     D        + C  G+C +    Y CLC   + G+   ++ +CV +     LV +         +C  G C++    ++C C +GF  T + + C+      ++   C                   FQ Q   C ++D                   +++C C  GF+ S+NG  C     TR S         +C     +        C+   G    +  + C +                    ++  +D  +  E    C  G CV+   S+RC C   Y     G  CV   +        C +    ++  G EC                A  +G +   +   +T E D   C L   L   RC       +    + C C  G+T   DG  C    VD+C + +  C     E ++    F CVCP     L   G  C   N    +P     D+ VN      G CVN     RC C  G++ S    EC+ I +      + Q  C+            EC C  G         C    ++  +K                 C +    C  G C       + C C  GY       +C+ MD  +C+     C    C +    +LC C   Y + E+GR C          D+ E + +    Q  C  T      +C PG                          C      ++C+C   F      H C  D N+C  P+ C +GC ++     CSC + +        C+   DE   +L   TC + S   TL 
Sbjct: 1627 NYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYN-GTCQNE-LAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSILLACE-DVDECGSRESPCQQNADCI-NIPGSYRCKCTRGYKLS-PGGACVGR---NECREIPNVC-SHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECD-------RQPCGNGTCKNIIGSYNCLC---FPGFVVTHNGDCVDFDECTTLVGQ---------VCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFD---TRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECS--VGHPCGQGTCTNVIGGFEC----------------ACADGFEPGLM---MTCE-DIDECSLNPLLCAFRCH------NTEGSYLCTCPAGYTLREDGAMC--RDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQP-----DLCVN------GRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRDVDECRMLAHLCAHGECI-NSLGSFRCHCQAGYTPDATATTCLDMD--ECSQVPKPCTF-LCKNTKGSFLCSCPRGYLLEEDGRTC---------KDLDECTSRQHNCQFLCVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGC-EDVNECDGPHRCQHGCQNQLGGYRCSCPQGFTQHSQWAQCV---DENECALSPPTCGSASCRNTLG 2589          

HSP 5 Score: 104.375 bits (259), Expect = 1.026e-21
Identity = 201/841 (23.90%), Postives = 313/841 (37.22%), Query Frame = 1
Query:  535 CPKGFT--QKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC----------QYRRDQCQLYGSSCGIFGKCVPTSDGQYTCIC----IKPY-SVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYR---CLCN-GEYQGYN----NDQECVRYGTSEP----LVSR-YCSKSEYY----------SLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENG----RSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGG---ECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            CP GF   Q    C D+DEC   S C++G C N  GS+ C+C P   LD +   C          + +  +C++      +  +C  T    +   C    I P  +  F   + +   + N C  F  +C P G C     S+ C CP G       + C+     D+   P           V+    YR   C C+ G   G       D E + + +  P      SR + S   +Y           LC  G+C +    ++C C+ GF      R C  I+    +C ++   C  G C     + +EC+C  G+   E+G    ++C+  +       +C       + G C       Y C C  G+  +     C    +  D C   +    C  GQCV+   +++C CH  + S+ + Q CV   +                +  GG    C++T  +Y C CG GY    +GR C+ +++             +E    C  G C  +   G +CLC  GF +  D R+C    VD+C  N +IC  G CE +  S F C C     + K    C  +    E     CD   + L        +  C C PG+    DG EC+ +++  S       +            +Y C C  G+  + +G  C   +       +CD        G C       Y C C +G+    D ++C  +D  +CA     C  G C ++   + CIC G Y +   G +C          DI+E +  +P +            C  G C+     Y C CP  F+ N     CV
Sbjct:  751 CPPGFHFWQDTEICKDVDEC-LSSPCVSGVCRNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFARMTGVTCDDVNECESFPGVC-PNGRCVNTAGSFRCECPEGLMLDASGRLCV-----DVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDID----ECRISPDLCGQGTCVNTPGS-FECECFPGY---ESGFMLMKNCMDVDECARDPLLC-------RGGTCTNTD-GSYKCQCPPGHELTAKGTAC----EDIDECSLSD--GLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECR--------------VQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDE------------CEENPRVCDQGHCT-NMPGGHRCLCYDGFMATPDMRTC--VDVDECDLNPHICLHGDCENTKGS-FVCHCQLGYMVRKGATGC-SDVDECEVGGHNCDSHASCLNIPG----SFSCRCLPGWVG--DGFECHDLDECVSQEHRCSPRGDCLNV----PGSYRCTCRQGF--AGDGFFCEDRDECAENVDLCD-------NGQCL-NAPGGYRCECEMGFDPTEDHRACQDVD--ECAQGNL-CAFGSCENLPGMFRCICNGGYELDRGGGNC---------TDINECA--DPVN------------CINGVCINTPGSYLCSCPQDFELNPSGVGCV 1485          

HSP 6 Score: 95.5153 bits (236), Expect = 4.636e-19
Identity = 224/984 (22.76%), Postives = 341/984 (34.65%), Query Frame = 1
Query:  310 NNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKID---RGLCKSTPENLQLSKE----------ECCSIFQVAWGNPCVFCDRNYCPKGF----------TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-QYRRDQCQL---------------------YGSSCGIFGK--------CVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRY----------GTSEPLVS----------RYCSKSEYYSLCEGGSCVDLNNDYYCQC---SEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENG-----RKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSIC----------DLHREK----------CKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            + CS +G C N     +C C  G+ G+         C   +D    G C + P   +   E           C  + + A GN C F      P  F           +    C DI+EC     C+NG CIN  GS+ C CP D  L+ + + C   R   C L                       S C   G+        C   +  +Y  +C        N  + I + + + C     LC   G+C     S+ C CP G+H SE  + C      DI +    +  C  G+C +    Y C+C  EY   N    C+            GT +  ++           Y     +   CE      ++ DY   C   + GF    +  + + I+    +C      C  G C      ++ C+C  GF  +    +C   +   +  S C+      Q   C  I P  Y C C  GY  S       +NE        +EI   C  G C+    SY C+CH  + +S +   C+   + +               C  G C +   +Y C C  G+  T NG      +C+ +  QV                 C  G C+ +    F CLC  GF   +DG++C     ++CL+    C PG C+    S FRC+CP    +  D H   I+  + EP             C  G C N     +C+C PG+  S++G  C+   +          +C              C    G    +    C +  SA  ++ +C          D  RE           C  G+C       + C C  GY       +C+  D  +C+V  + C  G C +++ G+ C C   +   E G       + +   DI E S  NP   +F             +C   +  Y C CP  + T   D    RD ++C
Sbjct: 1330 HRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILE-DIDECQELPGLCQ-GGDCVNTFGSFQCECPPGYHLSEHTRIC-----EDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACP-TPISPDYQILCGNQAPGFLTDIHTGKPLDID----ECGEIPAICANGICIN-QIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQ------QNADCINI-PGSYRCKCTRGYKLSPGGACVGRNE-------CREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECD------------RQPCGNGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQV-----------------CRFGHCL-NTAGSFHCLCQDGFELTADGKNC--VDTNECLSLAGTCLPGTCQNLEGS-FRCICPPGFQVQSD-HCIDIDECSEEPNL-----------CLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQE-LCPFGHGAVPGPDDSREDVNECAENPGVCTNGVCVNT-DGSFRCECPFGYSLDFTGINCV--DTDECSVG-HPCGQGTCTNVIGGFECACADGF---EPG-------LMMTCEDIDECSL-NPLLCAF-------------RCHNTEGSYLCTCPAGY-TLREDGAMCRDVDEC 2211          

HSP 7 Score: 67.781 bits (164), Expect = 1.265e-10
Identity = 86/366 (23.50%), Postives = 137/366 (37.43%), Query Frame = 1
Query: 1921 SRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSE------------------SALIKKSIC------DLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            S C  G C+ +    + C C PGF +    ++C    VD+C+ +  +C  GRC  +  S F+CVC     LS DG +C+ +      T            C +G C+N+     C+C PG+  +  G  C  I++  +        C         + ++ CQCL G     +GR C+ +                      + KS C          E C+  +C      ++   C  G    TD +     D  +CA++   C  G C ++   Y C+C   Y    +G+DC          D+ E           C    ++  C  G C      Y C CP  F   + D E  +D ++C
Sbjct:  456 SPCHHGDCV-NIPGTYHCRCYPGFQATPTRQAC--VDVDECIVSGGLCHLGRCVNTEGS-FQCVCNAGFELSPDGKNCVDHNECATSTM-----------CVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICVNGHCTNT------EGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQ--LCPAKDSAEFQALCSSGLGITTDGR-----DINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDC---------TDVDE-----------CALNSLL--CDNGWCQNSPGSYSCSCPPGFHF-WQDTEICKDVDEC 770          

HSP 8 Score: 62.3882 bits (150), Expect = 6.614e-9
Identity = 59/207 (28.50%), Postives = 91/207 (43.96%), Query Frame = 1
Query:  508 PCVFCDRNY-------CPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQ 1101
            PC F  +N        CP+G+  +E+   C D+DEC  +       C+N  G+F C+CPP     ++  +C +  D+C      CG  G C  T  G + C C + +++  +G  C    + N C+   +       CQ     Y CSCP GF Q      C+  +   +  SP     C   SC +   G+RC+C     G++ DQ
Sbjct: 2415 PCTFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFLCVNTVGAFTCRCPPG--FTQHHQAC-FDNDECSAQPGPCGAHGHCHNTP-GSFRCECHQGFTLVSSGHGC---EDVNECDGPHRC---QHGCQNQLGGYRCSCPQGFTQHSQWAQCVDENECAL--SPPT---CGSASCRNTLGGFRCVCP---SGFDFDQ 2603          
BLAST of Fibrillin-2 vs. Ensembl Human
Match: FBN3 (fibrillin 3 [Source:HGNC Symbol;Acc:HGNC:18794])

HSP 1 Score: 157.147 bits (396), Expect = 6.481e-38
Identity = 236/961 (24.56%), Postives = 351/961 (36.52%), Query Frame = 1
Query:  148 CCSGWIKNVYG--DCVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQ-YRRDQC--QLYGSSCGIFGKCVPTSDGQYT---CICIKP--YSVSFNGKSCIKKTNYNVCNYFKKLC---LPYGECQP---YGLSYYCS---------------------CPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEE------PDNSY---CLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICD-------LHREKCKT-GICY--PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CC GW +   G   CV   C   CG G C   N+C C D T+   +C  +    C+ +C N G C+   C+C+ GY G  C   I                                    C+ ++    C+     L  +K  CC+    AWG PC  C    + C +GF        C D+DECQ    +C  G C+N  GSF C+CP  H L +++ +C+ YR   C   L+G      G+C     G YT   C C +   ++     + C  + +    N F++LC   LP     P    GL  + S                      PS    + +  +  +N   DIC+       C  G C+     YRC CN    GY  D   VR    E +    C+ S     C  G CV++   Y+C+C  GF AT  R+ C+ ++    +C ++   C  GRC   + + ++C C  GF  S +G++C+       ST         C  GVC       + C C  G+  +    YC+      D CQ   I   C  G C +   S+RC C G      +G              R+C      S C G                   A E G         VT+       PD+ +   C L           C    +  F+ LC  G    +DGR      +++C  +  +C  G CE    S +RCVC         G  C          T   +  +N L C +G C N      C C PG+   +D + C  +++  S   ++ +             +Y C+C  G     +G  C+ S        I++S C+       L  E C T G  +  P  + +   AC  G+ + T        D  +C      C  G C +    + C C     +  +GR C+
Sbjct:   68 CCPGW-RTFPGRSQCVVPICRRACGEGFCSQPNLCTCADGTL-APSCGVSRGSGCSVSCMNGGTCRGASCLCQKGYTGTVCGQPICDRGCHNGGRCIGPNRCACVYGFMGPQCERDYRTGPCFGQVGPEGCQHQLTGLVCTKALCCATVGRAWGLPCELCPAQPHPCRRGFIPNIHTGACQDVDECQAVPGLCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFG------GRCAGDLAGHYTRRQCCCDRGRCWAAGPVPELCPPRGS----NEFQQLCAQRLPLLPGHPGLFPGLLGFGSNGMGPPLGPARLNPHGSDARGIPSLGPGNSNIGTATLNQTIDICR--HFTNLCLNGRCLPTPSSYRCECN---VGYTQD---VR---GECIDVDECTSSP----CHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVD----ECIVSGGLCHLGRCVNTEGS-FQCVCNAGFELSPDGKNCVDHNECATST--------MCVNGVCL-NEDGSFSCLCKPGFLLAPGGHYCMD----IDECQTPGI---CVNGHCTNTEGSFRCQCLGGLAVGTDG--------------RVCVDTHVRSTCYG-------------------AIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQL-----------CPAKDSAEFQALCSSGLGITTDGRD-----INECALDPEVCANGVCENLRGS-YRCVCNLGYEAGASGKDC----------TDVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSPCVSGVCRNLA-------GSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFARMT---GVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCV 910          

HSP 2 Score: 129.413 bits (324), Expect = 2.036e-29
Identity = 219/954 (22.96%), Postives = 344/954 (36.06%), Query Frame = 1
Query:  310 NNCSNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKI----DRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELD----NNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLC-------SKWEYYSLCQGG--------ECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCL----LQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNN--ENICT-----------------PGR--------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRC--KGGYCYDIVDGYLCIC-VGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHEC 2913
            N C++   C NG CI   G +             G  C       C+++     D G+  S    + +++  CC     AWGNPC  C        R  CP G   + NR     +DIDECQ    +C  G+C+N  GSF+C+CPP ++L E+T  C+   D+C  +   CG  G C  T  G YTC+C   Y     G +C+         ++   C    E         C C     Q+ ++         + C +P   +             Y+ LC  +  G+  D       T +PL    C   E  ++C  G C++    + C+C  GF        C  ++    +C   +  CQ    Q  D      +Y C+C RG+  S  G +C+     R   ++C         G C       Y+C C  G+  S D+  C+      D C  Q     C  G C +   SY C+C   ++ ++NG +CV + +      ++C       +   ++ LCQ G         CVDTN              +N     R       +  + +C+      E  + C+ G C  +    F+CLC PGF  + +G  C       C        C+                 PG         C + G++ F+ +CP+       GH  +     +      C    N   C +G CVN     RC C  GY     G  C   ++ S      Q  C            +EC C +G+       +C   +   +   +C     +C         +  Y+C C  GY    D   C  +D  +CA  +  C  +G  C +++  + C+C  G   +  +G  C          D +E   Q              + C  G+CV     ++C C   F+ +    EC
Sbjct: 1447 NECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICE-DIDECSTHSGICGP-GTCYNTL-GNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTC--QNELAFNVTRKMCCCSYNIGQAWNRPC-------EACPTPISPD-------------YQILCGNQAPGFLTDIH-----TGKPLDIDECG--EIPAICANGICINQIGSFRCECPAGFNYNSILLACEDVD----ECGSRESPCQ----QNADCINIPGSYRCKCTRGYKLSPGG-ACVGRNECREIPNVC-------SHGDCMDTE-GSYMCLCHRGFQASADQTLCMD----IDECDRQP----CGNGTCKNIIGSYNCLCFPGFVVTHNG-DCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGTCT-NSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPF-------GHGAVPGPDDSREDVNEC--AENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCGQGTCTNVI------GGFECACADGFEPGLM-MTCEDIDECSLNPLLCAF---RCHNT------EGSYLCTCPAGYTLREDGAMCRDVD--ECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGC---------TDDNECHAQP-------------DLCVNGRCVNTAGSFRCDCDEGFQPSPTLTEC 2292          

HSP 3 Score: 116.701 bits (291), Expect = 1.622e-25
Identity = 225/978 (23.01%), Postives = 352/978 (35.99%), Query Frame = 1
Query:  319 SNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKG-------FTQKENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPT------------------------------------------SDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCR---GG---SCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYS----QSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLIN-----YVTTEPTTK-----YCDILVNRLR----CASGNCVNDRCICGPGYKSSE-----DGKECYKIEKVSSIXXXXXXXXXXXXXXXXDD-----NNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDI----VDGYLCICVGNYTVTENGRDCIL---------KIIAVKSVD--ISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTN 2895
            S  G C NG+C+  +G F             G  C    +  C+++ D   C  T          CCSI  V WG  C  C         + CP+G       F        D++EC+ F  +C +G C N  GSF C C     LD    +C    D+C++    CG  G CV T                                          +DG Y C C   + ++  G +C    + + C+    LC P+G+C     ++ CSC +GF  + D++ C+     DI         CR   GG    C++    YRC C   Y    + + C      E          E   +C+ G C ++   + C C +GF AT + R C+ ++    +C LN   C  G C+     ++ C C  G++  +    C   +        CE+ GH C +       P  + C CL G+     +  D   C+         Q    S R   G C++   SYRC C   +  + +G  C    +            E   LC  G+C++    Y C+C  G+  TE+ R C  +++                 + C  G C       F+C+C  G+     G +C    +++C +  N C  G C  +  S + C CP    L+  G  C+       ++ T            +I V   R    C+ G    + C   P   ++E      G E ++  +++ I        +  G  +  D      +++C+C  GY  SE+ R C   +        C  H   C  G CY    N Y C C   Y Q     +C+ M    C    +R   G C +     V   +C C  N     N R C           +I+        ++++    P     C   EI   C  G C+ +   ++C+CP  F  N
Sbjct:  875 SFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAV-WGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCT-DIDECRISPDLCGQ-GTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTAC---EDIDECSLSDGLC-PHGQCVNVIGAFQCSCHAGFQSTPDRQGCV-----DI-------NECRVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDECE----------ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVD----ECDLNPHICLHGDCENT-KGSFVCHCQLGYMVRKGATGCSDVDE-------CEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVS--------QEHRCSPR---GDCLNVPGSYRCTCRQGF--AGDGFFCEDRDECA----------ENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQG-------------NLCAFGSCENLPGM-FRCICNGGYELDRGGGNC--TDINECADPVN-CINGVCINTPGS-YLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDE-------CSTHSGICGPGTCYNTLGN-YTCVCPAEYLQVNGGNNCMDMRKSVC----FRHYNGTCQNELAFNVTRKMCCCSYNIGQAWN-RPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDEC--GEIPAICANGICINQIGSFRCECPAGFNYN 1755          

HSP 4 Score: 108.612 bits (270), Expect = 4.332e-23
Identity = 238/1052 (22.62%), Postives = 366/1052 (34.79%), Query Frame = 1
Query:  340 NGKCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQV--AWGNPCVFCDRNYCP----------KGFTQ--KENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGY--NNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIE---TITSQCALNQ---------------FQCQGGRCQELDN-----------------NNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK--------------------NEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYL--SRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCE-RSGNSNFRCVCPY-YASLSKDGHSCLI-NYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKK---------------SICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFC--TRKEIIEKCQPG-------------------------KCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC--PY-CFYGCFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTCRTKSLNRTLN 3105
            N  C+C + Y     G +C     S C+   + G C++      ++++ CC  + +  AW  PC  C     P           GF       +  DIDEC +  +IC NG CIN+ GSFRC+CP     +   ++C+   D+C    S C     C+    G Y C C + Y +S  G +C+ +   N C     +C  +G+C     SY C C  GF  S D+  C+     D        + C  G+C +    Y CLC   + G+   ++ +CV +     LV +         +C  G C++    ++C C +GF  T + + C+      ++   C                   FQ Q   C ++D                   +++C C  GF+ S+NG  C     TR S         +C     +        C+   G    +  + C +                    ++  +D  +  E    C  G CV+   S+RC C   Y     G  CV   +        C +    ++  G EC                A  +G +   +   +T E D   C L   L   RC       +    + C C  G+T   DG  C    VD+C + +  C     E ++    F CVCP     L   G  C   N    +P     D+ VN      G CVN     RC C  G++ S    EC+ I +      + Q  C+            EC C  G         C    ++  +K                 C +    C  G C       + C C  GY       +C+ MD  +C+     C    C +    +LC C   Y + E+GR C          D+ E + +    Q  C  T      +C PG                          C      ++C+C   F      H C  D N+C  P+ C +GC ++     CSC + +        C+   DE   +L   TC + S   TL 
Sbjct: 1627 NYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYN-GTCQNE-LAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSILLACE-DVDECGSRESPCQQNADCI-NIPGSYRCKCTRGYKLS-PGGACVGR---NECREIPNVC-SHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECD-------RQPCGNGTCKNIIGSYNCLC---FPGFVVTHNGDCVDFDECTTLVGQ---------VCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFD---TRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECS--VGHPCGQGTCTNVIGGFEC----------------ACADGFEPGLM---MTCE-DIDECSLNPLLCAFRCH------NTEGSYLCTCPAGYTLREDGAMC--RDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQP-----DLCVN------GRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRDVDECRMLAHLCAHGECI-NSLGSFRCHCQAGYTPDATATTCLDMD--ECSQVPKPCTF-LCKNTKGSFLCSCPRGYLLEEDGRTC---------KDLDECTSRQHNCQFLCVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGC-EDVNECDGPHRCQHGCQNQLGGYRCSCPQGFTQHSQWAQCV---DENECALSPPTCGSASCRNTLG 2589          

HSP 5 Score: 104.375 bits (259), Expect = 1.026e-21
Identity = 201/841 (23.90%), Postives = 313/841 (37.22%), Query Frame = 1
Query:  535 CPKGFT--QKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC----------QYRRDQCQLYGSSCGIFGKCVPTSDGQYTCIC----IKPY-SVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYR---CLCN-GEYQGYN----NDQECVRYGTSEP----LVSR-YCSKSEYY----------SLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENG----RSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGG---ECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            CP GF   Q    C D+DEC   S C++G C N  GS+ C+C P   LD +   C          + +  +C++      +  +C  T    +   C    I P  +  F   + +   + N C  F  +C P G C     S+ C CP G       + C+     D+   P           V+    YR   C C+ G   G       D E + + +  P      SR + S   +Y           LC  G+C +    ++C C+ GF      R C  I+    +C ++   C  G C     + +EC+C  G+   E+G    ++C+  +       +C       + G C       Y C C  G+  +     C    +  D C   +    C  GQCV+   +++C CH  + S+ + Q CV   +                +  GG    C++T  +Y C CG GY    +GR C+ +++             +E    C  G C  +   G +CLC  GF +  D R+C    VD+C  N +IC  G CE +  S F C C     + K    C  +    E     CD   + L        +  C C PG+    DG EC+ +++  S       +            +Y C C  G+  + +G  C   +       +CD        G C       Y C C +G+    D ++C  +D  +CA     C  G C ++   + CIC G Y +   G +C          DI+E +  +P +            C  G C+     Y C CP  F+ N     CV
Sbjct:  751 CPPGFHFWQDTEICKDVDEC-LSSPCVSGVCRNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFARMTGVTCDDVNECESFPGVC-PNGRCVNTAGSFRCECPEGLMLDASGRLCV-----DVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDID----ECRISPDLCGQGTCVNTPGS-FECECFPGY---ESGFMLMKNCMDVDECARDPLLC-------RGGTCTNTD-GSYKCQCPPGHELTAKGTAC----EDIDECSLSD--GLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECR--------------VQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDE------------CEENPRVCDQGHCT-NMPGGHRCLCYDGFMATPDMRTC--VDVDECDLNPHICLHGDCENTKGS-FVCHCQLGYMVRKGATGC-SDVDECEVGGHNCDSHASCLNIPG----SFSCRCLPGWVG--DGFECHDLDECVSQEHRCSPRGDCLNV----PGSYRCTCRQGF--AGDGFFCEDRDECAENVDLCD-------NGQCL-NAPGGYRCECEMGFDPTEDHRACQDVD--ECAQGNL-CAFGSCENLPGMFRCICNGGYELDRGGGNC---------TDINECA--DPVN------------CINGVCINTPGSYLCSCPQDFELNPSGVGCV 1485          

HSP 6 Score: 95.5153 bits (236), Expect = 4.636e-19
Identity = 224/984 (22.76%), Postives = 341/984 (34.65%), Query Frame = 1
Query:  310 NNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKID---RGLCKSTPENLQLSKE----------ECCSIFQVAWGNPCVFCDRNYCPKGF----------TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-QYRRDQCQL---------------------YGSSCGIFGK--------CVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRY----------GTSEPLVS----------RYCSKSEYYSLCEGGSCVDLNNDYYCQC---SEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENG-----RKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSIC----------DLHREK----------CKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            + CS +G C N     +C C  G+ G+         C   +D    G C + P   +   E           C  + + A GN C F      P  F           +    C DI+EC     C+NG CIN  GS+ C CP D  L+ + + C   R   C L                       S C   G+        C   +  +Y  +C        N  + I + + + C     LC   G+C     S+ C CP G+H SE  + C      DI +    +  C  G+C +    Y C+C  EY   N    C+            GT +  ++           Y     +   CE      ++ DY   C   + GF    +  + + I+    +C      C  G C      ++ C+C  GF  +    +C   +   +  S C+      Q   C  I P  Y C C  GY  S       +NE        +EI   C  G C+    SY C+CH  + +S +   C+   + +               C  G C +   +Y C C  G+  T NG      +C+ +  QV                 C  G C+ +    F CLC  GF   +DG++C     ++CL+    C PG C+    S FRC+CP    +  D H   I+  + EP             C  G C N     +C+C PG+  S++G  C+   +          +C              C    G    +    C +  SA  ++ +C          D  RE           C  G+C       + C C  GY       +C+  D  +C+V  + C  G C +++ G+ C C   +   E G       + +   DI E S  NP   +F             +C   +  Y C CP  + T   D    RD ++C
Sbjct: 1330 HRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILE-DIDECQELPGLCQ-GGDCVNTFGSFQCECPPGYHLSEHTRIC-----EDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACP-TPISPDYQILCGNQAPGFLTDIHTGKPLDID----ECGEIPAICANGICIN-QIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQ------QNADCINI-PGSYRCKCTRGYKLSPGGACVGRNE-------CREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECD------------RQPCGNGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQV-----------------CRFGHCL-NTAGSFHCLCQDGFELTADGKNC--VDTNECLSLAGTCLPGTCQNLEGS-FRCICPPGFQVQSD-HCIDIDECSEEPNL-----------CLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQE-LCPFGHGAVPGPDDSREDVNECAENPGVCTNGVCVNT-DGSFRCECPFGYSLDFTGINCV--DTDECSVG-HPCGQGTCTNVIGGFECACADGF---EPG-------LMMTCEDIDECSL-NPLLCAF-------------RCHNTEGSYLCTCPAGY-TLREDGAMCRDVDEC 2211          

HSP 7 Score: 67.781 bits (164), Expect = 1.265e-10
Identity = 86/366 (23.50%), Postives = 137/366 (37.43%), Query Frame = 1
Query: 1921 SRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSE------------------SALIKKSIC------DLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            S C  G C+ +    + C C PGF +    ++C    VD+C+ +  +C  GRC  +  S F+CVC     LS DG +C+ +      T            C +G C+N+     C+C PG+  +  G  C  I++  +        C         + ++ CQCL G     +GR C+ +                      + KS C          E C+  +C      ++   C  G    TD +     D  +CA++   C  G C ++   Y C+C   Y    +G+DC          D+ E           C    ++  C  G C      Y C CP  F   + D E  +D ++C
Sbjct:  456 SPCHHGDCV-NIPGTYHCRCYPGFQATPTRQAC--VDVDECIVSGGLCHLGRCVNTEGS-FQCVCNAGFELSPDGKNCVDHNECATSTM-----------CVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICVNGHCTNT------EGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQ--LCPAKDSAEFQALCSSGLGITTDGR-----DINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDC---------TDVDE-----------CALNSLL--CDNGWCQNSPGSYSCSCPPGFHF-WQDTEICKDVDEC 770          

HSP 8 Score: 62.3882 bits (150), Expect = 6.614e-9
Identity = 59/207 (28.50%), Postives = 91/207 (43.96%), Query Frame = 1
Query:  508 PCVFCDRNY-------CPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQ 1101
            PC F  +N        CP+G+  +E+   C D+DEC  +       C+N  G+F C+CPP     ++  +C +  D+C      CG  G C  T  G + C C + +++  +G  C    + N C+   +       CQ     Y CSCP GF Q      C+  +   +  SP     C   SC +   G+RC+C     G++ DQ
Sbjct: 2415 PCTFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFLCVNTVGAFTCRCPPG--FTQHHQAC-FDNDECSAQPGPCGAHGHCHNTP-GSFRCECHQGFTLVSSGHGC---EDVNECDGPHRC---QHGCQNQLGGYRCSCPQGFTQHSQWAQCVDENECAL--SPPT---CGSASCRNTLGGFRCVCP---SGFDFDQ 2603          
BLAST of Fibrillin-2 vs. Ensembl Human
Match: FBN3 (fibrillin 3 [Source:HGNC Symbol;Acc:HGNC:18794])

HSP 1 Score: 157.147 bits (396), Expect = 6.481e-38
Identity = 236/961 (24.56%), Postives = 351/961 (36.52%), Query Frame = 1
Query:  148 CCSGWIKNVYG--DCVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQ-YRRDQC--QLYGSSCGIFGKCVPTSDGQYT---CICIKP--YSVSFNGKSCIKKTNYNVCNYFKKLC---LPYGECQP---YGLSYYCS---------------------CPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEE------PDNSY---CLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICD-------LHREKCKT-GICY--PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CC GW +   G   CV   C   CG G C   N+C C D T+   +C  +    C+ +C N G C+   C+C+ GY G  C   I                                    C+ ++    C+     L  +K  CC+    AWG PC  C    + C +GF        C D+DECQ    +C  G C+N  GSF C+CP  H L +++ +C+ YR   C   L+G      G+C     G YT   C C +   ++     + C  + +    N F++LC   LP     P    GL  + S                      PS    + +  +  +N   DIC+       C  G C+     YRC CN    GY  D   VR    E +    C+ S     C  G CV++   Y+C+C  GF AT  R+ C+ ++    +C ++   C  GRC   + + ++C C  GF  S +G++C+       ST         C  GVC       + C C  G+  +    YC+      D CQ   I   C  G C +   S+RC C G      +G              R+C      S C G                   A E G         VT+       PD+ +   C L           C    +  F+ LC  G    +DGR      +++C  +  +C  G CE    S +RCVC         G  C          T   +  +N L C +G C N      C C PG+   +D + C  +++  S   ++ +             +Y C+C  G     +G  C+ S        I++S C+       L  E C T G  +  P  + +   AC  G+ + T        D  +C      C  G C +    + C C     +  +GR C+
Sbjct:   68 CCPGW-RTFPGRSQCVVPICRRACGEGFCSQPNLCTCADGTL-APSCGVSRGSGCSVSCMNGGTCRGASCLCQKGYTGTVCGQPICDRGCHNGGRCIGPNRCACVYGFMGPQCERDYRTGPCFGQVGPEGCQHQLTGLVCTKALCCATVGRAWGLPCELCPAQPHPCRRGFIPNIHTGACQDVDECQAVPGLCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFG------GRCAGDLAGHYTRRQCCCDRGRCWAAGPVPELCPPRGS----NEFQQLCAQRLPLLPGHPGLFPGLLGFGSNGMGPPLGPARLNPHGSDARGIPSLGPGNSNIGTATLNQTIDICR--HFTNLCLNGRCLPTPSSYRCECN---VGYTQD---VR---GECIDVDECTSSP----CHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVD----ECIVSGGLCHLGRCVNTEGS-FQCVCNAGFELSPDGKNCVDHNECATST--------MCVNGVCL-NEDGSFSCLCKPGFLLAPGGHYCMD----IDECQTPGI---CVNGHCTNTEGSFRCQCLGGLAVGTDG--------------RVCVDTHVRSTCYG-------------------AIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQL-----------CPAKDSAEFQALCSSGLGITTDGRD-----INECALDPEVCANGVCENLRGS-YRCVCNLGYEAGASGKDC----------TDVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSPCVSGVCRNLA-------GSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFARMT---GVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCV 910          

HSP 2 Score: 129.413 bits (324), Expect = 2.036e-29
Identity = 219/954 (22.96%), Postives = 344/954 (36.06%), Query Frame = 1
Query:  310 NNCSNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKI----DRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELD----NNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLC-------SKWEYYSLCQGG--------ECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCL----LQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNN--ENICT-----------------PGR--------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRC--KGGYCYDIVDGYLCIC-VGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHEC 2913
            N C++   C NG CI   G +             G  C       C+++     D G+  S    + +++  CC     AWGNPC  C        R  CP G   + NR     +DIDECQ    +C  G+C+N  GSF+C+CPP ++L E+T  C+   D+C  +   CG  G C  T  G YTC+C   Y     G +C+         ++   C    E         C C     Q+ ++         + C +P   +             Y+ LC  +  G+  D       T +PL    C   E  ++C  G C++    + C+C  GF        C  ++    +C   +  CQ    Q  D      +Y C+C RG+  S  G +C+     R   ++C         G C       Y+C C  G+  S D+  C+      D C  Q     C  G C +   SY C+C   ++ ++NG +CV + +      ++C       +   ++ LCQ G         CVDTN              +N     R       +  + +C+      E  + C+ G C  +    F+CLC PGF  + +G  C       C        C+                 PG         C + G++ F+ +CP+       GH  +     +      C    N   C +G CVN     RC C  GY     G  C   ++ S      Q  C            +EC C +G+       +C   +   +   +C     +C         +  Y+C C  GY    D   C  +D  +CA  +  C  +G  C +++  + C+C  G   +  +G  C          D +E   Q              + C  G+CV     ++C C   F+ +    EC
Sbjct: 1447 NECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICE-DIDECSTHSGICGP-GTCYNTL-GNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTC--QNELAFNVTRKMCCCSYNIGQAWNRPC-------EACPTPISPD-------------YQILCGNQAPGFLTDIH-----TGKPLDIDECG--EIPAICANGICINQIGSFRCECPAGFNYNSILLACEDVD----ECGSRESPCQ----QNADCINIPGSYRCKCTRGYKLSPGG-ACVGRNECREIPNVC-------SHGDCMDTE-GSYMCLCHRGFQASADQTLCMD----IDECDRQP----CGNGTCKNIIGSYNCLCFPGFVVTHNG-DCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGTCT-NSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPF-------GHGAVPGPDDSREDVNEC--AENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCGQGTCTNVI------GGFECACADGFEPGLM-MTCEDIDECSLNPLLCAF---RCHNT------EGSYLCTCPAGYTLREDGAMCRDVD--ECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGC---------TDDNECHAQP-------------DLCVNGRCVNTAGSFRCDCDEGFQPSPTLTEC 2292          

HSP 3 Score: 116.701 bits (291), Expect = 1.622e-25
Identity = 225/978 (23.01%), Postives = 352/978 (35.99%), Query Frame = 1
Query:  319 SNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKG-------FTQKENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPT------------------------------------------SDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCR---GG---SCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYS----QSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLIN-----YVTTEPTTK-----YCDILVNRLR----CASGNCVNDRCICGPGYKSSE-----DGKECYKIEKVSSIXXXXXXXXXXXXXXXXDD-----NNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDI----VDGYLCICVGNYTVTENGRDCIL---------KIIAVKSVD--ISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTN 2895
            S  G C NG+C+  +G F             G  C    +  C+++ D   C  T          CCSI  V WG  C  C         + CP+G       F        D++EC+ F  +C +G C N  GSF C C     LD    +C    D+C++    CG  G CV T                                          +DG Y C C   + ++  G +C    + + C+    LC P+G+C     ++ CSC +GF  + D++ C+     DI         CR   GG    C++    YRC C   Y    + + C      E          E   +C+ G C ++   + C C +GF AT + R C+ ++    +C LN   C  G C+     ++ C C  G++  +    C   +        CE+ GH C +       P  + C CL G+     +  D   C+         Q    S R   G C++   SYRC C   +  + +G  C    +            E   LC  G+C++    Y C+C  G+  TE+ R C  +++                 + C  G C       F+C+C  G+     G +C    +++C +  N C  G C  +  S + C CP    L+  G  C+       ++ T            +I V   R    C+ G    + C   P   ++E      G E ++  +++ I        +  G  +  D      +++C+C  GY  SE+ R C   +        C  H   C  G CY    N Y C C   Y Q     +C+ M    C    +R   G C +     V   +C C  N     N R C           +I+        ++++    P     C   EI   C  G C+ +   ++C+CP  F  N
Sbjct:  875 SFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAV-WGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCT-DIDECRISPDLCGQ-GTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTAC---EDIDECSLSDGLC-PHGQCVNVIGAFQCSCHAGFQSTPDRQGCV-----DI-------NECRVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDECE----------ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVD----ECDLNPHICLHGDCENT-KGSFVCHCQLGYMVRKGATGCSDVDE-------CEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVS--------QEHRCSPR---GDCLNVPGSYRCTCRQGF--AGDGFFCEDRDECA----------ENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQG-------------NLCAFGSCENLPGM-FRCICNGGYELDRGGGNC--TDINECADPVN-CINGVCINTPGS-YLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDE-------CSTHSGICGPGTCYNTLGN-YTCVCPAEYLQVNGGNNCMDMRKSVC----FRHYNGTCQNELAFNVTRKMCCCSYNIGQAWN-RPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDEC--GEIPAICANGICINQIGSFRCECPAGFNYN 1755          

HSP 4 Score: 108.612 bits (270), Expect = 4.332e-23
Identity = 238/1052 (22.62%), Postives = 366/1052 (34.79%), Query Frame = 1
Query:  340 NGKCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQV--AWGNPCVFCDRNYCP----------KGFTQ--KENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGY--NNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIE---TITSQCALNQ---------------FQCQGGRCQELDN-----------------NNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK--------------------NEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYL--SRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCE-RSGNSNFRCVCPY-YASLSKDGHSCLI-NYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKK---------------SICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFC--TRKEIIEKCQPG-------------------------KCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC--PY-CFYGCFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTCRTKSLNRTLN 3105
            N  C+C + Y     G +C     S C+   + G C++      ++++ CC  + +  AW  PC  C     P           GF       +  DIDEC +  +IC NG CIN+ GSFRC+CP     +   ++C+   D+C    S C     C+    G Y C C + Y +S  G +C+ +   N C     +C  +G+C     SY C C  GF  S D+  C+     D        + C  G+C +    Y CLC   + G+   ++ +CV +     LV +         +C  G C++    ++C C +GF  T + + C+      ++   C                   FQ Q   C ++D                   +++C C  GF+ S+NG  C     TR S         +C     +        C+   G    +  + C +                    ++  +D  +  E    C  G CV+   S+RC C   Y     G  CV   +        C +    ++  G EC                A  +G +   +   +T E D   C L   L   RC       +    + C C  G+T   DG  C    VD+C + +  C     E ++    F CVCP     L   G  C   N    +P     D+ VN      G CVN     RC C  G++ S    EC+ I +      + Q  C+            EC C  G         C    ++  +K                 C +    C  G C       + C C  GY       +C+ MD  +C+     C    C +    +LC C   Y + E+GR C          D+ E + +    Q  C  T      +C PG                          C      ++C+C   F      H C  D N+C  P+ C +GC ++     CSC + +        C+   DE   +L   TC + S   TL 
Sbjct: 1627 NYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYN-GTCQNE-LAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSILLACE-DVDECGSRESPCQQNADCI-NIPGSYRCKCTRGYKLS-PGGACVGR---NECREIPNVC-SHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECD-------RQPCGNGTCKNIIGSYNCLC---FPGFVVTHNGDCVDFDECTTLVGQ---------VCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFD---TRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECS--VGHPCGQGTCTNVIGGFEC----------------ACADGFEPGLM---MTCE-DIDECSLNPLLCAFRCH------NTEGSYLCTCPAGYTLREDGAMC--RDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQP-----DLCVN------GRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRDVDECRMLAHLCAHGECI-NSLGSFRCHCQAGYTPDATATTCLDMD--ECSQVPKPCTF-LCKNTKGSFLCSCPRGYLLEEDGRTC---------KDLDECTSRQHNCQFLCVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGC-EDVNECDGPHRCQHGCQNQLGGYRCSCPQGFTQHSQWAQCV---DENECALSPPTCGSASCRNTLG 2589          

HSP 5 Score: 104.375 bits (259), Expect = 1.026e-21
Identity = 201/841 (23.90%), Postives = 313/841 (37.22%), Query Frame = 1
Query:  535 CPKGFT--QKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC----------QYRRDQCQLYGSSCGIFGKCVPTSDGQYTCIC----IKPY-SVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYR---CLCN-GEYQGYN----NDQECVRYGTSEP----LVSR-YCSKSEYY----------SLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENG----RSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGG---ECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            CP GF   Q    C D+DEC   S C++G C N  GS+ C+C P   LD +   C          + +  +C++      +  +C  T    +   C    I P  +  F   + +   + N C  F  +C P G C     S+ C CP G       + C+     D+   P           V+    YR   C C+ G   G       D E + + +  P      SR + S   +Y           LC  G+C +    ++C C+ GF      R C  I+    +C ++   C  G C     + +EC+C  G+   E+G    ++C+  +       +C       + G C       Y C C  G+  +     C    +  D C   +    C  GQCV+   +++C CH  + S+ + Q CV   +                +  GG    C++T  +Y C CG GY    +GR C+ +++             +E    C  G C  +   G +CLC  GF +  D R+C    VD+C  N +IC  G CE +  S F C C     + K    C  +    E     CD   + L        +  C C PG+    DG EC+ +++  S       +            +Y C C  G+  + +G  C   +       +CD        G C       Y C C +G+    D ++C  +D  +CA     C  G C ++   + CIC G Y +   G +C          DI+E +  +P +            C  G C+     Y C CP  F+ N     CV
Sbjct:  751 CPPGFHFWQDTEICKDVDEC-LSSPCVSGVCRNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFARMTGVTCDDVNECESFPGVC-PNGRCVNTAGSFRCECPEGLMLDASGRLCV-----DVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDID----ECRISPDLCGQGTCVNTPGS-FECECFPGY---ESGFMLMKNCMDVDECARDPLLC-------RGGTCTNTD-GSYKCQCPPGHELTAKGTAC----EDIDECSLSD--GLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECR--------------VQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDE------------CEENPRVCDQGHCT-NMPGGHRCLCYDGFMATPDMRTC--VDVDECDLNPHICLHGDCENTKGS-FVCHCQLGYMVRKGATGC-SDVDECEVGGHNCDSHASCLNIPG----SFSCRCLPGWVG--DGFECHDLDECVSQEHRCSPRGDCLNV----PGSYRCTCRQGF--AGDGFFCEDRDECAENVDLCD-------NGQCL-NAPGGYRCECEMGFDPTEDHRACQDVD--ECAQGNL-CAFGSCENLPGMFRCICNGGYELDRGGGNC---------TDINECA--DPVN------------CINGVCINTPGSYLCSCPQDFELNPSGVGCV 1485          

HSP 6 Score: 95.5153 bits (236), Expect = 4.636e-19
Identity = 224/984 (22.76%), Postives = 341/984 (34.65%), Query Frame = 1
Query:  310 NNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKID---RGLCKSTPENLQLSKE----------ECCSIFQVAWGNPCVFCDRNYCPKGF----------TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-QYRRDQCQL---------------------YGSSCGIFGK--------CVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRY----------GTSEPLVS----------RYCSKSEYYSLCEGGSCVDLNNDYYCQC---SEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENG-----RKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSIC----------DLHREK----------CKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            + CS +G C N     +C C  G+ G+         C   +D    G C + P   +   E           C  + + A GN C F      P  F           +    C DI+EC     C+NG CIN  GS+ C CP D  L+ + + C   R   C L                       S C   G+        C   +  +Y  +C        N  + I + + + C     LC   G+C     S+ C CP G+H SE  + C      DI +    +  C  G+C +    Y C+C  EY   N    C+            GT +  ++           Y     +   CE      ++ DY   C   + GF    +  + + I+    +C      C  G C      ++ C+C  GF  +    +C   +   +  S C+      Q   C  I P  Y C C  GY  S       +NE        +EI   C  G C+    SY C+CH  + +S +   C+   + +               C  G C +   +Y C C  G+  T NG      +C+ +  QV                 C  G C+ +    F CLC  GF   +DG++C     ++CL+    C PG C+    S FRC+CP    +  D H   I+  + EP             C  G C N     +C+C PG+  S++G  C+   +          +C              C    G    +    C +  SA  ++ +C          D  RE           C  G+C       + C C  GY       +C+  D  +C+V  + C  G C +++ G+ C C   +   E G       + +   DI E S  NP   +F             +C   +  Y C CP  + T   D    RD ++C
Sbjct: 1330 HRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILE-DIDECQELPGLCQ-GGDCVNTFGSFQCECPPGYHLSEHTRIC-----EDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACP-TPISPDYQILCGNQAPGFLTDIHTGKPLDID----ECGEIPAICANGICIN-QIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQ------QNADCINI-PGSYRCKCTRGYKLSPGGACVGRNE-------CREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECD------------RQPCGNGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQV-----------------CRFGHCL-NTAGSFHCLCQDGFELTADGKNC--VDTNECLSLAGTCLPGTCQNLEGS-FRCICPPGFQVQSD-HCIDIDECSEEPNL-----------CLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQE-LCPFGHGAVPGPDDSREDVNECAENPGVCTNGVCVNT-DGSFRCECPFGYSLDFTGINCV--DTDECSVG-HPCGQGTCTNVIGGFECACADGF---EPG-------LMMTCEDIDECSL-NPLLCAF-------------RCHNTEGSYLCTCPAGY-TLREDGAMCRDVDEC 2211          

HSP 7 Score: 67.781 bits (164), Expect = 1.265e-10
Identity = 86/366 (23.50%), Postives = 137/366 (37.43%), Query Frame = 1
Query: 1921 SRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSE------------------SALIKKSIC------DLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            S C  G C+ +    + C C PGF +    ++C    VD+C+ +  +C  GRC  +  S F+CVC     LS DG +C+ +      T            C +G C+N+     C+C PG+  +  G  C  I++  +        C         + ++ CQCL G     +GR C+ +                      + KS C          E C+  +C      ++   C  G    TD +     D  +CA++   C  G C ++   Y C+C   Y    +G+DC          D+ E           C    ++  C  G C      Y C CP  F   + D E  +D ++C
Sbjct:  456 SPCHHGDCV-NIPGTYHCRCYPGFQATPTRQAC--VDVDECIVSGGLCHLGRCVNTEGS-FQCVCNAGFELSPDGKNCVDHNECATSTM-----------CVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICVNGHCTNT------EGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQ--LCPAKDSAEFQALCSSGLGITTDGR-----DINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDC---------TDVDE-----------CALNSLL--CDNGWCQNSPGSYSCSCPPGFHF-WQDTEICKDVDEC 770          

HSP 8 Score: 62.3882 bits (150), Expect = 6.614e-9
Identity = 59/207 (28.50%), Postives = 91/207 (43.96%), Query Frame = 1
Query:  508 PCVFCDRNY-------CPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQ 1101
            PC F  +N        CP+G+  +E+   C D+DEC  +       C+N  G+F C+CPP     ++  +C +  D+C      CG  G C  T  G + C C + +++  +G  C    + N C+   +       CQ     Y CSCP GF Q      C+  +   +  SP     C   SC +   G+RC+C     G++ DQ
Sbjct: 2415 PCTFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFLCVNTVGAFTCRCPPG--FTQHHQAC-FDNDECSAQPGPCGAHGHCHNTP-GSFRCECHQGFTLVSSGHGC---EDVNECDGPHRC---QHGCQNQLGGYRCSCPQGFTQHSQWAQCVDENECAL--SPPT---CGSASCRNTLGGFRCVCP---SGFDFDQ 2603          
BLAST of Fibrillin-2 vs. Ensembl Human
Match: FBN2 (fibrillin 2 [Source:HGNC Symbol;Acc:HGNC:3604])

HSP 1 Score: 157.147 bits (396), Expect = 7.260e-38
Identity = 242/1008 (24.01%), Postives = 363/1008 (36.01%), Query Frame = 1
Query:  253 YDKTIRTETCPQNNQKLCTNNCSNKGQCQNG----KCICESGY----FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-YCPKGFTQ-KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-----------------------QYRRDQC-----QLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNY---NVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI-----------------VNSNSDI-----------------CQSPEIAER----CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTE--------------PPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQ-----------------EYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSIC-----DLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            Y     TETC   N+  C +N    G C+N      C C  G      G  C  ++  TC++ I    C+       L K ECC+    AWG+PC  C+ +  CP+G  + K   C+D++EC+ F  +C NG C+N KGSF C+CP    LD     C                       ++R D C       +G+ C    +C      +Y  +C +    +  G     +  Y   N C  F  +C  YG+C+    S+ C C SGF    ++++C                  VN+                     C   +  ER    CRGG+CV+    ++C C   ++   + ++CV            CS S+  +LC  G CV++   Y C C+ G+ AT +R+ C  I+           QC           +YEC C  G+    +GRSC   +   N+  IC+  G +C         P EY C C +G+  S D K CI      D  +    S  C  G+C +   S+ C C   Y        C    + E               P    CS  E + +  G +C+D                 NG     I  Q    P +  C                    E ++ C  G+C+ +    ++C C  GFT ASD RSC  + +D+C + +NIC  G C       F C+C     L + G +C              D   + + C +G CVN      C C P ++ +  G  C                          DN      L    + +   SC       + +S C           C+T  C P+   +Y   C  G     +  + I+ D  +C      C+GG C +    + C C   Y ++E+ R C          DI E  + +P              C PG C     +Y C CP  +      H C+
Sbjct:  841 YVFRTETETCEDINE--CESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATL-KSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECE---ECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCT-YGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDI--------NECSLSD--NLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSE------GSYECSCSEGYALMPDGRSCADIDECENNPDICD--GGQCTN------IPGEYRCLCYDGFMASMDMKTCI------DVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGW-IGNGIKCIDL------------DECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCL-NVPGAYRCECEMGFTPASDSRSC--QDIDEC-SFQNICVFGTCNNL-PGMFHCICDDGYELDRTGGNC-----------TDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCV-------------------------DNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCET--CPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRIC---------EDIDEC-FAHPGV------------CGPGTCYNTLGNYTCICPPEYMQVNGGHNCM 1733          

HSP 2 Score: 128.257 bits (321), Expect = 5.132e-29
Identity = 232/1006 (23.06%), Postives = 359/1006 (35.69%), Query Frame = 1
Query:  310 NNCSNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKI----DRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR-------NYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSV-----------------SFNGKSCIKKTNYNV------CNY-----FKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCE-GGSCVDLNNDYYCQCSEGFYATEN-----RRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQ------ECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNN--ENICT-----------------PGR--------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFDENSISTCSCSENYENLFDTGLC 3027
            + C++   C NG C+   G +             G  C    +  CY+K     D  L  +T   + +S+  CC     AWGNPC  C           CP G   + N      +DIDECQ    +C  G CIN  GSF+C+CP  +YL E+T  C+   D+C  +   CG  G C  T  G YTCIC   Y                   S+NG +C  +  +NV      C Y     + K C P            C    GF         +     DI +  EI   C  G C+++   +RC C   +    ND   V     E      CS  +  +LC+    C++    Y C+C+ GF  + N     R  C++I  +          C  G C +L   +Y+C C  GF  S++   C+  +         E   H C  G C       Y C C  G+  + +   C+  ++   +       + CR G+C +   S++C+C+  Y  + +G+      ECV    +  P      +  +  +C  G  V +                    C  I  +  E+P+            C+ G C  +   GF+CLC PGF  + +GR C       C  N     C+                 PG         C +     F+ +CPY       GH  + +   T      C  L +   C++G C+N     RC C  GY     G  C   ++ S         C           ++EC C  G+       +C           +C     +C            Y C C +GY    D+K C  +D     +++   +G  C +++  ++CIC        +G  C+                     ++ C  K  I  C+ G+CV     Y+C+C   F+++    EC+ +          CF E   + C  + +  NL     C
Sbjct: 1534 DECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICE-DIDECFAHPGVCGP-GTCYNTL-GNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAV-----DIDECKEIPGICANGVCINQIGSFRCECPTGFS--YNDLLLVCEDIDE------CSNGD--NLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNV----------CSHGLCVDL-QGSYQCICHNGFKASQDQTMCMDVD---------ECERHPCGNGTCKNTV-GSYNCLCYPGFELTHNND-CLDIDECSSF-----FGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKS------------------ENCIDI-NECDEDPN-----------ICLFGSCT-NTPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPY-------GHGTVPSLHDTREDVNEC--LESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCTNVI------GSFECNCNEGFEPGPM-MNCEDINECAQNPLLCAF---RCMNTF------GSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCV--------------------DENECRTKPGI--CENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGL------CFAEVLQTICQMASSSRNLVTKSEC 2410          

HSP 3 Score: 124.79 bits (312), Expect = 5.192e-28
Identity = 253/1072 (23.60%), Postives = 385/1072 (35.91%), Query Frame = 1
Query:  325 KGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR-------NYCPKGFTQKENRCD---------DIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNG-KSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGT------------SEPLVSRYCSKSEYYSL-------------------CEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLIN-----YVTTEPTTK-----YCDILVNRLR----CASGNCVNDRCICGPGYKSSE-----DGKECYKIEKVSSIXXXXXXXXXXXXXXXXDD-----NNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKC--AVNEYRCKGGYCYDIVDGYLCICVGNY--------------------TVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYY-------------DHECVR----------------------------DSNKCP----YCFYG-CFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTCR 3078
             G C NG+C+   G F             G  C    +  CY+K D   C   P   +   + CC     AWG  C  C +         CP+G     NR D         DI+EC+ F  +C  G+C N  GSF+C+C     LD    +C    D+C++    CG  G CV T  G + C C + Y   F   K+C+   + + C     LC   G C     S+ C CP G   S  ++ C+     DI +       CR G CV+    Y+C CN  YQ   + Q C                 +    S  CS SE Y+L                   C+GG C ++  +Y C C +GF A+ + + CI +    ++C LN   C  G C+     ++ C C  G+   +    C   +        CE+  H C         P  + C+C EG+  +  +  CI  ++  +      I+      QCV+   SYRC C   +  + +G  C    +            E  +LC+ G+C++    Y C+C  G+    + R C  I++          C  Q     C+ G C  +    F C+C  G+     G +C    +D+C +  N C  G C  +    + C CP    L+  G  C+ N     Y+   P          +I V   R    C+ G    + C   P   S+E      G E ++   ++ I        +  G  +  +      +++C+C  GY  SE+ R C   +        C  H   C  G CY    N Y C C   Y Q     +C+ M    C  + N   C+    +++    +C C  N                     T+  N       I   K+VDI E              KEI   C  G C+ +   ++C+CP  F  N               D+ C R                            D N+C      C +G C D      C C   ++   D  +C+   +   +  G+ TC+
Sbjct:  963 PGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIH-PVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRG-AGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCT-DIDECRISPDLCG-SGICVNTP-GSFECECFEGYESGFMMMKNCM---DIDECERNPLLCR-GGTCVNTEGSFQCDCPLGHELSPSREDCV-----DINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDV----NECDLNSNICMFGECENT-KGSFICHCQLGYSVKKGTTGCTDVDE-------CEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIK--CIDLDECSNGTHQCSINA-----QCVNTPGSYRCACSEGF--TGDGFTCSDVDECA----------ENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDE----------CSFQNI---CVFGTC-NNLPGMFHCICDDGYELDRTGGNC--TDIDECADPIN-CVNGLCVNT-PGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDE-------CFAHPGVCGPGTCYNTLGN-YTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTK-RMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDEC-------------KEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPCGNGTCK 1949          

HSP 4 Score: 123.25 bits (308), Expect = 1.603e-27
Identity = 234/1014 (23.08%), Postives = 344/1014 (33.93%), Query Frame = 1
Query:  148 CCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNY-------------------------------------CPKGFTQKEN--RCDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCI--CIKP---YSVSFNGKSCIKKTNYNVCNYFKKLC---LPYGEC------QPYGLSYYCSCPS--------------------GFHQSEDKKSC-------IVNSNSDICQSPEI----AERCRGGSCVSEGKGYRCLCNGEY-QGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLP----------GFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICD-------LHREKCKT-GICY--PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CC GW     G+ C+   C   CG G C   N+C C    I + TC   + + C+  C N G C +  C C+ GY G  C   +                                    C+ +++  +C+     +  +K  CC+    AWG+PC  C        R +                                     CP G  Q E   +C+DIDEC     IC  GEC N  GS+ C CP  +    +   C  +R      G    + G+C     G+ T +  C +P   + +    ++C  + +      +++LC   LP G        +P G       PS                    GF                I+   + + Q+ +I    A  C  G C+     YRC CN  Y Q  N D   V   TS P              C  G CV+    YYC+C  GF  T  ++ CI I+    +C  N   C+ GRC   D  +++C C  GF  + +G++C+  +    +        + C  G+C       + C C  G+  + + +YC       D CQ   I   C  G C+++  S+RC C        +G              R+C      S C GG                            I+K V   P        E         C  +  YGF   C P          G  S+  G + D   +++C  + +IC  G CE    S +RC C         G +C+             + LVNRL C +G C N      C C PGY    + + C  I +  S            G    +  ++ C+C  G   S  G  CI S        I+ S C+       L  E C T G  +  P  + +   AC  G  +    K     D  +C V    C  G C +    + C C    T+   GR C+
Sbjct:   97 CCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSSGQI-SSTCGSKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCIDQRTGMCFSGL---VNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGS----EEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNP--------------CTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDID----ECIQNGVLCKNGRCVNTD-GSFQCICNAGFELTTDGKNCVDHDECTTT--------NMCLNGMCI-NEDGSFKCICKPGFVLAPNGRYCTD----VDECQTPGI---CMNGHCINSEGSFRCDCPPGLAVGMDG--------------RVCVDTHMRSTCYGG----------------------------IKKGVCVRPFPGAVTKSEC--------CCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGS-YRCNCNSGYEPDASGRNCI----------DIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECES-------NPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARI---KGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCL 996          

HSP 5 Score: 119.013 bits (297), Expect = 3.271e-26
Identity = 242/956 (25.31%), Postives = 353/956 (36.92%), Query Frame = 1
Query:  205 YDCGYGRC---VGLNVCECYDKTIRTETCPQNNQKLCTNNCSNK-GQ-CQNGKCICESGYFGEDCNTAIISTCYVK--IDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKC-VPTS--DGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVR-YGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDK--------TYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY----CFYGCFDENSISTCSCSENY 3000
            + CG G C   VG   C CY     T     NN  L  + CS+  GQ C+NG+C  E G F   CN     T   K  ID   C + P +        C   + ++        R  CP G+  K   C DI+EC +  +ICL G C N  G F+C CPP   L +N   C   R   Q +  +    GKC VP +    +  C C K     +     +   +  V   F+ LC       PYG   + + PS     ED   C+        +SP I   C  G C++    +RC C     GYN D   VR   T E  +   C           G+C ++   + C C+EGF         +  E I ++CA N   C   RC      +YEC C  G+   E+ + C   +        CE  G  C+  +        ++C C  G ++  D + C+   + +           C  G+CV+   SYRC C+  + SS++G EC+  +Q       LC      ++CQ                                        +S  L+ +    C GGR  G +        T  +K +C  G    +DGR      +D+C    N+CT G+C  +  S FRC C    +    G SC I+      + K C+ +      +       +C C  GY   EDGK C  +++  +     Q  C            + C+C  G+ +     +CI +     + S+C         GIC       + C C  G+       +C  +D  +C  N +RC+ G C +I+ GY C C   Y        C         VD +E S  N               C    C      Y+C CP  F  + +   C  D N+C      C YGC +      C C   Y
Sbjct: 1941 HPCGNGTCKNTVGSYNCLCYPGFELT----HNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGT---CQNLEGSF--------RCICPPGYEVKSENCIDINECDEDPNICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTR---QSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEV--AFQDLC-------PYG---HGTVPSLHDTREDVNECL--------ESPGI---CSNGQCINTDGSFRCECP---MGYNLDYTGVRCVDTDECSIGNPCGN---------GTCTNVIGSFECNCNEGFEPGPM----MNCEDI-NECAQNPLLC-AFRCMNT-FGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLI------GTFMCICPPGMARRPDGEGCVDENECRTK------PGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQG------LCFAEVLQTICQ-------------------------------------MASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRD-----IDECKVMPNLCTNGQCINTMGS-FRCFCKVGYTTDISGTSC-IDLDECSQSPKPCNYICKNTEGSY------QCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTL------GGFTCKCPPGFTQHHT--ACIDNNECGSQPSLCG------AKGICQNT-PGSFSCECQRGFSLDATGLNCEDVD--ECDGN-HRCQHG-CQNILGGYRCGCPQGYIQHYQWNQC---------VDENECSNPN--------------ACGSASCYNTLGSYKCACPSGFSFDQFSSAC-HDVNECSSSKNPCNYGCSNTEGGYLCGCPPGY 2725          

HSP 6 Score: 117.087 bits (292), Expect = 1.380e-25
Identity = 227/954 (23.79%), Postives = 356/954 (37.32%), Query Frame = 1
Query:  340 NGKCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQV--AWGNPCVFCDR-----------NYCPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQ-GYNND----QECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGF-IRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC--------VRYKQTEP------PAVRLCSK-----WEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLS------KDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICDLHREK----------CKTG--------ICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDI-------SEVSYQNPQSQSFCTRKE-----IIEKCQPGK------CVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            N  CIC   Y     G +C     S CY   +   C++      ++K  CC  + V  AW  PC  C             N     F     +  DIDEC +   IC NG CIN+ GSFRC+CP     ++  + C+   D+C    + C     C+  S G Y C C   + +S NG +C+ +   N C     +C  +G C     SY C C +GF  S+D+  C+   + D C+       C  G+C +    Y CLC   ++  +NND     EC  +               +  +C  G C +    + C C+EG+  T + + CI     T++C      C  G CQ L+ + + C C  G+ ++SEN   CI         +IC L+G    T       P  + C C  G+  S++ + C    Q   +C     + +C   +   N    +C C  K      G  C        V ++   P      P++    +      E   +C  G+C++T+ ++ C+C  GY     G +C   ++     P             C  G C  +    F+C C  GF     G   + E +++C  N  +C   RC  +  S + C CP   +L       KD   C       E     C  L+    C          IC PG     DG+ C    +  +   + +              +Y C+C  G+  S +G  C+ +   L    + ++IC +              C  G        +C   G   Y   C  G    TD +     D  +C V    C  G C + +  + C C   YT   +G  CI      +S          +E SYQ    + +  +++      +++CQ  +      CV     + CKCP  F  +   H    D+N+C
Sbjct: 1714 NYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELP-FNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCE-DIDECSNGDNLCQRNADCI-NSPGSYRCECAAGFKLSPNG-ACVDR---NECLEIPNVC-SHGLCVDLQGSYQCICHNGFKASQDQTMCM---DVDECER----HPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSF---------------FGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCID----TNECVALPGSCSPGTCQNLEGS-FRCICPPGYEVKSEN---CIDINECDEDPNIC-LFGSCTNT-------PGGFQCLCPPGFVLSDNGRRCFDTRQ--SFCFTNFENGKCSVPK-AFNTTKAKCCCS-KMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNP-------------CGNGTCT-NVIGSFECNCNEGFEP---GPMMNCEDINECAQNPLLCA-FRCMNTFGS-YECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMC----------ICPPGMARRPDGEGCVDENECRTKPGICENGRCVNII-----GSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGR-----DIDECKVMPNLCTNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNYICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQH---HTACIDNNEC 2575          

HSP 7 Score: 105.916 bits (263), Expect = 3.381e-22
Identity = 239/1042 (22.94%), Postives = 364/1042 (34.93%), Query Frame = 1
Query:  157 GWIKNVYGDCVK-SECDYD-CGYGRCV---GLNVCECYDKTIRTETCPQNNQKLCTNNCSNKG-QCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFN-GKSCIKKTNYNVCNYFKKLCLPYGE-CQPYGLSYYCSCPSG----FHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQS-----EDRKYC------IKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTE--------------PPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEP---DNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENIC-------TPG------------------------RCERSG-----------NSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKI---IAVKSVDISEVSYQNPQSQSFCTRKEII---------EKCQPG--------KCVEKQEDYQCKCPHSFKTNYYD----HECVRDSNKC 2934
            G+ ++  GDC+   EC  + C  G CV   G   C+C+    RT   P     +  + C   G  C+NG+C+   G F   CN                + T +       + C+   +     C+  D ++   C  GF    N   C D+DECQ   IC+NG CIN +GSFRC CPP   +  +   C     +   YG              G    +C++P+  +    + C    +Y            +GE CQP        CP+     FH        I     DI +     + C  G C +    YRC CN  Y+   + + C+     E LV+R         LC+ G C +    Y C C  G+        C  I    S        C  G C+  +  ++ C+C  G   S  G  CI + +    T    +   RC+  +      +E  CA L     S     E    C      IK    +D  + +     C  G+CV++  S+ C C         G+ C+  +  +              P   R+ +         G EC +                  G   +     +T  P   D + C  + +   C  G+C  +    FKC C  GF    + R+C    +D+C  + ++C       TPG                         CER+              +F+C CP    LS     C+ IN  +          L + L C +G CVN     +C C PGY+++ D + C  I++   +                 + +YEC C  GY    +GRSC   +       ICD        G C  I   +Y C C  G+  + D K+CI  D  +C +N   C  G C +    ++C C   Y+V +    C       I   + D+       P S     R+  I         ++C  G        +CV     Y+C C   F  + +      EC  + N C
Sbjct:  524 GYKQDANGDCIDVDECTSNPCTNGDCVNTPGSYYCKCHAGFQRT---PTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGF-------------ELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYG--------------GIKKGVCVRPFPGAVTKSECCCANPDYG-----------FGEPCQP--------CPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDI--DECLVNRL--------LCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESN------PCVNGACRN-NLGSFNCECSPGSKLSSTGLICIDSLK---GTCWLNIQDSRCEVNINGATLKSE-CCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEEC---PKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINEC--KAFPGMCTYGKCR-NTIGSFKCRCNSGFALDMEERNC--TDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECS----------LSDNL-CRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIM------NGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICD-------GGQCTNI-PGEYRCLCYDGFMASMDMKTCI--DVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLC 1460          

HSP 8 Score: 104.375 bits (259), Expect = 1.086e-21
Identity = 217/884 (24.55%), Postives = 320/884 (36.20%), Query Frame = 1
Query:  508 PCVFCDRNYCPKGFTQKEN-RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGG-----------------SCVDLNNDY----YCQCSEGFYATENRRRCIKIETIT------SQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIE------------KQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFR---CVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQA-TDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFDENSIST----CSCSENYENLFD 3015
            P V   R  C  G+ Q  N  C D+DEC   + C NG+C+N  GS+ C+C           +C    D+C   G  C   G+CV T DG + CIC   + ++ +GK+C+        N    +CL  G C     S+ C C  GF  + + + C   ++ D CQ+P I   C  G C++    +RC C                G +  +  R C  +   S C GG                  C   N DY     CQ      + E    C     IT      ++CAL+   C  G C+ L   +Y C C  G+    +GR+CI  +        C +    C  G+C    P  Y C C  GY    + + C      +D   N+  S  C  G C +N  S+ C C      S+ G  C+   +        C      S C+    V+ N                G  C R E            K VT E  N     + +   C  GRC+  K   F C C  G T    GR C    ++QC    +      C       FR   C C   A+   +   C       +P TK  + L     C  G    +R     G    +D  EC     + +                    +++C+C +G+      R+C   +        C +  + C +GIC       + C C  GY+      K+C+ +D  +C  N   C+GG C +    + C C   + ++ +  DC         VDI+E S  +               C+ GKCV     YQC C   ++    D +   D ++C     GC  + + S     CSCSE Y  + D
Sbjct:  512 PTVSSYRCECNMGYKQDANGDCIDVDECT-SNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQAC-IDIDECIQNGVLC-KNGRCVNT-DGSFQCICNAGFELTTDGKNCVDHDECTTTN----MCL-NGMCINEDGSFKCICKPGFVLAPNGRYC---TDVDECQTPGI---CMNGHCINSEGSFRCDC--------------PPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENL-RGSYRCNCNSGYEPDASGRNCIDIDE-------CLVNRLLCDNGLCRNT-PGSYSCTCPPGYVFRTETETC------EDI--NECESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKG------TCWLNIQDSRCE----VNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNE---CEVFPGVCPNGRCVNSKG-SFHCECPEGLTLDGTGRVCLDIRMEQCYLKWD---EDECIHPVPGKFRMDACCCAVGAAWGTECEEC------PKPGTKEYETL-----CPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTI-----------GSFKCRCNSGFALDMEERNCTDIDE-------CRISPDLCGSGICVNT-PGSFECECFEGYESGFMMMKNCMDID--ECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDC---------VDINECSLSD-------------NLCRNGKCVNMIGTYQCSCNPGYQATP-DRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPD 1277          

HSP 9 Score: 102.834 bits (255), Expect = 2.640e-21
Identity = 234/1039 (22.52%), Postives = 369/1039 (35.51%), Query Frame = 1
Query:  328 GQCQNG----KCICESGYF--GEDCNTAIISTCYVKID---RGLCKSTPENLQ-----------------LSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDECQFK-SICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLV--------------SRYCSKSEYYSLCEGGSCVDLN-------------------NDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVR------YKQTEPPA--------------------VRLCSKW-------------EYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLI----------------NYVTTEPTTKYCDILVNRLR--------CASGNCVNDRCICG--PGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYG-------CFDENSISTCSCSENYENLFDTGLCI 3030
            G+C+N     KC C SG+    E+ N   I  C +  D    G+C +TP + +                 +  +EC     +  G  CV  + ++   CP G     +R  C DI+EC    ++C NG+C+N  G+++C C P +    +   C    D+C +    C    +C   S+G Y C C + Y++  +G+SC    + + C     +C   G+C      Y C C  GF  S D K+CI  +  D+      +  C  G C +    + C C   Y        C      E                 S  CS  E + +  G  C+DL+                     Y C CSEGF  T +   C  ++    +CA N   C+ G+C  +    Y C+C  GF  + + RSC   +           + + C  G C  + P  + C C +GY        C   ++  D          C  G CV+    Y C C   +  +  G  CV       Y +  P                        L   W             EYY+LC GGE                     G + + I   + E+ D      QE    C GG CI   T+G F+C C  G+  + D R C  E +D+C  +  +C PG C  +   N+ C+CP        GH+C+                 N +    T + C    N  +        C +    + + ICG  PG+       +   I++   I  +                ++ C+C  G+  ++    C   +      ++C  + +   +          Y C C  G+K + +      +D  +C      C  G C D+   Y CIC   +  +++   C+         D+ E           C R      C  G C      Y C C   F+  + +++C+ D ++C   F+G       CF+E     C C+E YE   D   CI
Sbjct: 1087 GKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCT-DIDECMIMNGGCDT--QCT-NSEGSYECSCSEGYALMPDGRSC---ADIDECENNPDIC-DGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDL-----NSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGW-IGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGF--TGDGFTCSDVD----ECAENINLCENGQCLNVPGA-YRCECEMGFTPASDSRSCQDIDECS--------FQNICVFGTCNNL-PGMFHCICDDGYELDRTGGNCTDIDECAD-------PINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGE---------------------GFRPNPI-TIILEDIDE----CQELPGLCQGGNCI--NTFGSFQCECPQGYYLSEDTRIC--EDIDECFAHPGVCGPGTCYNT-LGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQI-----GSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINS-------PGSYRCECAAGFKLSPNGA---CVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCM---------DVDE-----------CER----HPCGNGTCKNTVGSYNCLCYPGFELTH-NNDCL-DIDECSS-FFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCI 2015          

HSP 10 Score: 100.523 bits (249), Expect = 1.654e-20
Identity = 178/760 (23.42%), Postives = 274/760 (36.05%), Query Frame = 1
Query:  307 TNNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKI---DRGLCKSTPENLQLSKE----------ECCSIFQVAWGNPCVFCDRNYCPKGF----------TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-QYRRDQCQL-YG--------------------SSCGIFGK--------CVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENR-------RRCIKIETITSQCALNQFQCQGGRCQELDN-----------------NNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENG-----RKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEK 2313
            T+ CS   QC N     +C C  G+ G+    + +  C   I   + G C + P   +   E           C  I + ++ N CVF   N  P  F           +    C DIDEC     C+NG C+N  G + C CPPD  L+   + C   R   C L +G                    S C   GK        C P +  +Y  +C        N  + I + + + C     LC   G C     S+ C CP G++ SED + C      DI +       C  G+C +    Y C+C  EY   N    C+       +   +C +S   + CE     ++     C C+       N+             +TI        F    G+  ++D                   ++ C+C  GF  ++    C   +   N  ++C+       +       P  Y C C  G+  S +     +NE         EI   C  G CV    SY+C+CH  + +S +   C+   + E               C  G C +T  +Y C C  G+  T N       +CS    QV                 C  GRC  ++   FKCLC  G+    DG++C     ++C+     C+PG C+    S FRC+CP    +  +  +C+ IN    +P             C  G+C N     +C+C PG+  S++G+ C+   +
Sbjct: 1416 THQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILE-DIDECQELPGLCQ-GGNCINTFGSFQCECPQGYYLSEDTRIC-----EDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMD------MRKSFCYRSYNGTTCENELPFNVTKRMCC-CTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINS-------PGSYRCECAAGFKLSPNGACVDRNECL-------EIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECE------------RHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQV-----------------CRNGRCF-NEIGSFKCLCNEGYELTPDGKNCID--TNECVALPGSCSPGTCQNLEGS-FRCICPPGYEVKSE--NCIDINECDEDPNI-----------CLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQ 2101          

HSP 11 Score: 85.8853 bits (211), Expect = 3.823e-16
Identity = 199/855 (23.27%), Postives = 304/855 (35.56%), Query Frame = 1
Query:  577 IDECQFKS-ICLNGECINEKGSFRCQCPPDHYLDEN--------------------------------------TMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGG-----------------SCVDLNNDY----YCQCSEGFYATENRRRCIKIETIT------SQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIE------------KQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCL--NNENIC---TPGR--------------------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRL---RCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKE 2811
            ID C+  + +CLNG CI    S+RC+C   +  D N                                      T       D+C   G  C   G+CV T DG + CIC   + ++ +GK+C+        N    +CL  G C     S+ C C  GF  + + + C   ++ D CQ+P I   C  G C++    +RC C                G +  +  R C  +   S C GG                  C   N DY     CQ      + E    C     IT      ++CAL+   C  G C+ L   +Y C C  G+    +GR+CI  +        C +    C  G+C    P  Y C C  GY    + + C      +D   N+  S  C  G C +N  S+ C C      S+ G  C+   +        C      S C+    V+ N                G  C R E            K VT E  N     + +   C  GRC+  K   F C C  G T    GR C    ++QC    +E+ C    PG+                    C + G   +  +CP  A  +  G     + +T  P  K  DI   +     C  G C N     +C C  G+    + + C  I++             G G       ++EC+C  GY   E+G   +K+    +    C+ +   C+ G C    +  + C C LG++ +  ++ C+ ++  +C++++  C+ G C +++  Y C C   Y  T + + C          DI E    N    + CT  E
Sbjct:  495 IDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLC-KNGRCVNT-DGSFQCICNAGFELTTDGKNCVDHDECTTTN----MCL-NGMCINEDGSFKCICKPGFVLAPNGRYC---TDVDECQTPGI---CMNGHCINSEGSFRCDC--------------PPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENL-RGSYRCNCNSGYEPDASGRNCIDIDE-------CLVNRLLCDNGLCRNT-PGSYSCTCPPGYVFRTETETC------EDI--NECESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKG------TCWLNIQDSRCE----VNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNE---CEVFPGVCPNGRCVNSKG-SFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRG-----DVLTGRPFYK--DINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECR-----ISPDLCGSGICVNTPGSFECECFEGY---ESGFMMMKN---CMDIDECERNPLLCRGGTCVNT-EGSFQCDCPLGHELSPSREDCVDIN--ECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGC---------TDIDECMIMNGGCDTQCTNSE 1261          

HSP 12 Score: 62.3882 bits (150), Expect = 6.923e-9
Identity = 110/428 (25.70%), Postives = 161/428 (37.62%), Query Frame = 1
Query:  310 NNCSNK-GQCQNGKCICESGYFGEDCNTAIIST-------------CYVKIDRGLCK--STPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQ-FKSICLNGECINEKGSF-----------------------------------------RCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGR 1398
            N C  K G C+NG+C+   G +  +CN    S+             C+ ++ + +C+  S+  NL ++K ECC      WG+ C  C        +  CP G     +   DIDEC+   ++C NG+CIN  GSF                                         +C CP  + L E+  +C+   D+CQ    +C     CV T  G +TC C  P   + +  +CI     N C     LC   G CQ    S+ C C  GF       +C    + D C       RC+ G C +   GYRC C   Y  +    +CV            CS     + C   SC +    Y C C  GF   +    C  +    ++C+ ++  C  G C   +   Y C C  G+ R   G 
Sbjct: 2340 NECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNL-VTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDG-RDIDECKVMPNLCTNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNYICKNTEGSYQCSCPRGYVLQEDGKTCK-DLDECQTKQHNCQFL--CVNTLGG-FTCKC--PPGFTQHHTACIDN---NECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNC---EDVDECDG---NHRCQHG-CQNILGGYRCGCPQGYIQHYQWNQCVD--------ENECSNP---NACGSASCYNTLGSYKCACPSGFSFDQFSSACHDV----NECSSSKNPCNYG-CSNTE-GGYLCGCPPGYYRVGQGH 2732          
BLAST of Fibrillin-2 vs. Ensembl Human
Match: FBN2 (fibrillin 2 [Source:HGNC Symbol;Acc:HGNC:3604])

HSP 1 Score: 157.147 bits (396), Expect = 7.260e-38
Identity = 242/1008 (24.01%), Postives = 363/1008 (36.01%), Query Frame = 1
Query:  253 YDKTIRTETCPQNNQKLCTNNCSNKGQCQNG----KCICESGY----FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-YCPKGFTQ-KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-----------------------QYRRDQC-----QLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNY---NVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI-----------------VNSNSDI-----------------CQSPEIAER----CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTE--------------PPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQ-----------------EYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSIC-----DLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            Y     TETC   N+  C +N    G C+N      C C  G      G  C  ++  TC++ I    C+       L K ECC+    AWG+PC  C+ +  CP+G  + K   C+D++EC+ F  +C NG C+N KGSF C+CP    LD     C                       ++R D C       +G+ C    +C      +Y  +C +    +  G     +  Y   N C  F  +C  YG+C+    S+ C C SGF    ++++C                  VN+                     C   +  ER    CRGG+CV+    ++C C   ++   + ++CV            CS S+  +LC  G CV++   Y C C+ G+ AT +R+ C  I+           QC           +YEC C  G+    +GRSC   +   N+  IC+  G +C         P EY C C +G+  S D K CI      D  +    S  C  G+C +   S+ C C   Y        C    + E               P    CS  E + +  G +C+D                 NG     I  Q    P +  C                    E ++ C  G+C+ +    ++C C  GFT ASD RSC  + +D+C + +NIC  G C       F C+C     L + G +C              D   + + C +G CVN      C C P ++ +  G  C                          DN      L    + +   SC       + +S C           C+T  C P+   +Y   C  G     +  + I+ D  +C      C+GG C +    + C C   Y ++E+ R C          DI E  + +P              C PG C     +Y C CP  +      H C+
Sbjct:  841 YVFRTETETCEDINE--CESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATL-KSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECE---ECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCT-YGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDI--------NECSLSD--NLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSE------GSYECSCSEGYALMPDGRSCADIDECENNPDICD--GGQCTN------IPGEYRCLCYDGFMASMDMKTCI------DVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGW-IGNGIKCIDL------------DECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCL-NVPGAYRCECEMGFTPASDSRSC--QDIDEC-SFQNICVFGTCNNL-PGMFHCICDDGYELDRTGGNC-----------TDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCV-------------------------DNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCET--CPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRIC---------EDIDEC-FAHPGV------------CGPGTCYNTLGNYTCICPPEYMQVNGGHNCM 1733          

HSP 2 Score: 128.257 bits (321), Expect = 5.132e-29
Identity = 232/1006 (23.06%), Postives = 359/1006 (35.69%), Query Frame = 1
Query:  310 NNCSNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKI----DRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR-------NYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSV-----------------SFNGKSCIKKTNYNV------CNY-----FKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCE-GGSCVDLNNDYYCQCSEGFYATEN-----RRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQ------ECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNN--ENICT-----------------PGR--------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFDENSISTCSCSENYENLFDTGLC 3027
            + C++   C NG C+   G +             G  C    +  CY+K     D  L  +T   + +S+  CC     AWGNPC  C           CP G   + N      +DIDECQ    +C  G CIN  GSF+C+CP  +YL E+T  C+   D+C  +   CG  G C  T  G YTCIC   Y                   S+NG +C  +  +NV      C Y     + K C P            C    GF         +     DI +  EI   C  G C+++   +RC C   +    ND   V     E      CS  +  +LC+    C++    Y C+C+ GF  + N     R  C++I  +          C  G C +L   +Y+C C  GF  S++   C+  +         E   H C  G C       Y C C  G+  + +   C+  ++   +       + CR G+C +   S++C+C+  Y  + +G+      ECV    +  P      +  +  +C  G  V +                    C  I  +  E+P+            C+ G C  +   GF+CLC PGF  + +GR C       C  N     C+                 PG         C +     F+ +CPY       GH  + +   T      C  L +   C++G C+N     RC C  GY     G  C   ++ S         C           ++EC C  G+       +C           +C     +C            Y C C +GY    D+K C  +D     +++   +G  C +++  ++CIC        +G  C+                     ++ C  K  I  C+ G+CV     Y+C+C   F+++    EC+ +          CF E   + C  + +  NL     C
Sbjct: 1534 DECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICE-DIDECFAHPGVCGP-GTCYNTL-GNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAV-----DIDECKEIPGICANGVCINQIGSFRCECPTGFS--YNDLLLVCEDIDE------CSNGD--NLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNV----------CSHGLCVDL-QGSYQCICHNGFKASQDQTMCMDVD---------ECERHPCGNGTCKNTV-GSYNCLCYPGFELTHNND-CLDIDECSSF-----FGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKS------------------ENCIDI-NECDEDPN-----------ICLFGSCT-NTPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPY-------GHGTVPSLHDTREDVNEC--LESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCTNVI------GSFECNCNEGFEPGPM-MNCEDINECAQNPLLCAF---RCMNTF------GSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCV--------------------DENECRTKPGI--CENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGL------CFAEVLQTICQMASSSRNLVTKSEC 2410          

HSP 3 Score: 124.79 bits (312), Expect = 5.192e-28
Identity = 253/1072 (23.60%), Postives = 385/1072 (35.91%), Query Frame = 1
Query:  325 KGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR-------NYCPKGFTQKENRCD---------DIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNG-KSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGT------------SEPLVSRYCSKSEYYSL-------------------CEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLIN-----YVTTEPTTK-----YCDILVNRLR----CASGNCVNDRCICGPGYKSSE-----DGKECYKIEKVSSIXXXXXXXXXXXXXXXXDD-----NNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKC--AVNEYRCKGGYCYDIVDGYLCICVGNY--------------------TVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYY-------------DHECVR----------------------------DSNKCP----YCFYG-CFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTCR 3078
             G C NG+C+   G F             G  C    +  CY+K D   C   P   +   + CC     AWG  C  C +         CP+G     NR D         DI+EC+ F  +C  G+C N  GSF+C+C     LD    +C    D+C++    CG  G CV T  G + C C + Y   F   K+C+   + + C     LC   G C     S+ C CP G   S  ++ C+     DI +       CR G CV+    Y+C CN  YQ   + Q C                 +    S  CS SE Y+L                   C+GG C ++  +Y C C +GF A+ + + CI +    ++C LN   C  G C+     ++ C C  G+   +    C   +        CE+  H C         P  + C+C EG+  +  +  CI  ++  +      I+      QCV+   SYRC C   +  + +G  C    +            E  +LC+ G+C++    Y C+C  G+    + R C  I++          C  Q     C+ G C  +    F C+C  G+     G +C    +D+C +  N C  G C  +    + C CP    L+  G  C+ N     Y+   P          +I V   R    C+ G    + C   P   S+E      G E ++   ++ I        +  G  +  +      +++C+C  GY  SE+ R C   +        C  H   C  G CY    N Y C C   Y Q     +C+ M    C  + N   C+    +++    +C C  N                     T+  N       I   K+VDI E              KEI   C  G C+ +   ++C+CP  F  N               D+ C R                            D N+C      C +G C D      C C   ++   D  +C+   +   +  G+ TC+
Sbjct:  963 PGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIH-PVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRG-AGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCT-DIDECRISPDLCG-SGICVNTP-GSFECECFEGYESGFMMMKNCM---DIDECERNPLLCR-GGTCVNTEGSFQCDCPLGHELSPSREDCV-----DINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDV----NECDLNSNICMFGECENT-KGSFICHCQLGYSVKKGTTGCTDVDE-------CEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIK--CIDLDECSNGTHQCSINA-----QCVNTPGSYRCACSEGF--TGDGFTCSDVDECA----------ENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDE----------CSFQNI---CVFGTC-NNLPGMFHCICDDGYELDRTGGNC--TDIDECADPIN-CVNGLCVNT-PGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDE-------CFAHPGVCGPGTCYNTLGN-YTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTK-RMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDEC-------------KEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPCGNGTCK 1949          

HSP 4 Score: 123.25 bits (308), Expect = 1.603e-27
Identity = 234/1014 (23.08%), Postives = 344/1014 (33.93%), Query Frame = 1
Query:  148 CCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNY-------------------------------------CPKGFTQKEN--RCDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCI--CIKP---YSVSFNGKSCIKKTNYNVCNYFKKLC---LPYGEC------QPYGLSYYCSCPS--------------------GFHQSEDKKSC-------IVNSNSDICQSPEI----AERCRGGSCVSEGKGYRCLCNGEY-QGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLP----------GFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICD-------LHREKCKT-GICY--PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CC GW     G+ C+   C   CG G C   N+C C    I + TC   + + C+  C N G C +  C C+ GY G  C   +                                    C+ +++  +C+     +  +K  CC+    AWG+PC  C        R +                                     CP G  Q E   +C+DIDEC     IC  GEC N  GS+ C CP  +    +   C  +R      G    + G+C     G+ T +  C +P   + +    ++C  + +      +++LC   LP G        +P G       PS                    GF                I+   + + Q+ +I    A  C  G C+     YRC CN  Y Q  N D   V   TS P              C  G CV+    YYC+C  GF  T  ++ CI I+    +C  N   C+ GRC   D  +++C C  GF  + +G++C+  +    +        + C  G+C       + C C  G+  + + +YC       D CQ   I   C  G C+++  S+RC C        +G              R+C      S C GG                            I+K V   P        E         C  +  YGF   C P          G  S+  G + D   +++C  + +IC  G CE    S +RC C         G +C+             + LVNRL C +G C N      C C PGY    + + C  I +  S            G    +  ++ C+C  G   S  G  CI S        I+ S C+       L  E C T G  +  P  + +   AC  G  +    K     D  +C V    C  G C +    + C C    T+   GR C+
Sbjct:   97 CCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSSGQI-SSTCGSKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCIDQRTGMCFSGL---VNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGS----EEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNP--------------CTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDID----ECIQNGVLCKNGRCVNTD-GSFQCICNAGFELTTDGKNCVDHDECTTT--------NMCLNGMCI-NEDGSFKCICKPGFVLAPNGRYCTD----VDECQTPGI---CMNGHCINSEGSFRCDCPPGLAVGMDG--------------RVCVDTHMRSTCYGG----------------------------IKKGVCVRPFPGAVTKSEC--------CCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGS-YRCNCNSGYEPDASGRNCI----------DIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECES-------NPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARI---KGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCL 996          

HSP 5 Score: 119.013 bits (297), Expect = 3.271e-26
Identity = 242/956 (25.31%), Postives = 353/956 (36.92%), Query Frame = 1
Query:  205 YDCGYGRC---VGLNVCECYDKTIRTETCPQNNQKLCTNNCSNK-GQ-CQNGKCICESGYFGEDCNTAIISTCYVK--IDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKC-VPTS--DGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVR-YGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDK--------TYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY----CFYGCFDENSISTCSCSENY 3000
            + CG G C   VG   C CY     T     NN  L  + CS+  GQ C+NG+C  E G F   CN     T   K  ID   C + P +        C   + ++        R  CP G+  K   C DI+EC +  +ICL G C N  G F+C CPP   L +N   C   R   Q +  +    GKC VP +    +  C C K     +     +   +  V   F+ LC       PYG   + + PS     ED   C+        +SP I   C  G C++    +RC C     GYN D   VR   T E  +   C           G+C ++   + C C+EGF         +  E I ++CA N   C   RC      +YEC C  G+   E+ + C   +        CE  G  C+  +        ++C C  G ++  D + C+   + +           C  G+CV+   SYRC C+  + SS++G EC+  +Q       LC      ++CQ                                        +S  L+ +    C GGR  G +        T  +K +C  G    +DGR      +D+C    N+CT G+C  +  S FRC C    +    G SC I+      + K C+ +      +       +C C  GY   EDGK C  +++  +     Q  C            + C+C  G+ +     +CI +     + S+C         GIC       + C C  G+       +C  +D  +C  N +RC+ G C +I+ GY C C   Y        C         VD +E S  N               C    C      Y+C CP  F  + +   C  D N+C      C YGC +      C C   Y
Sbjct: 1941 HPCGNGTCKNTVGSYNCLCYPGFELT----HNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGT---CQNLEGSF--------RCICPPGYEVKSENCIDINECDEDPNICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTR---QSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEV--AFQDLC-------PYG---HGTVPSLHDTREDVNECL--------ESPGI---CSNGQCINTDGSFRCECP---MGYNLDYTGVRCVDTDECSIGNPCGN---------GTCTNVIGSFECNCNEGFEPGPM----MNCEDI-NECAQNPLLC-AFRCMNT-FGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLI------GTFMCICPPGMARRPDGEGCVDENECRTK------PGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQG------LCFAEVLQTICQ-------------------------------------MASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRD-----IDECKVMPNLCTNGQCINTMGS-FRCFCKVGYTTDISGTSC-IDLDECSQSPKPCNYICKNTEGSY------QCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTL------GGFTCKCPPGFTQHHT--ACIDNNECGSQPSLCG------AKGICQNT-PGSFSCECQRGFSLDATGLNCEDVD--ECDGN-HRCQHG-CQNILGGYRCGCPQGYIQHYQWNQC---------VDENECSNPN--------------ACGSASCYNTLGSYKCACPSGFSFDQFSSAC-HDVNECSSSKNPCNYGCSNTEGGYLCGCPPGY 2725          

HSP 6 Score: 117.087 bits (292), Expect = 1.380e-25
Identity = 227/954 (23.79%), Postives = 356/954 (37.32%), Query Frame = 1
Query:  340 NGKCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQV--AWGNPCVFCDR-----------NYCPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQ-GYNND----QECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGF-IRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC--------VRYKQTEP------PAVRLCSK-----WEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLS------KDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICDLHREK----------CKTG--------ICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDI-------SEVSYQNPQSQSFCTRKE-----IIEKCQPGK------CVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            N  CIC   Y     G +C     S CY   +   C++      ++K  CC  + V  AW  PC  C             N     F     +  DIDEC +   IC NG CIN+ GSFRC+CP     ++  + C+   D+C    + C     C+  S G Y C C   + +S NG +C+ +   N C     +C  +G C     SY C C +GF  S+D+  C+   + D C+       C  G+C +    Y CLC   ++  +NND     EC  +               +  +C  G C +    + C C+EG+  T + + CI     T++C      C  G CQ L+ + + C C  G+ ++SEN   CI         +IC L+G    T       P  + C C  G+  S++ + C    Q   +C     + +C   +   N    +C C  K      G  C        V ++   P      P++    +      E   +C  G+C++T+ ++ C+C  GY     G +C   ++     P             C  G C  +    F+C C  GF     G   + E +++C  N  +C   RC  +  S + C CP   +L       KD   C       E     C  L+    C          IC PG     DG+ C    +  +   + +              +Y C+C  G+  S +G  C+ +   L    + ++IC +              C  G        +C   G   Y   C  G    TD +     D  +C V    C  G C + +  + C C   YT   +G  CI      +S          +E SYQ    + +  +++      +++CQ  +      CV     + CKCP  F  +   H    D+N+C
Sbjct: 1714 NYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELP-FNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCE-DIDECSNGDNLCQRNADCI-NSPGSYRCECAAGFKLSPNG-ACVDR---NECLEIPNVC-SHGLCVDLQGSYQCICHNGFKASQDQTMCM---DVDECER----HPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSF---------------FGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCID----TNECVALPGSCSPGTCQNLEGS-FRCICPPGYEVKSEN---CIDINECDEDPNIC-LFGSCTNT-------PGGFQCLCPPGFVLSDNGRRCFDTRQ--SFCFTNFENGKCSVPK-AFNTTKAKCCCS-KMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNP-------------CGNGTCT-NVIGSFECNCNEGFEP---GPMMNCEDINECAQNPLLCA-FRCMNTFGS-YECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMC----------ICPPGMARRPDGEGCVDENECRTKPGICENGRCVNII-----GSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGR-----DIDECKVMPNLCTNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNYICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQH---HTACIDNNEC 2575          

HSP 7 Score: 105.916 bits (263), Expect = 3.381e-22
Identity = 239/1042 (22.94%), Postives = 364/1042 (34.93%), Query Frame = 1
Query:  157 GWIKNVYGDCVK-SECDYD-CGYGRCV---GLNVCECYDKTIRTETCPQNNQKLCTNNCSNKG-QCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFN-GKSCIKKTNYNVCNYFKKLCLPYGE-CQPYGLSYYCSCPSG----FHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQS-----EDRKYC------IKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTE--------------PPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEP---DNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENIC-------TPG------------------------RCERSG-----------NSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKI---IAVKSVDISEVSYQNPQSQSFCTRKEII---------EKCQPG--------KCVEKQEDYQCKCPHSFKTNYYD----HECVRDSNKC 2934
            G+ ++  GDC+   EC  + C  G CV   G   C+C+    RT   P     +  + C   G  C+NG+C+   G F   CN                + T +       + C+   +     C+  D ++   C  GF    N   C D+DECQ   IC+NG CIN +GSFRC CPP   +  +   C     +   YG              G    +C++P+  +    + C    +Y            +GE CQP        CP+     FH        I     DI +     + C  G C +    YRC CN  Y+   + + C+     E LV+R         LC+ G C +    Y C C  G+        C  I    S        C  G C+  +  ++ C+C  G   S  G  CI + +    T    +   RC+  +      +E  CA L     S     E    C      IK    +D  + +     C  G+CV++  S+ C C         G+ C+  +  +              P   R+ +         G EC +                  G   +     +T  P   D + C  + +   C  G+C  +    FKC C  GF    + R+C    +D+C  + ++C       TPG                         CER+              +F+C CP    LS     C+ IN  +          L + L C +G CVN     +C C PGY+++ D + C  I++   +                 + +YEC C  GY    +GRSC   +       ICD        G C  I   +Y C C  G+  + D K+CI  D  +C +N   C  G C +    ++C C   Y+V +    C       I   + D+       P S     R+  I         ++C  G        +CV     Y+C C   F  + +      EC  + N C
Sbjct:  524 GYKQDANGDCIDVDECTSNPCTNGDCVNTPGSYYCKCHAGFQRT---PTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGF-------------ELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYG--------------GIKKGVCVRPFPGAVTKSECCCANPDYG-----------FGEPCQP--------CPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDI--DECLVNRL--------LCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESN------PCVNGACRN-NLGSFNCECSPGSKLSSTGLICIDSLK---GTCWLNIQDSRCEVNINGATLKSE-CCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEEC---PKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINEC--KAFPGMCTYGKCR-NTIGSFKCRCNSGFALDMEERNC--TDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECS----------LSDNL-CRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIM------NGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICD-------GGQCTNI-PGEYRCLCYDGFMASMDMKTCI--DVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLC 1460          

HSP 8 Score: 104.375 bits (259), Expect = 1.086e-21
Identity = 217/884 (24.55%), Postives = 320/884 (36.20%), Query Frame = 1
Query:  508 PCVFCDRNYCPKGFTQKEN-RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGG-----------------SCVDLNNDY----YCQCSEGFYATENRRRCIKIETIT------SQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIE------------KQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFR---CVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQA-TDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFDENSIST----CSCSENYENLFD 3015
            P V   R  C  G+ Q  N  C D+DEC   + C NG+C+N  GS+ C+C           +C    D+C   G  C   G+CV T DG + CIC   + ++ +GK+C+        N    +CL  G C     S+ C C  GF  + + + C   ++ D CQ+P I   C  G C++    +RC C                G +  +  R C  +   S C GG                  C   N DY     CQ      + E    C     IT      ++CAL+   C  G C+ L   +Y C C  G+    +GR+CI  +        C +    C  G+C    P  Y C C  GY    + + C      +D   N+  S  C  G C +N  S+ C C      S+ G  C+   +        C      S C+    V+ N                G  C R E            K VT E  N     + +   C  GRC+  K   F C C  G T    GR C    ++QC    +      C       FR   C C   A+   +   C       +P TK  + L     C  G    +R     G    +D  EC     + +                    +++C+C +G+      R+C   +        C +  + C +GIC       + C C  GY+      K+C+ +D  +C  N   C+GG C +    + C C   + ++ +  DC         VDI+E S  +               C+ GKCV     YQC C   ++    D +   D ++C     GC  + + S     CSCSE Y  + D
Sbjct:  512 PTVSSYRCECNMGYKQDANGDCIDVDECT-SNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQAC-IDIDECIQNGVLC-KNGRCVNT-DGSFQCICNAGFELTTDGKNCVDHDECTTTN----MCL-NGMCINEDGSFKCICKPGFVLAPNGRYC---TDVDECQTPGI---CMNGHCINSEGSFRCDC--------------PPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENL-RGSYRCNCNSGYEPDASGRNCIDIDE-------CLVNRLLCDNGLCRNT-PGSYSCTCPPGYVFRTETETC------EDI--NECESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKG------TCWLNIQDSRCE----VNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNE---CEVFPGVCPNGRCVNSKG-SFHCECPEGLTLDGTGRVCLDIRMEQCYLKWD---EDECIHPVPGKFRMDACCCAVGAAWGTECEEC------PKPGTKEYETL-----CPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTI-----------GSFKCRCNSGFALDMEERNCTDIDE-------CRISPDLCGSGICVNT-PGSFECECFEGYESGFMMMKNCMDID--ECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDC---------VDINECSLSD-------------NLCRNGKCVNMIGTYQCSCNPGYQATP-DRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPD 1277          

HSP 9 Score: 102.834 bits (255), Expect = 2.640e-21
Identity = 234/1039 (22.52%), Postives = 369/1039 (35.51%), Query Frame = 1
Query:  328 GQCQNG----KCICESGYF--GEDCNTAIISTCYVKID---RGLCKSTPENLQ-----------------LSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDECQFK-SICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLV--------------SRYCSKSEYYSLCEGGSCVDLN-------------------NDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVR------YKQTEPPA--------------------VRLCSKW-------------EYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLI----------------NYVTTEPTTKYCDILVNRLR--------CASGNCVNDRCICG--PGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYG-------CFDENSISTCSCSENYENLFDTGLCI 3030
            G+C+N     KC C SG+    E+ N   I  C +  D    G+C +TP + +                 +  +EC     +  G  CV  + ++   CP G     +R  C DI+EC    ++C NG+C+N  G+++C C P +    +   C    D+C +    C    +C   S+G Y C C + Y++  +G+SC    + + C     +C   G+C      Y C C  GF  S D K+CI  +  D+      +  C  G C +    + C C   Y        C      E                 S  CS  E + +  G  C+DL+                     Y C CSEGF  T +   C  ++    +CA N   C+ G+C  +    Y C+C  GF  + + RSC   +           + + C  G C  + P  + C C +GY        C   ++  D          C  G CV+    Y C C   +  +  G  CV       Y +  P                        L   W             EYY+LC GGE                     G + + I   + E+ D      QE    C GG CI   T+G F+C C  G+  + D R C  E +D+C  +  +C PG C  +   N+ C+CP        GH+C+                 N +    T + C    N  +        C +    + + ICG  PG+       +   I++   I  +                ++ C+C  G+  ++    C   +      ++C  + +   +          Y C C  G+K + +      +D  +C      C  G C D+   Y CIC   +  +++   C+         D+ E           C R      C  G C      Y C C   F+  + +++C+ D ++C   F+G       CF+E     C C+E YE   D   CI
Sbjct: 1087 GKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCT-DIDECMIMNGGCDT--QCT-NSEGSYECSCSEGYALMPDGRSC---ADIDECENNPDIC-DGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDL-----NSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGW-IGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGF--TGDGFTCSDVD----ECAENINLCENGQCLNVPGA-YRCECEMGFTPASDSRSCQDIDECS--------FQNICVFGTCNNL-PGMFHCICDDGYELDRTGGNCTDIDECAD-------PINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGE---------------------GFRPNPI-TIILEDIDE----CQELPGLCQGGNCI--NTFGSFQCECPQGYYLSEDTRIC--EDIDECFAHPGVCGPGTCYNT-LGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQI-----GSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINS-------PGSYRCECAAGFKLSPNGA---CVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCM---------DVDE-----------CER----HPCGNGTCKNTVGSYNCLCYPGFELTH-NNDCL-DIDECSS-FFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCI 2015          

HSP 10 Score: 100.523 bits (249), Expect = 1.654e-20
Identity = 178/760 (23.42%), Postives = 274/760 (36.05%), Query Frame = 1
Query:  307 TNNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKI---DRGLCKSTPENLQLSKE----------ECCSIFQVAWGNPCVFCDRNYCPKGF----------TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-QYRRDQCQL-YG--------------------SSCGIFGK--------CVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENR-------RRCIKIETITSQCALNQFQCQGGRCQELDN-----------------NNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENG-----RKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEK 2313
            T+ CS   QC N     +C C  G+ G+    + +  C   I   + G C + P   +   E           C  I + ++ N CVF   N  P  F           +    C DIDEC     C+NG C+N  G + C CPPD  L+   + C   R   C L +G                    S C   GK        C P +  +Y  +C        N  + I + + + C     LC   G C     S+ C CP G++ SED + C      DI +       C  G+C +    Y C+C  EY   N    C+       +   +C +S   + CE     ++     C C+       N+             +TI        F    G+  ++D                   ++ C+C  GF  ++    C   +   N  ++C+       +       P  Y C C  G+  S +     +NE         EI   C  G CV    SY+C+CH  + +S +   C+   + E               C  G C +T  +Y C C  G+  T N       +CS    QV                 C  GRC  ++   FKCLC  G+    DG++C     ++C+     C+PG C+    S FRC+CP    +  +  +C+ IN    +P             C  G+C N     +C+C PG+  S++G+ C+   +
Sbjct: 1416 THQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILE-DIDECQELPGLCQ-GGNCINTFGSFQCECPQGYYLSEDTRIC-----EDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMD------MRKSFCYRSYNGTTCENELPFNVTKRMCC-CTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINS-------PGSYRCECAAGFKLSPNGACVDRNECL-------EIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECE------------RHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQV-----------------CRNGRCF-NEIGSFKCLCNEGYELTPDGKNCID--TNECVALPGSCSPGTCQNLEGS-FRCICPPGYEVKSE--NCIDINECDEDPNI-----------CLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQ 2101          

HSP 11 Score: 85.8853 bits (211), Expect = 3.823e-16
Identity = 199/855 (23.27%), Postives = 304/855 (35.56%), Query Frame = 1
Query:  577 IDECQFKS-ICLNGECINEKGSFRCQCPPDHYLDEN--------------------------------------TMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGG-----------------SCVDLNNDY----YCQCSEGFYATENRRRCIKIETIT------SQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIE------------KQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCL--NNENIC---TPGR--------------------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRL---RCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKE 2811
            ID C+  + +CLNG CI    S+RC+C   +  D N                                      T       D+C   G  C   G+CV T DG + CIC   + ++ +GK+C+        N    +CL  G C     S+ C C  GF  + + + C   ++ D CQ+P I   C  G C++    +RC C                G +  +  R C  +   S C GG                  C   N DY     CQ      + E    C     IT      ++CAL+   C  G C+ L   +Y C C  G+    +GR+CI  +        C +    C  G+C    P  Y C C  GY    + + C      +D   N+  S  C  G C +N  S+ C C      S+ G  C+   +        C      S C+    V+ N                G  C R E            K VT E  N     + +   C  GRC+  K   F C C  G T    GR C    ++QC    +E+ C    PG+                    C + G   +  +CP  A  +  G     + +T  P  K  DI   +     C  G C N     +C C  G+    + + C  I++             G G       ++EC+C  GY   E+G   +K+    +    C+ +   C+ G C    +  + C C LG++ +  ++ C+ ++  +C++++  C+ G C +++  Y C C   Y  T + + C          DI E    N    + CT  E
Sbjct:  495 IDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLC-KNGRCVNT-DGSFQCICNAGFELTTDGKNCVDHDECTTTN----MCL-NGMCINEDGSFKCICKPGFVLAPNGRYC---TDVDECQTPGI---CMNGHCINSEGSFRCDC--------------PPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENL-RGSYRCNCNSGYEPDASGRNCIDIDE-------CLVNRLLCDNGLCRNT-PGSYSCTCPPGYVFRTETETC------EDI--NECESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKG------TCWLNIQDSRCE----VNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNE---CEVFPGVCPNGRCVNSKG-SFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRG-----DVLTGRPFYK--DINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECR-----ISPDLCGSGICVNTPGSFECECFEGY---ESGFMMMKN---CMDIDECERNPLLCRGGTCVNT-EGSFQCDCPLGHELSPSREDCVDIN--ECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGC---------TDIDECMIMNGGCDTQCTNSE 1261          

HSP 12 Score: 62.3882 bits (150), Expect = 6.923e-9
Identity = 110/428 (25.70%), Postives = 161/428 (37.62%), Query Frame = 1
Query:  310 NNCSNK-GQCQNGKCICESGYFGEDCNTAIIST-------------CYVKIDRGLCK--STPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQ-FKSICLNGECINEKGSF-----------------------------------------RCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGR 1398
            N C  K G C+NG+C+   G +  +CN    S+             C+ ++ + +C+  S+  NL ++K ECC      WG+ C  C        +  CP G     +   DIDEC+   ++C NG+CIN  GSF                                         +C CP  + L E+  +C+   D+CQ    +C     CV T  G +TC C  P   + +  +CI     N C     LC   G CQ    S+ C C  GF       +C    + D C       RC+ G C +   GYRC C   Y  +    +CV            CS     + C   SC +    Y C C  GF   +    C  +    ++C+ ++  C  G C   +   Y C C  G+ R   G 
Sbjct: 2340 NECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNL-VTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDG-RDIDECKVMPNLCTNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNYICKNTEGSYQCSCPRGYVLQEDGKTCK-DLDECQTKQHNCQFL--CVNTLGG-FTCKC--PPGFTQHHTACIDN---NECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNC---EDVDECDG---NHRCQHG-CQNILGGYRCGCPQGYIQHYQWNQCVD--------ENECSNP---NACGSASCYNTLGSYKCACPSGFSFDQFSSACHDV----NECSSSKNPCNYG-CSNTE-GGYLCGCPPGYYRVGQGH 2732          
BLAST of Fibrillin-2 vs. Ensembl Celegans
Match: Y64G10A.7 (pep chromosome:WBcel235:IV:14291901:14319564:1 gene:WBGene00013416.1 transcript:Y64G10A.7e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y64G10A.7)

HSP 1 Score: 63.929 bits (154), Expect = 7.348e-10
Identity = 103/419 (24.58%), Postives = 162/419 (38.66%), Query Frame = 1
Query:  547 FTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQ-YTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNN---NYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYC-------IKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQ 1770
             +   N C DIDEC   +   +  C+N  G FRC CP D YL  +  +C  +   C      C    +C   S+G+ Y C C   + +S N +SC      + C   K  C  +  C        C C  GFH S D++SC+   + D C      E      C +    YRC C   YQ   + + C        + +  C + + Y   +GG        + C+C  G+    +++ C  I    ++C  N      G C ++  N   + ECQC  GF   ++ ++C       ++   CE      + G         Y+C+C  G+  SED   C       I N      C+N++ S+RC+              C   YI +++ + CV    +       C    + S CQ
Sbjct:  187 LSGDGNTCSDIDECAVSNGGCSDRCVNSPGGFRCDCPSDLYLHADGRTCG-KVTSCSTDNGGCEH--ECENDSNGEFYRCRCRVGFKLSENKRSCQP---VDPCFDNKGGCQHH--CTNNHGRAQCQCYPGFHLSYDRRSCV---DIDECAKNNGCEH----FCENVKGTYRCKCREGYQLGRDGRTCEEMLGGCQVGNGGC-QHDCYDQPDGG--------HVCKCRNGYILANDQKLCHDI----NECHENN-----GDCSQICVNLAGSVECQCKPGFRLMKDRKTCEDISECSSNNGGCEQICSNQEGG---------YMCSCEPGFELSEDGHSCHDMNECLINNGGCAQLCKNRKGSRRCQ--------------CFAGYILAHDEKSCVAASDSADIFSNECPNGFFGSTCQ 549          
BLAST of Fibrillin-2 vs. Ensembl Celegans
Match: Y64G10A.7 (pep chromosome:WBcel235:IV:14291901:14319564:1 gene:WBGene00013416.1 transcript:Y64G10A.7c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y64G10A.7)

HSP 1 Score: 63.929 bits (154), Expect = 7.518e-10
Identity = 103/419 (24.58%), Postives = 162/419 (38.66%), Query Frame = 1
Query:  547 FTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQ-YTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNN---NYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYC-------IKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQ 1770
             +   N C DIDEC   +   +  C+N  G FRC CP D YL  +  +C  +   C      C    +C   S+G+ Y C C   + +S N +SC      + C   K  C  +  C        C C  GFH S D++SC+   + D C      E      C +    YRC C   YQ   + + C        + +  C + + Y   +GG        + C+C  G+    +++ C  I    ++C  N      G C ++  N   + ECQC  GF   ++ ++C       ++   CE      + G         Y+C+C  G+  SED   C       I N      C+N++ S+RC+              C   YI +++ + CV    +       C    + S CQ
Sbjct:  187 LSGDGNTCSDIDECAVSNGGCSDRCVNSPGGFRCDCPSDLYLHADGRTCG-KVTSCSTDNGGCEH--ECENDSNGEFYRCRCRVGFKLSENKRSCQP---VDPCFDNKGGCQHH--CTNNHGRAQCQCYPGFHLSYDRRSCV---DIDECAKNNGCEH----FCENVKGTYRCKCREGYQLGRDGRTCEEMLGGCQVGNGGC-QHDCYDQPDGG--------HVCKCRNGYILANDQKLCHDI----NECHENN-----GDCSQICVNLAGSVECQCKPGFRLMKDRKTCEDISECSSNNGGCEQICSNQEGG---------YMCSCEPGFELSEDGHSCHDMNECLINNGGCAQLCKNRKGSRRCQ--------------CFAGYILAHDEKSCVAASDSADIFSNECPNGFFGSTCQ 549          
BLAST of Fibrillin-2 vs. Ensembl Celegans
Match: Y64G10A.7 (pep chromosome:WBcel235:IV:14291901:14319564:1 gene:WBGene00013416.1 transcript:Y64G10A.7d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y64G10A.7)

HSP 1 Score: 62.3882 bits (150), Expect = 1.920e-9
Identity = 94/367 (25.61%), Postives = 147/367 (40.05%), Query Frame = 1
Query:  547 FTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQ-YTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNN---NYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYC-------IKNEQYKDYCQNQEISKRCR 1614
             +   N C DIDEC   +   +  C+N  G FRC CP D YL  +  +C  +   C      C    +C   S+G+ Y C C   + +S N +SC      + C   K  C  +  C        C C  GFH S D++SC+   + D C      E      C +    YRC C   YQ   + + C        + +  C + + Y   +GG        + C+C  G+    +++ C  I    ++C  N      G C ++  N   + ECQC  GF   ++ ++C       ++   CE      + G         Y+C+C  G+  SED   C       I N      C+N++ S+RC+
Sbjct:  187 LSGDGNTCSDIDECAVSNGGCSDRCVNSPGGFRCDCPSDLYLHADGRTCG-KVTSCSTDNGGCEH--ECENDSNGEFYRCRCRVGFKLSENKRSCQP---VDPCFDNKGGCQHH--CTNNHGRAQCQCYPGFHLSYDRRSCV---DIDECAKNNGCEH----FCENVKGTYRCKCREGYQLGRDGRTCEEMLGGCQVGNGGC-QHDCYDQPDGG--------HVCKCRNGYILANDQKLCHDI----NECHENN-----GDCSQICVNLAGSVECQCKPGFRLMKDRKTCEDISECSSNNGGCEQICSNQEGG---------YMCSCEPGFELSEDGHSCHDMNECLINNGGCAQLCKNRKGSRRCQ 511          
BLAST of Fibrillin-2 vs. Ensembl Celegans
Match: Y64G10A.7 (pep chromosome:WBcel235:IV:14291901:14319564:1 gene:WBGene00013416.1 transcript:Y64G10A.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y64G10A.7)

HSP 1 Score: 62.3882 bits (150), Expect = 2.101e-9
Identity = 94/367 (25.61%), Postives = 147/367 (40.05%), Query Frame = 1
Query:  547 FTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQ-YTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNN---NYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYC-------IKNEQYKDYCQNQEISKRCR 1614
             +   N C DIDEC   +   +  C+N  G FRC CP D YL  +  +C  +   C      C    +C   S+G+ Y C C   + +S N +SC      + C   K  C  +  C        C C  GFH S D++SC+   + D C      E      C +    YRC C   YQ   + + C        + +  C + + Y   +GG        + C+C  G+    +++ C  I    ++C  N      G C ++  N   + ECQC  GF   ++ ++C       ++   CE      + G         Y+C+C  G+  SED   C       I N      C+N++ S+RC+
Sbjct:  187 LSGDGNTCSDIDECAVSNGGCSDRCVNSPGGFRCDCPSDLYLHADGRTCG-KVTSCSTDNGGCEH--ECENDSNGEFYRCRCRVGFKLSENKRSCQP---VDPCFDNKGGCQHH--CTNNHGRAQCQCYPGFHLSYDRRSCV---DIDECAKNNGCEH----FCENVKGTYRCKCREGYQLGRDGRTCEEMLGGCQVGNGGC-QHDCYDQPDGG--------HVCKCRNGYILANDQKLCHDI----NECHENN-----GDCSQICVNLAGSVECQCKPGFRLMKDRKTCEDISECSSNNGGCEQICSNQEGG---------YMCSCEPGFELSEDGHSCHDMNECLINNGGCAQLCKNRKGSRRCQ 511          
BLAST of Fibrillin-2 vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 54.299 bits (129), Expect = 4.920e-7
Identity = 50/204 (24.51%), Postives = 85/204 (41.67%), Query Frame = 1
Query:  529 NYCPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSC--------IVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECV 1110
            N C  G+        C+D++ECQ + +C + ECIN  G+++C+C P +  ++    C+   +  +  G  C +  +C+ T  G + C C   + ++ +G+ C    + N C      C    +C     SY C C  GF    D   C           S +D+C           G C++    Y C C   Y+   + + CV
Sbjct:  334 NLCAHGYEVNGATGFCEDVNECQ-QGVCGSMECINLPGTYKCKCGPGYEFNDAKKRCEDVDECIKFAGHVCDLSAECINTI-GSFECKCKPGFQLASDGRRC---EDVNECTTGIAAC--EQKCVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLCM----------GGCINTKGSYLCQCPPGYKIQPDGRTCV 520          
BLAST of Fibrillin-2 vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0290277)

HSP 1 Score: 67.0106 bits (162), Expect = 9.489e-11
Identity = 122/496 (24.60%), Postives = 187/496 (37.70%), Query Frame = 1
Query: 1489 YPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNG-QECVR--YKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRI---EKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICT-----PGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR------CICGPGYKSS----EDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKS--VDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDH 2907
             P EY C+C EGY   E  K C+   +    C N E+S  C+G  C +   SYRCV   + +  N    E V    ++T    V +         C  G                +  + +G  C  I   E    E+ DN+  + Q+     +G          F+C C+ G+    D RSC    +D C + EN           C+     ++RCVCP    LS+D HSCL+           C       +C+ G C+         CIC  GY+S     +D  EC +   + S               +     Y+CQC  G    E        E   + +++C+++   C+  IC  +     +CAC  G++ + D KSC  +D  +C VN   C+   C ++   Y CIC   Y         +LK+  ++    DI E S    Q    C+ + +        C      Y C CP  +     +H
Sbjct:  310 LPGEYKCSCQEGYYLDESGKSCVDINE----CANPELSSNCQGA-CENLPGSYRCV---EPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSG----------------FQLSADGTDCQDINECEVDGPEDLDNN-AVCQQKCENTIGS---------FRCTCVEGYHLLEDQRSC---ALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQ-------ESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLCS------------HTCQNTPGGYQCQCPEGLNLVE--------EYTCLAENLCEVNNNGCEQ-IC--LTARGGVCACREGFRLSADGKSCEDVD--ECLVNNGGCQ-QVCRNLPGSYGCICAAGYE--------LLKLDGIRGYCFDIDECS----QRTHGCSDQML--------CENLNGSYTCLCPPGYALGLDNH 715          

HSP 2 Score: 56.6102 bits (135), Expect = 1.377e-7
Identity = 148/653 (22.66%), Postives = 241/653 (36.91%), Query Frame = 1
Query:  283 PQNNQKLCTNNCSNKGQCQNGKCICESGY-FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGS----CVSEGKGYRCLCNGEYQ-GYN-------NDQECVRYGTSEPLVSRYCSKSEYYSLCEGG---SCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQEL---DNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGG---QCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRL----CSKWE---YYSLCQGGECVDTXXXXXXXXXXXXXATENG---RKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRC--ERSGNSNFRCVCPYYASLSK 2139
            PQ N+  C + C +  +  + +C+C  GY   ED ++ ++       ++G+ K +P     S++           N    C    CP G+  +   C DIDEC   +   +  C N  G ++CQCP    L E   +C    + C++  + C     C+    G   C C + + +S +GKSC    + + C      C     C+    SY C C +G+     K   I     DI    E ++R  G S    C +    Y CLC   Y  G +       N        +SE   +  C   +  SL  G     C +    + C C  G+  +E+ R C  I+               G+C +L       + C C  GF  + +G  C   +        C        + +C  +    + CAC  GY  ++D+  C+  +         E +    GG   +C++   ++ C C   YI +++G+ C       PP  +     C+  E    Y+L    +CVD +              +NG    +CS  E                                 FKC C PG+   SD ++C  + +D+C  ++  C  G C  E  G   FRC  P +  L +
Sbjct:  469 PQLNRTRCAHECQDLPE-GSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASED-----------NTSFSC---ICPTGYRSEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPEGLNLVEE-YTC-LAENLCEVNNNGCEQI--CLTARGG--VCACREGFRLSADGKSC---EDVDECLVNNGGCQQV--CRNLPGSYGCICAAGYELL--KLDGIRGYCFDI---DECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDECLD---------SNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNC--------SDICINLL-GTHACACERGYELAKDKLSCLDVD---------ECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQK----------QNGGCSHRCSNTEG-------------------------------SFKCSCPPGYELDSDQKTC--QDIDECDQDKTSCITGTCINEIGG---FRCEFPKFPVLPE 1017          
BLAST of Fibrillin-2 vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0301222)

HSP 1 Score: 67.0106 bits (162), Expect = 9.489e-11
Identity = 122/496 (24.60%), Postives = 187/496 (37.70%), Query Frame = 1
Query: 1489 YPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNG-QECVR--YKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRI---EKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICT-----PGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR------CICGPGYKSS----EDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKS--VDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDH 2907
             P EY C+C EGY   E  K C+   +    C N E+S  C+G  C +   SYRCV   + +  N    E V    ++T    V +         C  G                +  + +G  C  I   E    E+ DN+  + Q+     +G          F+C C+ G+    D RSC    +D C + EN           C+     ++RCVCP    LS+D HSCL+           C       +C+ G C+         CIC  GY+S     +D  EC +   + S               +     Y+CQC  G    E        E   + +++C+++   C+  IC  +     +CAC  G++ + D KSC  +D  +C VN   C+   C ++   Y CIC   Y         +LK+  ++    DI E S    Q    C+ + +        C      Y C CP  +     +H
Sbjct:  310 LPGEYKCSCQEGYYLDESGKSCVDINE----CANPELSSNCQGA-CENLPGSYRCV---EPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSG----------------FQLSADGTDCQDINECEVDGPEDLDNN-AVCQQKCENTIGS---------FRCTCVEGYHLLEDQRSC---ALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQ-------ESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLCS------------HTCQNTPGGYQCQCPEGLNLVE--------EYTCLAENLCEVNNNGCEQ-IC--LTARGGVCACREGFRLSADGKSCEDVD--ECLVNNGGCQ-QVCRNLPGSYGCICAAGYE--------LLKLDGIRGYCFDIDECS----QRTHGCSDQML--------CENLNGSYTCLCPPGYALGLDNH 715          

HSP 2 Score: 56.6102 bits (135), Expect = 1.377e-7
Identity = 148/653 (22.66%), Postives = 241/653 (36.91%), Query Frame = 1
Query:  283 PQNNQKLCTNNCSNKGQCQNGKCICESGY-FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGS----CVSEGKGYRCLCNGEYQ-GYN-------NDQECVRYGTSEPLVSRYCSKSEYYSLCEGG---SCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQEL---DNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGG---QCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRL----CSKWE---YYSLCQGGECVDTXXXXXXXXXXXXXATENG---RKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRC--ERSGNSNFRCVCPYYASLSK 2139
            PQ N+  C + C +  +  + +C+C  GY   ED ++ ++       ++G+ K +P     S++           N    C    CP G+  +   C DIDEC   +   +  C N  G ++CQCP    L E   +C    + C++  + C     C+    G   C C + + +S +GKSC    + + C      C     C+    SY C C +G+     K   I     DI    E ++R  G S    C +    Y CLC   Y  G +       N        +SE   +  C   +  SL  G     C +    + C C  G+  +E+ R C  I+               G+C +L       + C C  GF  + +G  C   +        C        + +C  +    + CAC  GY  ++D+  C+  +         E +    GG   +C++   ++ C C   YI +++G+ C       PP  +     C+  E    Y+L    +CVD +              +NG    +CS  E                                 FKC C PG+   SD ++C  + +D+C  ++  C  G C  E  G   FRC  P +  L +
Sbjct:  469 PQLNRTRCAHECQDLPE-GSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASED-----------NTSFSC---ICPTGYRSEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPEGLNLVEE-YTC-LAENLCEVNNNGCEQI--CLTARGG--VCACREGFRLSADGKSC---EDVDECLVNNGGCQQV--CRNLPGSYGCICAAGYELL--KLDGIRGYCFDI---DECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDECLD---------SNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNC--------SDICINLL-GTHACACERGYELAKDKLSCLDVD---------ECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQK----------QNGGCSHRCSNTEG-------------------------------SFKCSCPPGYELDSDQKTC--QDIDECDQDKTSCITGTCINEIGG---FRCEFPKFPVLPE 1017          
BLAST of Fibrillin-2 vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0301221)

HSP 1 Score: 67.0106 bits (162), Expect = 9.489e-11
Identity = 122/496 (24.60%), Postives = 187/496 (37.70%), Query Frame = 1
Query: 1489 YPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNG-QECVR--YKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRI---EKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICT-----PGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR------CICGPGYKSS----EDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKS--VDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDH 2907
             P EY C+C EGY   E  K C+   +    C N E+S  C+G  C +   SYRCV   + +  N    E V    ++T    V +         C  G                +  + +G  C  I   E    E+ DN+  + Q+     +G          F+C C+ G+    D RSC    +D C + EN           C+     ++RCVCP    LS+D HSCL+           C       +C+ G C+         CIC  GY+S     +D  EC +   + S               +     Y+CQC  G    E        E   + +++C+++   C+  IC  +     +CAC  G++ + D KSC  +D  +C VN   C+   C ++   Y CIC   Y         +LK+  ++    DI E S    Q    C+ + +        C      Y C CP  +     +H
Sbjct:  310 LPGEYKCSCQEGYYLDESGKSCVDINE----CANPELSSNCQGA-CENLPGSYRCV---EPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSG----------------FQLSADGTDCQDINECEVDGPEDLDNN-AVCQQKCENTIGS---------FRCTCVEGYHLLEDQRSC---ALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQ-------ESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLCS------------HTCQNTPGGYQCQCPEGLNLVE--------EYTCLAENLCEVNNNGCEQ-IC--LTARGGVCACREGFRLSADGKSCEDVD--ECLVNNGGCQ-QVCRNLPGSYGCICAAGYE--------LLKLDGIRGYCFDIDECS----QRTHGCSDQML--------CENLNGSYTCLCPPGYALGLDNH 715          

HSP 2 Score: 56.6102 bits (135), Expect = 1.377e-7
Identity = 148/653 (22.66%), Postives = 241/653 (36.91%), Query Frame = 1
Query:  283 PQNNQKLCTNNCSNKGQCQNGKCICESGY-FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGS----CVSEGKGYRCLCNGEYQ-GYN-------NDQECVRYGTSEPLVSRYCSKSEYYSLCEGG---SCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQEL---DNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGG---QCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRL----CSKWE---YYSLCQGGECVDTXXXXXXXXXXXXXATENG---RKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRC--ERSGNSNFRCVCPYYASLSK 2139
            PQ N+  C + C +  +  + +C+C  GY   ED ++ ++       ++G+ K +P     S++           N    C    CP G+  +   C DIDEC   +   +  C N  G ++CQCP    L E   +C    + C++  + C     C+    G   C C + + +S +GKSC    + + C      C     C+    SY C C +G+     K   I     DI    E ++R  G S    C +    Y CLC   Y  G +       N        +SE   +  C   +  SL  G     C +    + C C  G+  +E+ R C  I+               G+C +L       + C C  GF  + +G  C   +        C        + +C  +    + CAC  GY  ++D+  C+  +         E +    GG   +C++   ++ C C   YI +++G+ C       PP  +     C+  E    Y+L    +CVD +              +NG    +CS  E                                 FKC C PG+   SD ++C  + +D+C  ++  C  G C  E  G   FRC  P +  L +
Sbjct:  469 PQLNRTRCAHECQDLPE-GSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASED-----------NTSFSC---ICPTGYRSEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPEGLNLVEE-YTC-LAENLCEVNNNGCEQI--CLTARGG--VCACREGFRLSADGKSC---EDVDECLVNNGGCQQV--CRNLPGSYGCICAAGYELL--KLDGIRGYCFDI---DECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDECLD---------SNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNC--------SDICINLL-GTHACACERGYELAKDKLSCLDVD---------ECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQK----------QNGGCSHRCSNTEG-------------------------------SFKCSCPPGYELDSDQKTC--QDIDECDQDKTSCITGTCINEIGG---FRCEFPKFPVLPE 1017          
BLAST of Fibrillin-2 vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0304659)

HSP 1 Score: 66.2402 bits (160), Expect = 1.703e-10
Identity = 115/416 (27.64%), Postives = 164/416 (39.42%), Query Frame = 1
Query:  535 CPKGFTQKENRCD-DIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYN--------NDQECVRYGTSEPLVSRY---CSKSEYYSLCE-------------GGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSE---DRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC 1698
            C +GFT    RC+ +I+EC+       G C+++ G+FRC C P          C+   D+CQ   + C   G C    +G + C C    ++ F G  C  + N + C    + C   G C      Y C CP G+  +    SC +N N   C S      C  G C+ +   ++CLC+  Y GY             C   G  +  V  Y   C        CE             G +C+D  N Y CQC  GF      +     E I+S CA N      G C +   N Y+C+C RGF  +     C+ ++    +++ C   G RC+ G+      NE+IC C  GY+      D   C  N      CQ         GG C    N++ C C   Y     GQ+C
Sbjct:  476 CSQGFTGP--RCETNINECESHPCQNEGSCLDDPGTFRCVCMPGF----TGTQCEIDIDECQ--SNPCLNDGTCHDKING-FKCSC----ALGFTGARC--QINIDDCQ--SQPCRNRGICHDSIAGYSCECPPGYTGT----SCEININD--CDS----NPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNV--DECISSPCANN------GVCID-QVNGYKCECPRGFYDAH----CL-SDVDECASNPCVNEG-RCEDGI------NEFICHCPPGYTGKRCELDIDECSSNP-----CQ--------HGGTCYDKLNAFSCQCMPGYT----GQKC 826          

HSP 2 Score: 55.0694 bits (131), Expect = 5.510e-7
Identity = 130/521 (24.95%), Postives = 190/521 (36.47%), Query Frame = 1
Query:  316 CSNKGQC---QNGK--CICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQ--------LSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDI----------DECQFKSICLNGECINEK--------GSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGF--------------HQSEDKKSCIVNSNSDICQSP-------------EIAERCR-----GGSCVSEGKGYRCLCNGEYQGY---NNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISS 1680
            C N G C    NGK  C C+S Y G+ C            + G C+ T  N +        L  +E  S+ ++A  N    CD   C  G T +    ++           + C+ K++C +  C N           SF C CPP    D    +C Y  ++CQ   + C   G CV T  G Y C+C   Y+    GK C   T Y  C+     C   G C+  GLSY C CP GF              H  ++  +CI   +   C+ P             E A+R       G +C +    Y C+C   + G    NN  +C +                +Y    G +C+D    +YCQC++G    +    C   +  TS        C         N +Y C C  G+     G  C +     +  S CE        G+C    P  Y C C +G++    R     NE     CQN+        G C+ +  ++RCVC   +  +
Sbjct:   67 CQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDE--SLCEIAVPN---ACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGD----TCSYDIEECQ--SNPCKYGGTCVNTH-GSYQCMCPTGYT----GKDC--DTKYKPCS--PSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAAC-------------FY----GATCIDGVGSFYCQCTKG----KTGLLCHLDDACTSNPCHADAICD----TSPINGSYACSCATGY----KGVDCSEDIDECDQGSPCE------HNGICVNT-PGSYRCNCSQGFTGP--RCETNINECESHPCQNE--------GSCLDDPGTFRCVCMPGFTGT 521          
BLAST of Fibrillin-2 vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0070507)

HSP 1 Score: 66.2402 bits (160), Expect = 1.703e-10
Identity = 115/416 (27.64%), Postives = 164/416 (39.42%), Query Frame = 1
Query:  535 CPKGFTQKENRCD-DIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYN--------NDQECVRYGTSEPLVSRY---CSKSEYYSLCE-------------GGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSE---DRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC 1698
            C +GFT    RC+ +I+EC+       G C+++ G+FRC C P          C+   D+CQ   + C   G C    +G + C C    ++ F G  C  + N + C    + C   G C      Y C CP G+  +    SC +N N   C S      C  G C+ +   ++CLC+  Y GY             C   G  +  V  Y   C        CE             G +C+D  N Y CQC  GF      +     E I+S CA N      G C +   N Y+C+C RGF  +     C+ ++    +++ C   G RC+ G+      NE+IC C  GY+      D   C  N      CQ         GG C    N++ C C   Y     GQ+C
Sbjct:  476 CSQGFTGP--RCETNINECESHPCQNEGSCLDDPGTFRCVCMPGF----TGTQCEIDIDECQ--SNPCLNDGTCHDKING-FKCSC----ALGFTGARC--QINIDDCQ--SQPCRNRGICHDSIAGYSCECPPGYTGT----SCEININD--CDS----NPCHRGKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNV--DECISSPCANN------GVCID-QVNGYKCECPRGFYDAH----CL-SDVDECASNPCVNEG-RCEDGI------NEFICHCPPGYTGKRCELDIDECSSNP-----CQ--------HGGTCYDKLNAFSCQCMPGYT----GQKC 826          

HSP 2 Score: 55.0694 bits (131), Expect = 5.510e-7
Identity = 130/521 (24.95%), Postives = 190/521 (36.47%), Query Frame = 1
Query:  316 CSNKGQC---QNGK--CICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQ--------LSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDI----------DECQFKSICLNGECINEK--------GSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGF--------------HQSEDKKSCIVNSNSDICQSP-------------EIAERCR-----GGSCVSEGKGYRCLCNGEYQGY---NNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISS 1680
            C N G C    NGK  C C+S Y G+ C            + G C+ T  N +        L  +E  S+ ++A  N    CD   C  G T +    ++           + C+ K++C +  C N           SF C CPP    D    +C Y  ++CQ   + C   G CV T  G Y C+C   Y+    GK C   T Y  C+     C   G C+  GLSY C CP GF              H  ++  +CI   +   C+ P             E A+R       G +C +    Y C+C   + G    NN  +C +                +Y    G +C+D    +YCQC++G    +    C   +  TS        C         N +Y C C  G+     G  C +     +  S CE        G+C    P  Y C C +G++    R     NE     CQN+        G C+ +  ++RCVC   +  +
Sbjct:   67 CQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDE--SLCEIAVPN---ACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGD----TCSYDIEECQ--SNPCKYGGTCVNTH-GSYQCMCPTGYT----GKDC--DTKYKPCS--PSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAAC-------------FY----GATCIDGVGSFYCQCTKG----KTGLLCHLDDACTSNPCHADAICD----TSPINGSYACSCATGY----KGVDCSEDIDECDQGSPCE------HNGICVNT-PGSYRCNCSQGFTGP--RCETNINECESHPCQNE--------GSCLDDPGTFRCVCMPGFTGT 521          
BLAST of Fibrillin-2 vs. Ensembl Zebrafish
Match: fbn2a (fibrillin 2a [Source:ZFIN;Acc:ZDB-GENE-090112-4])

HSP 1 Score: 147.902 bits (372), Expect = 3.218e-35
Identity = 237/956 (24.79%), Postives = 358/956 (37.45%), Query Frame = 1
Query:  325 KGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR-------NYCPKG--FTQKENRCD-------DIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPY-SVSFNGKSCIK----KTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRY---------------------------GTSEPLVSRYCSK----SEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL----------INYVTTEPTTKYCDILVNRLR--CASGNCVNDRCICGPGYKSSE-----DGKECYKIEKVSSIXXXXXXXXXXXXXXXXDD-----NNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKC--AVNEYRCKGGYCYDIVDGYLCICVGNYTVTEN---------GRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTN 2895
             G C NG C+   G F             G  C       C++  +  +C + P   +   + CC    +AWG  C  C           CP+G  F  K +  +       DI+EC+ F+SIC++G+C N  GSFRC+C     LD N  +C    D+C +    CG  G CV T  G + C C   Y S     K+C+     + N ++CN         G C+    SY C CP G H S D  +C      D+ +    +  C  G CV+    Y+C CN  YQ   + + C                              G S     R CS      E   +CEGG C ++   Y+C C EGF A+ + + CI +    ++C LN   C  G C+     ++ C C  G+   +    C            CE+  H C T       P  Y C+C +G+    D   C       D C N+  S      +CV+   SY C C   +I   +G  C    +            E   LC+ G+C++   +Y C+C  G+  T N + C  I++          C  Q     C+ G C       F+C+C  G+     G +C    VD+CL++ N C  G CE +  S ++C CP    L+  G  C+          + Y +    +      V+R    C+ G      C   P   +SE      G E +K   V+ I        +  G  +  +      +++C+C  G+  +   R C   +  ++   +       C  G CY    N Y C C   Y Q      C+ M    C  + N   C+    ++I    LC C  N     N         G D    +    +    +++   P+    C   EI+  C  G C+     + C+CP  F  N
Sbjct:  879 PGVCHNGHCVNTRGSFKCQCPESLTLDVTGRLCVDVRSEPCFLTYEEDVC-TQPVPGRFRMDMCCCTVGLAWGKDCDLCPEPGTRQFDTLCPRGPGFANKGDFINGAIPSSSDINECKVFQSICVHGKCRNTIGSFRCRCDSGFALDTNEKNCT-DIDECMISPDVCG-HGTCVNTL-GSFQCDCFPGYESGIMMMKNCMDIDECERNLSLCN--------GGTCENTDGSYKCVCPPGHHLSVDGSAC-----EDVNECDLSSTLCPNGWCVNLVGTYQCSCNSGYQTTPDWKGCTDIDECTIENGGCELYCSNSEGSYSCSCGQGYSLTPDQRTCSDVNECEEVLDICEGGQCTNVPGAYHCLCYEGFMASVDMKTCIDV----NECELNDNICAFGECENT-KGSFICHCDMGYAVKKGTSGCTDVNE-------CEINSHNCDTHATCVNTPGHYHCSCGDGWFG--DGVKCAD----VDECANR-TSVCSADAECVNTAGSYHCECSDGFIG--DGVICSDLDECA----------EDVDLCENGQCLNVPGSYRCECEMGFTHTSNRKTCRDIDE----------CSFQNI---CVFGTCQNIPGM-FRCICDEGYELDRTGGNCTD--VDECLDSLN-CVNGHCENTAGS-YQCNCPIDFELNPTGIGCVDTRVGNCFLEVAYNSKLACSAEIGFGVSRSSCCCSLGRVWGYPCDHCPTLNTSEYNTLCPGGEGFKPNPVTIILEDIDECQELPGVCQGGNCVNTFGSFQCECPAGFYLNTQSRICEDIDECVLSLGV-------CGPGTCYNTLGN-YTCVCPQDYIQVNGGHRCMDMRKSLCYRSYNGSACEHQLNFNITH-RLCCCSYNVGKAWNKPCHACPIPGTDDYSSLCGSVTGFWIDIATGKPKDIDEC--HEILGVCAHGVCINHMGSFHCECPTGFLYN 1757          

HSP 2 Score: 134.806 bits (338), Expect = 3.189e-31
Identity = 220/899 (24.47%), Postives = 330/899 (36.71%), Query Frame = 1
Query:  373 GEDCNTAIISTCYVKI--DRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRC----DDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSV-----------------SFNGKSCIKKTNYNV------CNY--------------------FKKLC---------------------------LPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEY----QGYNNDQ-ECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ-TEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKC-SRIEKQVTEEPDNSYCLLQEYLSRCMGGRC---IGDKTYGFKCLCLPGFTSASDGRSCDPEY------------VDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYK-----SSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            G  C    +  C++++  +  L  S      +S+  CC      WG PC  C           CP G   K N      +DIDECQ    +C  G C+N  GSF+C+CP   YL+  +  C+   D+C L    CG  G C  T  G YTC+C + Y                   S+NG +C  + N+N+      C+Y                    +  LC                             +G C  +  S++C CP+GF  ++    C    + D C S E   + R   C++   GY+C C+  Y     G  ND+ EC+                E  S+C  G CVD+   Y C C  GF  T NRR C+ I   + Q       C  G C+     ++ C C  GF  + N       E     + +C     RC   V        + C C EGY  + D K C+      D  +   I   C  G C++   S+RCVC   YI  ++   CV   + +E P +           C  G C ++  ++ C C  G+  +E+ R+C    E       +NS C + +  +      C   +  + +G  C   P    A+    C   +            +++C+ N  IC  GRC     S FRC CP   +L   G  C             C +   R  C +G C N      C+C  G++     S ED  EC +   + +   +N               +YEC C +GY   E+GR C   +        CD    +C   I        ++C C  G  +    ++C   D  +C      C+ G C + V  Y C C   +    +   C+
Sbjct: 1485 GIGCVDTRVGNCFLEVAYNSKLACSAEIGFGVSRSSCCCSLGRVWGYPCDHCPTLNTSEYNTLCPGGEGFKPNPVTIILEDIDECQELPGVCQGGNCVNTFGSFQCECPAGFYLNTQSRICE-DIDECVLSLGVCGP-GTCYNTL-GNYTCVCPQDYIQVNGGHRCMDMRKSLCYRSYNGSACEHQLNFNITHRLCCCSYNVGKAWNKPCHACPIPGTDDYSSLCGSVTGFWIDIATGKPKDIDECHEILGVCAHGVCINHMGSFHCECPTGFLYNDLLLIC---EDIDECSSREPVCQ-RNADCINRPGGYQCECSDGYILTPNGDCNDRNECL----------------ETPSVCRHGDCVDIPGGYECMCHTGFTVTPNRRMCVDINECSHQ------PCGNGTCKN-SVGSFNCICHHGFELATNNYCTDIDECAVFHSQLCR--NGRCVNNV------GSFQCLCREGYELTFDGKTCM------DVNECTIIPGICAPGTCLNLDGSFRCVCPDGYIVQSD--HCVDVNECSEEPGI-----------CTYGTCFNSLGSFECVCKPGFVLSEDKRRCYDTRESFCFTRFENSKCSVPQAFNTTKAKCCCSIMAKEGWGDPCELCPKEHDAAFQDLCPFGHGIIPGVGDTRVDLNECVENPEICVNGRCINMDGS-FRCECPAGYTLDYTGTHC--------DDIDECSV---RNPCGNGTCSNVIGAFECLCEEGFEPGPMMSCEDVNECGQNPLLCAFRCINTF------------GSYECSCPSGYTLREDGRMCQDVDECAEDLHNCDSRGMECSNLI------GTFMCVCPAGMIRRMSDEAC--QDENECLTQPGVCENGRCVNTVGSYTCECGVGFKTDSSATQCL 2294          

HSP 3 Score: 114.005 bits (284), Expect = 7.521e-25
Identity = 195/863 (22.60%), Postives = 330/863 (38.24%), Query Frame = 1
Query:  334 CQNGKCICESGYFGEDCNTAI----------ISTC-YVKIDRGLCKSTPEN---------LQLSK-EECCSIFQVAWGNPCVFCDRNY---CPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPS---GF----HQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKI-ETITSQC-------ALNQFQCQGGRCQELDNNNYEC-QCLRG--FIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYK--------------QTEPPAVRLCSKWEYYSLCQGGEC-VDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVC-PYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEK--VSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            C NG+CI     +  DCNT            +  C +     G C +TP +         L++   +EC     +     C+  + ++   C  GF    +   C D DEC   ++CLNG CINE GSF+C C P   L+ +   C    D+C+  G    + G+CV T  G + C C    +V  +G++C+     + C    K  L     Q       C C +    F    H    K S    +++DI +     + C  G C +    +RC+CN  Y+   + + C+     E +V+          LC+ G C ++   Y C C  GF    +   C  + E ++S C       +   F C+  +  +LD+    C   ++G  ++  ++GR  +        +  C   G    +    P  P +    C  G++QS       +    +D  + +     C  G CV+   S++C C         G+ CV  +              Q  P   R+        L  G +C +                     K   I   +    D + C +  + S C+ G+C  +    F+C C  GF   ++ ++C    +D+C+ + ++C  G C  +  S F+C C P Y S    G   + N +  +   +      N   C  G C N     +C+C PG+  S DG  C  + +  +SS    N                Y+C C +GY  + + + C   +   I+   C+L+             +  Y C+C  GY    D+++C   D  +C      C+GG C ++   Y C+C   +  + + + CI
Sbjct:  438 CLNGRCIPMESDYRCDCNTGFKEDNRGECSDVDECEFDPCANGNCINTPGSYYCRCHTGFLRVPDIDECLQNGVLCKNGRCLNTEGSFQCICNSGFKLSPDGRNCVDHDECAATNMCLNGMCINEDGSFKCVCKPGFTLNSSGRYCT-DIDECRTPGVC--MNGRCVNTQ-GSFRCECFAGLTVGIDGRTCVDTHMRSTCYGAVKRGLCLRPFQRAVTKSQCCCANPDYAFGEPCHPCPAKHSGTAITHADINECALDPDICSNGVCENLRGNFRCVCNIGYESDQSGRNCLD--IDECVVNSL--------LCDNGLCRNVPGSYSCTCPAGFIFRHDTETCEDVNECVSSPCVNGVCKNSAGSFYCECSQGSKLDSTGLLCVDSVKGSCWLTLQDGRCEVNINGATLRSQCCATLGLAWGS----PCEPCQTDLVCERGFAQS-------RGASCEDVNECEVFPGVCHNGHCVNTRGSFKCQCPESLTLDVTGRLCVDVRSEPCFLTYEEDVCTQPVPGRFRMDMCCCTVGLAWGKDCDLCPEPGTRQFDTLCPRGPGFANKGDFINGAIPSSSDINECKV--FQSICVHGKCR-NTIGSFRCRCDSGFALDTNEKNCTD--IDECMISPDVCGHGTCVNTLGS-FQCDCFPGYES----GIMMMKNCMDIDECER------NLSLCNGGTCENTDGSYKCVCPPGHHLSVDGSACEDVNECDLSSTLCPNGWCVNLV-------GTYQCSCNSGYQTTPDWKGCTDIDECTIENGGCELYCSN---------SEGSYSCSCGQGYSLTPDQRTC--SDVNECEEVLDICEGGQCTNVPGAYHCLCYEGFMASVDMKTCI 1241          

HSP 4 Score: 111.309 bits (277), Expect = 4.266e-24
Identity = 211/975 (21.64%), Postives = 340/975 (34.87%), Query Frame = 1
Query:  139 EPLCCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPC-------VFCDRNY-------------------------------------CPKGFTQKEN--RCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYT---CICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDIC----QSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSE---YYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVT--EEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESA----LIKKSICDLH------REKCKTGICYPIG------QNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            +  CC GW     G+ CV   C  DCG G C   N+C C      T TC   + K C   C N G C++  C C  GY G  C   +                                    C++++    C         SK  CC+    AWG+ C         C R +                                     CP G+ Q  +  +C+D+DEC   +  C  G CIN  GSF C CP  + L  +   C    DQ      +  + G+C     G++    C C +       G+   ++T + +C        P      Y ++ +  C   F    D+     N N  I     Q+P+I +  +         G++                       P+VS   + +      +LC  G C+ + +DY C C+ GF   +NR  C  ++    +C  +   C  G C      +Y C+C  GF+R  +   C++              G  C+ G C       + C C  G+  S D + C+ +++          +  C  G C++   S++CVC   +  +++G+ C    +   P V           C  G CV+T  ++ C+C  G     +GR C     + T         CL     +      C  +  Y F   C P   +   G +     +++C  + +IC+ G CE     NFRCVC       + G +CL             + +VN L C +G C N      C C  G+    D + C  + +  S            G  +    ++ C+C  G      G  C+ S        ++   C+++      R +C   +    G      Q D +C    G+ Q+   +     D  +C V    C  G+C +    + C C  + T+   GR C+
Sbjct:   42 QSFCCPGWKTLPGGNQCVVPICRSDCGDGFCSRPNMCTCPGGQTAT-TCFTKSSKQCNIRCMNGGVCEDDYCQCPKGYTGSFCGQPVCEKNCQNGGHCIGPNRCACGYGFTGPQCERDYRTGPCFIQVHSRKCAGQSSEFVCSKALCCATVGQAWGHSCEQCPPISSPCTRGFIPNTRTGACQDVDECKVVPDLCKGGRCINTLGSYQCTCPVGYQQHVSILKCEDVDECSTIERACEAGHCINSAGSFSCVCPSGYVLSADRTRC---LDQHTGICFASVVNGRCAHEISGRFNKIQCCCDR-------GRCWSQRTTHEMC--------PVPGSGDY-ITLFNLCFVFFVSPNDQILHPHNGNGQIKPQIRQTPQILQFPQIPQIPRHDNGFK--------------------PQRPVVSVNETVNRCRLLPNLCLNGRCIPMESDYRCDCNTGF-KEDNRGECSDVD----ECEFD--PCANGNCINTP-GSYYCRCHTGFLRVPDIDECLQN-------------GVLCKNGRCLNT-EGSFQCICNSGFKLSPDGRNCVDHDECA-------ATNMCLNGMCINEDGSFKCVCKPGFTLNSSGRYCTDIDECRTPGV-----------CMNGRCVNTQGSFRCECFAGLTVGIDGRTCVDTHMRSTCYGAVKRGLCLRPFQRAVTKSQCCCANPDYAFGEPCHP-CPAKHSGTAITHADINECALDPDICSNGVCENL-RGNFRCVCNIGYESDQSGRNCL----------DIDECVVNSLLCDNGLCRNVPGSYSCTCPAGFIFRHDTETCEDVNECVS-------SPCVNGVCKNSAGSFYCECSQGSKLDSTGLLCVDSVKGSCWLTLQDGRCEVNINGATLRSQCCATLGLAWGSPCEPCQTDLVCE--RGFAQS---RGASCEDVNECEVFPGVCHNGHCVNTRGSFKCQCPESLTLDVTGRLCV 912          

HSP 5 Score: 104.76 bits (260), Expect = 4.406e-22
Identity = 217/960 (22.60%), Postives = 351/960 (36.56%), Query Frame = 1
Query:  460 LSKEECCSIFQVAWGNPCVFCDRNY---CPKG--FTQKENRCDDIDECQFKS-ICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEY---QGYN----------NDQECVRYGTSEPLVSRY-CSKSEYY-----------------SLCEGGS-CVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVR------YKQTEPPAVRLCSK------------------W-------------EYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHS--------CLINYVTTEPTTKYCDILVNRLRCAS---GNCVNDRC-------------ICGP--------GYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQ----------------------NPQSQSFCTRKE-----IIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            +  +EC     +  G  C   D +Y   CP G   +   + C+D++EC   S +C NG C+N  G+++C C   +    +   C    D+C +    C ++      S+G Y+C C + YS++ + ++C   ++ N C     +C   G+C     +Y+C C  GF  S D K+CI     D+ +       C  G C +    + C C+  Y   +G +          N   C  + T       Y CS  + +                 S+C   + CV+    Y+C+CS+GF           I +   +CA +   C+ G+C  +  + Y C+C  GF  + N ++C   +           + + C  G C  I P  + C C EGY        C   ++  D       S  C  G C +   SY+C C   +  +  G  CV       + +    +   CS                   W             EY +LC GGE                     G K + +   + E+ D      QE    C GG C+   T+G F+C C  GF   +  R C  E +D+C+ +  +C PG C  +   N+ CVCP        GH         C  +Y  +    +    + +RL C S   G   N  C             +CG              +D  EC++I  V +                    ++ C+C  G++ ++    C   +    ++ +C  + +     I  P G   Y C C  GY    +       D  +C      C+ G C DI  GY C+C   +TVT N R C         VDI+E S+Q                         + ++CT  +       + C+ G+CV     +QC C   ++  +    C+ D N+C
Sbjct: 1074 MDIDECERNLSLCNGGTCENTDGSYKCVCPPGHHLSVDGSACEDVNECDLSSTLCPNGWCVNLVGTYQCSCNSGYQTTPDWKGCT-DIDECTIENGGCELY---CSNSEGSYSCSCGQGYSLTPDQRTC---SDVNECEEVLDIC-EGGQCTNVPGAYHCLCYEGFMASVDMKTCI-----DVNECELNDNICAFGECENTKGSFICHCDMGYAVKKGTSGCTDVNECEINSHNCDTHATCVNTPGHYHCSCGDGWFGDGVKCADVDECANRTSVCSADAECVNTAGSYHCECSDGFIGDG------VICSDLDECAEDVDLCENGQCLNVPGS-YRCECEMGFTHTSNRKTCRDIDECS--------FQNICVFGTCQNI-PGMFRCICDEGYELDRTGGNCTDVDECLD-------SLNCVNGHCENTAGSYQCNCPIDFELNPTGIGCVDTRVGNCFLEVAYNSKLACSAEIGFGVSRSSCCCSLGRVWGYPCDHCPTLNTSEYNTLCPGGE---------------------GFKPNPV-TIILEDIDE----CQELPGVCQGGNCV--NTFGSFQCECPAGFYLNTQSRIC--EDIDECVLSLGVCGPGTCYNT-LGNYTCVCPQDYIQVNGGHRCMDMRKSLCYRSYNGSACEHQLNFNITHRLCCCSYNVGKAWNKPCHACPIPGTDDYSSLCGSVTGFWIDIATGKPKDIDECHEILGVCAHGVCINHM-----------GSFHCECPTGFLYNDLLLICEDIDECSSREPVCQRNADC----INRPGG---YQCECSDGYILTPNGD---CNDRNECLETPSVCRHGDCVDIPGGYECMCHTGFTVTPNRRMC---------VDINECSHQPCGNGTCKNSVGSFNCICHHGFELATNNYCTDIDECAVFHSQLCRNGRCVNNVGSFQCLCREGYELTFDGKTCM-DVNEC 1935          

HSP 6 Score: 102.449 bits (254), Expect = 2.198e-21
Identity = 227/1018 (22.30%), Postives = 352/1018 (34.58%), Query Frame = 1
Query:  340 NGKCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQV--AWGNPCVFCD-------RNYCPK--GF--TQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI------------------VNSNSDICQSP-EIA----------------ERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK--NEQYKDYC---------------------QNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ---TEPPAVRLCSK--WEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGN-SNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKK---------------SICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPG-----------------------KCVEKQEDYQCKCPHSFKTNYYDH------ECVRDSNKCPYCFYGCFDENSISTCSCSENY 3000
            N  C+C   Y     G  C     S CY   +   C+    N  ++   CC  + V  AW  PC  C         + C    GF       +  DIDEC +   +C +G CIN  GSF C+CP     ++  + C+   D+C      C     C+    G Y C C   Y ++ NG       + N C     +C  +G+C      Y C C +GF  + +++ C+                  V S + IC    E+A                + CR G CV+    ++CLC   Y+   + + C+       +            +C  G+C++L+  + C C +G+    +   C+ +    ++C+     C  G C      ++EC C  GF+ SE+ R C     TR S         +C     +     +  C+ +      +  + C K  +  ++D C                     +N EI   C  G+C++   S+RC C   Y     G  C    +     P     CS     +  LC+ G                  + E+  +C +              LL  +       RCI   T+G ++C C  G+T   DGR C  + VD+C  + + C     E S     F CVCP          + +I  ++ E      + L     C +G CVN      C CG G+K+     +C    K      +    CQ      +  +  +C C  G+   +    C    +A  KK                 C L  + C  G C  +    Y C C  GY  +T   +C+ +D  +C ++   C    C +    Y C C   YT+  + R C       K VD  +    N Q     T      KC  G                        C      + C+CP  F  +   H      EC RD      C +GC +      CSC + Y
Sbjct: 1629 NYTCVCPQDYIQVNGGHRCMDMRKSLCYRSYNGSACEHQ-LNFNITHRLCCCSYNVGKAWNKPCHACPIPGTDDYSSLCGSVTGFWIDIATGKPKDIDECHEILGVCAHGVCINHMGSFHCECPTGFLYNDLLLICE-DIDECSSREPVCQRNADCI-NRPGGYQCECSDGYILTPNGDC----NDRNECLETPSVCR-HGDCVDIPGGYECMCHTGFTVTPNRRMCVDINECSHQPCGNGTCKNSVGSFNCICHHGFELATNNYCTDIDECAVFHSQLCRNGRCVNNVGSFQCLCREGYELTFDGKTCMDVNECTIIPG----------ICAPGTCLNLDGSFRCVCPDGYIVQSDH--CVDV----NECSEEPGICTYGTCFN-SLGSFECVCKPGFVLSEDKRRCYD---TRESFCFTRFENSKCSVPQAFNTTKAKCCCSIMAKEGWGDPCELCPKEHDAAFQDLCPFGHGIIPGVGDTRVDLNECVENPEI---CVNGRCINMDGSFRCECPAGYTLDYTGTHCDDIDECSVRNPCGNGTCSNVIGAFECLCEEG-----------FEPGPMMSCEDVNECGQNP------------LLCAF-------RCI--NTFGSYECSCPSGYTLREDGRMC--QDVDECAEDLHNCDSRGMECSNLIGTFMCVCP----------AGMIRRMSDEACQDENECLTQPGVCENGRCVNTVGSYTCECGVGFKTDSSATQCLDYRKGFCFTEVLHTMCQMSSSSRVPVSRSQCCCNGGHGWGDQCELCPLPATANYKKLCPYGHGYAIDGTDIDECKLIPDVCANGACINM-MGSYRCHCKPGYIASTAGTACVDVD--ECGMSPKPCNF-ICKNTEGSYACSCPRGYTLQNDNRSC-------KDVDECQSRRHNCQFSCMNTIGGFTCKCPAGFSQHHRAYIDECLSDLTPCGLQGACQNSVGSFSCECPQGFSLDSLGHNCDDVDECARDHR----CQFGCQNVAGGFRCSCPQGY 2556          

HSP 7 Score: 100.908 bits (250), Expect = 7.245e-21
Identity = 202/832 (24.28%), Postives = 295/832 (35.46%), Query Frame = 1
Query:  202 DYDCGYGRC---VGLNVCEC---YDKTIRTETCPQNNQ-KLCTNNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSK--------------------EECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGK--GYRC-----LCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYC---------------------IKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ---TEPPAVR-------------LCSK----------------WEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEK-----------------------QVTEEPDNSYCLLQE-----YLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEK 2313
            D  C +G C    G  +C C   Y     T  C   N+ ++ ++NC     C N      C C  G+FG+    A +  C  +    +C +  E +  +                     +EC     +     C+    +Y   C  GFT   NR  C DIDEC F++IC+ G C N  G FRC C   + LD    +C    D+C L   +C + G C  T+ G Y C C   + ++  G  C+   +  V N F ++         Y     CS   GF  S                        R   C S G+  GY C     L   EY       E  +      ++       E   +C+GG+CV+    + C+C  GFY     R C  I+    +C L+   C  G C      NY C C + +I+   G  C+     R S       G  C+  + + I      C+   G + ++    C                     I   + KD  +  EI   C  G C+++  S+ C C   ++ ++    C    +    EP   R              CS                  E  S+C+ G+CVD    Y C C  G+  T N R C  I +                          E   N+YC   +     +   C  GRC+ +    F+CLC  G+    DG++C    V++C     IC PG C     S FRCVCP    +  D H   +N  + EP             C  G C N      C+C PG+  SED + CY   +
Sbjct: 1250 DNICAFGECENTKGSFICHCDMGYAVKKGTSGCTDVNECEINSHNCDTHATCVNTPGHYHCSCGDGWFGDGVKCADVDECANRTS--VCSADAECVNTAGSYHCECSDGFIGDGVICSDLDECAEDVDLCENGQCLNVPGSYRCECEMGFTHTSNRKTCRDIDECSFQNICVFGTCQNIPGMFRCICDEGYELDRTGGNCT-DVDEC-LDSLNC-VNGHCENTA-GSYQCNCPIDFELNPTGIGCV---DTRVGNCFLEV--------AYNSKLACSAEIGFGVS------------------------RSSCCCSLGRVWGYPCDHCPTLNTSEYNTLCPGGEGFKPNPVTIILEDIDECQELPGVCQGGNCVNTFGSFQCECPAGFYLNTQSRICEDID----ECVLSLGVCGPGTCYNT-LGNYTCVCPQDYIQVNGGHRCMD---MRKSLCYRSYNGSACEHQLNFNITHRLCCCSYNVGKAWNKPCHACPIPGTDDYSSLCGSVTGFWIDIATGKPKDIDECHEILGVCAHGVCINHMGSFHCECPTGFLYNDLLLICEDIDECSSREPVCQRNADCINRPGGYQCECSDGYILTPNGDCNDRNECLETPSVCRHGDCVDIPGGYECMCHTGFTVTPNRRMCVDINECSHQPCGNGTCKNSVGSFNCICHHGFELATNNYCTDIDECAVFHSQLCRNGRCV-NNVGSFQCLCREGYELTFDGKTC--MDVNECTIIPGICAPGTCLNLDGS-FRCVCPDGYIVQSD-HCVDVNECSEEPGI-----------CTYGTCFNSLGSFECVCKPGFVLSEDKRRCYDTRE 2016          

HSP 8 Score: 95.1301 bits (235), Expect = 3.789e-19
Identity = 219/1030 (21.26%), Postives = 354/1030 (34.37%), Query Frame = 1
Query:  532 YCPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLP---------------------------------------YGECQPYGLSYYCSCPSGFHQSEDKKSC--------IVNSNSDICQSPEIAERCRGGSCVS----EGKGYRC-LCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYS---LCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ--TEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDL--------------------HR---EKCKTGICYPIG-----QND---YICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY----CFYGCFDENSISTCSCSENY----------------ENLFDTGLCIIKSDEISYSLGDSTCRTKSLNRTLNIKFSGIFKFSTGSPSEVKQSIEKILLIKQQKSIRLNVCSLQGEYQKIHKN--ELSNSF 3273
             C  GFT   NR  C DI+EC  +  C NG C N  GSF C C   H  +  T +     D+C ++ S     G+CV  + G + C+C + Y ++F+GK+C+   + N C     +C P                                       YG C     S+ C C  GF  SEDK+ C             +  C  P+     +   C S    EG G  C LC  E+     D     +G    +       +E      +C  G C++++  + C+C  G+        C  I+    +C++    C  G C  +    +EC C  GF       SC        +  +C     RC            Y C+C  GY+  ED + C    Q  D C     +   RG +C +   ++ CVC    I   + + C    +  T+P             +C+ G CV+T  +Y C+CG G+    +  +C    K         +C  +   + C             +C C  G             + DQC           C     +N++ +CPY       GH   I+    +      D+      CA+G C+N     RC C PGY +S  G  C  +++                  +  + +Y C C  GY    + RSC   +    ++  C                      HR   ++C + +  P G     QN    + C C  G+   +   +C  +D  +CA  ++RC+ G C ++  G+ C C   YT  +    C+     + +                       + C    C      ++C CP  F  +     C  D ++C      C YGC +      C C   Y                +N     + I+K  ++  +L    C +  LN    ++   +      +     +S+     I     I L +    G +  + +   EL+N+F
Sbjct: 1833 MCHTGFTVTPNRRMCVDINECSHQP-CGNGTCKNSVGSFNCIC--HHGFELATNNYCTDIDECAVFHSQLCRNGRCV-NNVGSFQCLCREGYELTFDGKTCM---DVNECTIIPGICAPGTCLNLDGSFRCVCPDGYIVQSDHCVDVNECSEEPGICTYGTCFNSLGSFECVCKPGFVLSEDKRRCYDTRESFCFTRFENSKCSVPQAFNTTKAKCCCSIMAKEGWGDPCELCPKEHDAAFQDLCPFGHGIIPGVGDTRVDLNECVENPEICVNGRCINMDGSFRCECPAGYTLDYTGTHCDDID----ECSVRN-PCGNGTCSNVIGA-FECLCEEGF-EPGPMMSCEDVNECGQNPLLCAF---RCINTF------GSYECSCPSGYTLREDGRMC----QDVDECAEDLHNCDSRGMECSNLIGTFMCVCPAGMIRRMSDEACQDENECLTQP------------GVCENGRCVNTVGSYTCECGVGFKTDSSATQCLDYRK--------GFCFTEVLHTMCQMSSSSRVPVSRSQCCCNGGHG-----------WGDQCE---------LCPLPATANYKKLCPY-------GHGYAIDGTDIDECKLIPDV------CANGACINMMGSYRCHCKPGYIASTAGTACVDVDECG------MSPKPCNFICKNTEGSYACSCPRGYTLQNDNRSCKDVDECQSRRHNCQFSCMNTIGGFTCKCPAGFSQHHRAYIDECLSDL-TPCGLQGACQNSVGSFSCECPQGFSLDSLGHNCDDVD--ECA-RDHRCQFG-CQNVAGGFRCSCPQGYTQHQQWNQCVDDNECLNA-----------------------DNCGSASCFNTLGSFKCGCPSGFTFDPASTSC-EDVDECGSFMNPCRYGCSNTQGGFACGCPAGYYRAGQGRNLICADWTDDNPLRLVVAILK--KLRPALDRVKCSSWLLNNIEVVRVQSVCVSIPANTVVFPESLPHFRPISHHLPIVLFIPENSGNFIDVVEVDCELTNAF 2745          

HSP 9 Score: 90.8929 bits (224), Expect = 8.357e-18
Identity = 190/787 (24.14%), Postives = 278/787 (35.32%), Query Frame = 1
Query:  346 KCICESGY-FGED---CNTAIISTCYVKIDRGLCKSTPENLQLSKEECC--SIFQVAWGNPCVFCDRNY-------CPKGFTQKENRCD---DIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERC--RGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ---TEPPAVRLCSKWE--YYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENIC-TPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSE------DGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMD 2601
            +C+C+ G+   ED   C     S C+ + +   C S P+    +K +CC   + +  WG+PC  C + +       CP G        D   D++EC +   IC+NG CIN  GSFRC+CP  + LD     C    D+C +  + CG  G C     G + C+C +     F     +   + N C     LC     C     SY CSCPSG+   ED + C      D+ +  E    C  RG  C +    + C+C        +D+ C     +E L            +CE G CV+    Y C+C  GF    +  +C+          +    CQ      +  +  +C C  G    +    C     T N   +C  YGH                     GY+               D  + + I   C  G C++   SYRC C   YI+S  G  CV   +   +  P   +C   E  Y   C  G                Y    + R C  +++  +   +  +         CM      +   GF C C  GF+           Y+D+CL++   C   G C+ S  S F C CP   SL   GH+C              D      RC  G C N     RC C  GY   +      D  EC   +   S    N L             +++C C +G+       SC   +        C      C+ G      Q  + C C  GY +A   ++ I  D
Sbjct: 1995 ECVCKPGFVLSEDKRRCYDTRESFCFTRFENSKC-SVPQAFNTTKAKCCCSIMAKEGWGDPCELCPKEHDAAFQDLCPFGHGIIPGVGDTRVDLNECVENPEICVNGRCINMDGSFRCECPAGYTLDYTGTHCD-DIDECSVR-NPCG-NGTCSNVI-GAFECLCEE----GFEPGPMMSCEDVNECGQNPLLCA--FRCINTFGSYECSCPSGYTLREDGRMC-----QDVDECAEDLHNCDSRGMECSNLIGTFMCVCPAGMIRRMSDEAC--QDENECLTQP--------GVCENGRCVNTVGSYTCECGVGFKTDSSATQCLDYRKGFCFTEVLHTMCQMSSSSRVPVSRSQCCCNGGHGWGDQCELC-PLPATANYKKLCP-YGH---------------------GYAIDG-----------TDIDECKLIPDVCANGACINMMGSYRCHCKPGYIASTAGTACVDVDECGMSPKPCNFICKNTEGSYACSCPRG----------------YTLQNDNRSCKDVDECQSRRHNCQF--------SCM------NTIGGFTCKCPAGFSQHHRA------YIDECLSDLTPCGLQGACQNSVGS-FSCECPQGFSLDSLGHNC-----------DDVDECARDHRCQFG-CQNVAGGFRCSCPQGYTQHQQWNQCVDDNECLNADNCGSASCFNTL------------GSFKCGCPSGFTFDPASTSCEDVDE-------CGSFMNPCRYGCSNT--QGGFACGCPAGYYRAGQGRNLICAD 2651          

HSP 10 Score: 86.6557 bits (213), Expect = 1.735e-16
Identity = 191/887 (21.53%), Postives = 301/887 (33.93%), Query Frame = 1
Query:  592 FKSICLNGECINEKGSFRCQCPPDHYLDE---------------------NTMSCQYRR-----------DQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECV---RYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKI-ETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGEC-VDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEE-----------PDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNN--ENICT---PGR--------------------CERSGNSNFRCVCPYYASLSKDGHSCLIN-YVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTR----------------------------KEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
              ++CLNG CI  +  +RC C      D                      NT    Y R           D+C   G  C   G+C+ T +G + CIC   + +S +G++C+        N    +CL  G C     S+ C C  GF  +   + C   ++ D C++P +   C  G CV+    +RC C        + + CV      T    V R      +        C   N DY     E  +    +     I     ++CAL+   C  G C+ L   N+ C C  G+   ++GR+C+  +        C +    C  G+C  + P  Y C C  G+    D + C           N+ +S  C  G C ++  S+ C C       + G  CV              K   +   Q G C V+ N                G  C   +  +  E            D + C  + +   C  G C+  +   FKC C    T    GR C     + C     E++CT   PGR                    C   G   F  +CP     +  G    IN  + +      C +   +  C  G C N     RC C  G+    + K C  I++      +                +++C C  GY   E+G   +K+    +    C+ +   C  G C       Y C C  G+  + D  +C   D  +C ++   C  G+C ++V  Y C C   Y  T + + C          DI E + +N   + +C+                             +E+++ C+ G+C      Y C C   F  +     C+ D N+C
Sbjct:  434 LPNLCLNGRCIPMESDYRCDCNTGFKEDNRGECSDVDECEFDPCANGNCINTPGSYYCRCHTGFLRVPDIDECLQNGVLCK-NGRCLNT-EGSFQCICNSGFKLSPDGRNCVDHDECAATN----MCL-NGMCINEDGSFKCVCKPGFTLNSSGRYC---TDIDECRTPGV---CMNGRCVNTQGSFRCECFAGLTVGIDGRTCVDTHMRSTCYGAVKRGLCLRPFQRAVTKSQCCCANPDY--AFGEPCHPCPAKHSGTAITHADINECALDPDICSNGVCENL-RGNFRCVCNIGYESDQSGRNCLDIDE-------CVVNSLLCDNGLCRNV-PGSYSCTCPAGFIFRHDTETCED--------VNECVSSPCVNGVCKNSAGSFYCECSQGSKLDSTGLLCVDS-----------VKGSCWLTLQDGRCEVNINGATLRSQCCATLGLAWGSPCEPCQTDLVCERGFAQSRGASCEDVNEC--EVFPGVCHNGHCVNTRG-SFKCQCPESLTLDVTGRLCVDVRSEPCFLTYEEDVCTQPVPGRFRMDMCCCTVGLAWGKDCDLCPEPGTRQFDTLCPRGPGFANKGD--FINGAIPSSSDINECKVF--QSICVHGKCRNTIGSFRCRCDSGFALDTNEKNCTDIDECMISPDVCGHGTCVNTL-----GSFQCDCFPGY---ESGIMMMKN---CMDIDECERNLSLCNGGTCENT-DGSYKCVCPPGHHLSVDGSAC--EDVNECDLSSTLCPNGWCVNLVGTYQCSCNSGYQTTPDWKGC---------TDIDECTIENGGCELYCSNSEGSYSCSCGQGYSLTPDQRTCSDVNECEEVLDICEGGQCTNVPGAYHCLCYEGFMASVDMKTCI-DVNEC 1246          

HSP 11 Score: 55.4546 bits (132), Expect = 4.345e-7
Identity = 79/313 (25.24%), Postives = 116/313 (37.06%), Query Frame = 1
Query:  526 RNYCPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMS------CQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIE---TITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNS 1431
            R +C  G+  +     C D+DEC       N  C N +GS+ C CP  + L  +  S      CQ RR  CQ           C+ T  G +TC C   +S          +   + C      C   G CQ    S+ C CP GF       +C    + D C       RC+ G C +   G+RC C   Y  +    +CV    +E L +  C  +         SC +    + C C  GF        C  ++   +  + C       QGG         + C C  G+ R+  GR+ I A+ T ++
Sbjct: 2388 RCHCKPGYIASTAGTACVDVDECGMSPKPCNFICKNTEGSYACSCPRGYTLQNDNRSCKDVDECQSRRHNCQF---------SCMNTIGG-FTCKCPAGFSQH-------HRAYIDECLSDLTPCGLQGACQNSVGSFSCECPQGFSLDSLGHNC---DDVDECAR---DHRCQFG-CQNVAGGFRCSCPQGYTQHQQWNQCVD--DNECLNADNCGSA---------SCFNTLGSFKCGCPSGFTFDPASTSCEDVDECGSFMNPCRYGCSNTQGG---------FACGCPAGYYRAGQGRNLICADWTDDN 2656          
BLAST of Fibrillin-2 vs. Ensembl Zebrafish
Match: fbn2b (fibrillin 2b [Source:ZFIN;Acc:ZDB-GENE-090112-3])

HSP 1 Score: 137.502 bits (345), Expect = 5.194e-32
Identity = 227/919 (24.70%), Postives = 344/919 (37.43%), Query Frame = 1
Query:  310 NNCSNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKI----DRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKK------TNYNVC-------NYFKKLCLPYGECQPYGLSYYC-----SCPSGFHQSEDKKSC-------IVNSNS----DICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNN--------------DQECVRYGTSEPLVSRY---CSKS----------------EYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHR-CQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ--TEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKC---------SRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGD---------KTYGFKCLCLPGFTSA--SDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            N C +   C NG C+   G +             G  C    +  C++      D G+  S    + +++  CC     AWGNPC  C        +  CP G   + N      +DIDECQ    +C  G C+N  GSF+C+CP  +YL+E T  C+   D+C  +   CG  G C  T  G YTC+C   Y     G +C+         N+N         N  KK+C     C  Y +         +CP+    SE +  C       I++ ++    DI +  EI   C  G C+++   +RC C   +  YNN              D  C R      +   Y   CS                  E  ++C  G C+D    + C C  GF  T ++  C+ I+    Q       C  G C+     +Y C C  GF  + N   C+  +        C ++  + C+ G C       + C CL+GY+ + D K C+      D  +   +   C+ G C +   S+RC+C   Y   N+  +CV   +   EP            ++CQ G C +T  ++ C C  G+  ++NGR+C         +R E      P        +     + G   GD         +   F  LC  G  +    +GR    E +++C+ N  IC  G C  +  S FRC CP+  +L   G +C+         T  C I      C +G C N   + G    S ++G E   +     I                   +YEC C  GY+  ++ R C   +        C      CK  I        ++C C  G  +  D + C  MD  +C      CK G C + V  Y C C   +  +  G +CI
Sbjct: 1494 NECFDPVNCINGVCVNLPGSYLCNCPPDFELNPSGVGCVDTRVGNCFLDTLDRGDGGISCSAEIGVGVTRASCCCSLGGAWGNPCELCPSVNSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICE-DIDECTAHIGICGP-GTCYNTL-GNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNFNDTCENELSFNMTKKMC-----CCAYNVGKAWNRPCEACPTP-ATSEYQLLCGNQAPGFIIDIHTGKPIDIDECREIPGICANGVCINQIGSFRCECPMGFS-YNNILLICEDIDECNSGDNLCQRNANCINIPGSYRCECSAGFKLSPSGACIDRNECQEIPNVCSHGECIDTQGSFRCLCHNGFKTTPDQTMCMDIDECDRQ------PCGNGTCKNT-VGSYNCLCFPGFELTHN-NDCMDIDE-------CSVHASQVCRNGQCINNM-GSFKCLCLDGYNLTPDGKNCV------DINECVTLPGACQPGTCQNLDGSFRCICPPGYEVQND--KCVDINECNVEP------------NICQFGTCKNTPGSFQCICQPGFVLSDNGRRCFDTRESFCFTRFEAGKCSVPKPRNTTKAKCCCSLLPGEGWGDPCELCPRDTEEAAFHTLCPYGHEAVPKPEGR----EDMNECVENPEICGNGLCINTDGS-FRCECPFGYNLDYTGVNCV--------DTDECSI---GNPCGNGTCSN---VPGGFECSCQEGFEPGPMMTCEDINECAVNPLLCAFRCVNTFGSYECMCPTGYVLRDDNRMCRDQDECAEGLDDCASRGMACKNQI------GTFMCICPPGMTRRPDGEGC--MDLNECRSKPGICKNGRCVNTVGSYRCECNEGFEASATGTECI 2339          

HSP 2 Score: 118.627 bits (296), Expect = 2.629e-26
Identity = 204/892 (22.87%), Postives = 322/892 (36.10%), Query Frame = 1
Query:  172 VYGDCVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGS-SCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGE-CQPYGLSYYCSCPSGFHQSEDKKSC-----IVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALN--------QFQCQGGRCQELDNNNYEC-QCLRG--FIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVR-------YKQTEPPAVRLCSKWEYYSLC----QGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEP---DNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            V GDCV ++  Y C   +C      E Y  T   + C   ++ +      N   C+NG+C+   G F   CN                + +P+       + C+   +     C+  D ++   C  GF    N   C DIDEC    IC+NG C+N +GSFRC+CPP   +D +   C     +   YG+   G+  +  P +  +  C C  P                            +GE CQP        CP+ F+ +E +  C     I     DI +     + C+ G C +    YRC+CN  Y+   + + CV    +E LV+R         LC+ G C +    Y C C +GF    +   C  I    S   +N         F C+     +LD+ N  C   ++G  ++  ++GR  +        +  C   G    +    P    E   AC +G+ +       +K    +D  + +     C  G+CV+   S+RC C         G+ CV         K  E   V          +C         VD                  G   +     +T  P   D + C +  +   C  G C  +    FKC C  GF    + R+C    +D+C  + ++C  G C  +  S F C C        DG+      +        C+   + L C  G C+N      C C PG++ S +   C  + +     +L +               Y+C C  GY  + + + C+  +   I    CD H             +  Y C+C  GY    D ++C  +D  +C      C GG C +I   Y C+C   +  + + R CI
Sbjct:  505 VNGDCVNTQGSYHC---KCH-----EGYQGTPTKQACIDIDECI-----VNGVMCRNGRCVNTDGSFQCICNAGF-------------EISPDGKNCIDHDECATTNMCLNGMCINEDGSFKCICKPGFALAPNGRYCTDIDECHTSGICMNGRCVNTEGSFRCECPPGLAIDVDGRVCVDTHMRTTCYGAIKMGVCSRPFPGAVTKSECCCANPEH-------------------------GFGEPCQP--------CPA-FNSAEFQAVCSSGPGITTDGRDINECALDPDICQNGICENLRGSYRCICNIGYESDASGKNCVDI--NECLVNRL--------LCDNGMCRNTPGSYTCSCPKGFSFKADSETCEDINECDSNPCINGICRNIAGSFNCECSHGSKLDSTNTVCVDSMKGTCWLNIQDGRCEVNINGATLKSECCSTLGAAWGS----PCERCEIDPACSKGFGR-------MKGLVCEDINECEVFPGVCTNGRCVNTQGSFRCECPEGLTLDGAGRTCVDVRSEQCYMKWDEDECVEPLPGRYRVDMCCCTVGAAWGVDCEACPKPNTNEFKTICPRGPGIANRGDILTGRPFYKDVNECKV--FRGLCTHGTCR-NTIGSFKCRCDSGFALTMEERNC--TDIDECTISPDLCGHGVCVNTPGS-FECEC-------FDGYESGFMMMKNCMDIDECE--RDPLLCRGGTCLNTEGSYECDCPPGHQLSTEASACEDVNECQLSDNLCKHGQCVNMV-----GTYQCSCETGYQVTPDRQGCVDIDECTIMNGGCDTHCTN---------SEGSYECSCSEGYALMPDLRTCADID--ECEDTPDICDGGQCTNIPGEYRCLCYDGFMASMDMRTCI 1284          

HSP 3 Score: 104.375 bits (259), Expect = 5.918e-22
Identity = 235/1036 (22.68%), Postives = 347/1036 (33.49%), Query Frame = 1
Query:  148 CCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKG----YRCLCN-GEYQGYNNDQE-CVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDY------------------YCQCSEGFYATENRRRCIKI------ETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQ-------------------------CLNNEN----ICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEII-----------EKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            CC GW     G+ C+   C   CG G C   N+C C    +   +C     + C+  C N G C    C C+ GY G  C   +                                    C+ +++  +C+     +  +K  CC+    AWG+PC  C    + C +GF    +   C D+DECQ    +C  G CI                  NT+                           G Y C C   +  S   + C    + + C     +C   GEC     SY C+CP G+  S D   C V+     C S  +A     G C SE  G     +C C+ G      +  E C   G+ E    R C +   +    GG   D N                     Y   SE  +   N     KI      ET    C      C  GRC     + Y C+C  G+ +   G  CI  +         E   + C  G C       Y C C EGY  +  ++ CI      D C    +   CR G+CV+   S++C+C+  +  S +G+ C+ + +               ++C  G C++ + ++ C C  G+    NGR C+ I++  T                CM GRC+ +    F+C C PG     DGR C   ++                           C N E+     C P  C    ++ F+ VC     ++ DG    IN    +P     DI      C +G C N     RCIC  GY+S   GK C  I +      L        G       +Y C C  G+    +  +C         + I +     C  GIC  I    + C C  G K  +    C+      C +N           I DG   + +   T+     +C   + A               S+ F   K ++             C  G+CV  Q  ++C+CP     +     CV
Sbjct:   66 CCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSSGHL-APSCGAAAVQSCSVRCMNGGMCNEDACSCQKGYTGTHCGQPVCESGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLSGIVCTKTLCCATIGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQDVDECQAVPGLCAGGNCI------------------NTV---------------------------GSYECKCPAGHRQSETNQKC---EDIDECATISGVC-DGGECTNTAGSYVCTCPRGYITSTDGSRC-VDHRIGTCFS-SLAN----GRCASELSGQYTKMQCCCDTGRCWALGHIPEMCPVRGSDE--YRRLCIQRLPFGTGNGGIIHDGNGGLNIGGYGKGPSQNGNGGGGYIYGSEHTFTNGNGNGGQKIQISQLNETTIDVCKHFTNLCLNGRCIPTPTS-YRCECNMGYRQDVRGE-CIDVD---------ECVSNPCVNGDCVNTQ-GSYHCKCHEGYQGTPTKQACID----IDECIVNGV--MCRNGRCVNTDGSFQCICNAGFEISPDGKNCIDHDEC-----------ATTNMCLNGMCINEDGSFKCICKPGFALAPNGRYCTDIDECHTS-------------GICMNGRCV-NTEGSFRCECPPGLAIDVDGRVCVDTHMRTTCYGAIKMGVCSRPFPGAVTKSECCCANPEHGFGEPCQP--CPAFNSAEFQAVCSSGPGITTDGRD--INECALDP-----DI------CQNGICENLRGSYRCICNIGYESDASGKNCVDINEC-----LVNRLLCDNGMCRNTPGSYTCSCPKGFSFKADSETC---------EDINECDSNPCINGICRNIA-GSFNCECSHGSKLDSTNTVCVDSMKGTCWLN-----------IQDGRCEVNINGATLKS---ECCSTLGAAWGSPCERCEIDPACSKGFGRMKGLVCEDINECEVFPGVCTNGRCVNTQGSFRCECPEGLTLDGAGRTCV 956          

HSP 4 Score: 101.293 bits (251), Expect = 5.613e-21
Identity = 221/937 (23.59%), Postives = 340/937 (36.29%), Query Frame = 1
Query:  334 CQNG---------KCICESGYFGEDC--NTAIISTCYVK---IDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC----------QYRRDQCQLYGSSCGIFGKCVPTSDGQYTCIC----IKPY-SVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI--------VNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECV-----------RYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSI--CELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGG---ECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNC-VNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDC-------ILKIIAVKSVD--------ISEVSYQNPQSQSFCTRKEIIE-----KCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            CQNG         +CIC  GY  +    N   I+ C V     D G+C++TP +   S                       CPKGF+ K +   C+DI+EC   + C+NG C N  GSF C+C     LD     C            +  +C++  +   +  +C  T    +   C    I P  S  F     +   + N C  F  +C   G C     S+ C CP G       ++C+        +  + D C  P          C + G  +   C    +   N+ + +              T  P          +  LC  G+C +    + C+C  GF  T   R C  I+    +C ++   C  G C      ++EC+C  G+   E+G   +K     N   I  CE     C+ G C       Y C C  G+  S +   C      +D  + Q     C+ GQCV+   +Y+C C   Y  + + Q CV   +               ++  GG    C ++  +Y C C  GY    + R C+ I+ +  + PD            C GG+C  +    ++CLC  GF ++ D R+C    V++C  N NIC  G CE +  S F C              C + Y   + +T   D  V+     + NC ++  C+  PG                                      +++C+C +G+    +G  CI  +  + ++  C+ + E   T          Y C+C  G+    D  SC  MD  +CA N   C+ G C +   GY C C   +T TE+ + C          I    S          + +  Y+  +S   CT  +I E      C  G CV     Y C CP  F+ N     CV
Sbjct:  739 CQNGICENLRGSYRCICNIGYESDASGKNCVDINECLVNRLLCDNGMCRNTPGSYTCS-----------------------CPKGFSFKADSETCEDINECD-SNPCINGICRNIAGSFNCECSHGSKLDSTNTVCVDSMKGTCWLNIQDGRCEVNINGATLKSECCSTLGAAWGSPCERCEIDPACSKGFGRMKGLVCEDINECEVFPGVCT-NGRCVNTQGSFRCECPEGLTLDGAGRTCVDVRSEQCYMKWDEDECVEPLPGRYRVDMCCCTVGAAWGVDCEACPKPNTNEFKTICPRGPGIANRGDILTGRPFYKDVNECKVFRGLCTHGTCRNTIGSFKCRCDSGFALTMEERNCTDID----ECTISPDLCGHGVCVNTP-GSFECECFDGY---ESGFMMMK-----NCMDIDECERDPLLCRGGTCLNTE-GSYECDCPPGHQLSTEASAC------EDVNECQLSDNLCKHGQCVNMVGTYQCSCETGYQVTPDRQGCVDIDEC--------------TIMNGGCDTHCTNSEGSYECSCSEGYALMPDLRTCADID-ECEDTPD-----------ICDGGQCT-NIPGEYRCLCYDGFMASMDMRTCID--VNECDLNPNICLHGDCENTKGS-FIC-------------HCQLGYFVKKGSTGCTD--VDECEIGAHNCDLHAACVNAPG--------------------------------------SFKCRCRDGW--EGDGIKCIDVDECVTEEHNCNPNAECLNT-------PGSYRCSCKEGFN--GDGFSCSDMD--ECADNVNLCENGQCLNAPGGYRCECEMGFTPTEDSKACQDIDECNFQNICVFGSCQNLPGMFRCVCDYGYELDRSGGNCT--DINECFDPVNCINGVCVNLPGSYLCNCPPDFELNPSGVGCV 1532          

HSP 5 Score: 95.9005 bits (237), Expect = 2.697e-19
Identity = 216/946 (22.83%), Postives = 338/946 (35.73%), Query Frame = 1
Query:  346 KCICESGYF--GEDCNTAIISTCYVKID---RGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSI-CLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIE---------TITSQC--ALNQFQCQ--------GGRCQELDN------------------NNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ------------TEPPAVRLCSKWEYYSLCQGG-ECVDTXXXXXXXXXXXXXATENGRKCS-RIEKQVTEEPDNSYC--LLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKV-----------SSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREK-------------CKTGICY-PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRC-KGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            KC C+SG+    E+ N   I  C +  D    G+C +TP + +    EC   ++                 GF   +N C DIDEC+   + C  G C+N +GS+ C CPP H L     +C+   ++CQL  + C   G+CV    G Y C C   Y V+ + + C+   + + C      C  +  C     SY CSC  G+    D ++C     +DI +  +  + C GG C +    YRCLC   +    + + C+     +             ++C  G C +    + C C  G++  +    C  ++          + + C  A   F+C+        G +C ++D                    +Y C C  GF  + +G SC   +   ++ ++CE        G C    P  Y C C  G++ +ED K C    Q  D C  Q I   C  G C +    +RCVC   Y    +G  C    +               P   LC+    + L   G  CVDT               + G  CS  I   VT     S C  L   + + C    C    +  +K LC  G     +  +   E +D+C     +C  G C  +  S F+C CP    L+++   C       +  T +  I      C  G C N      C+C P Y     G  C  + K            + +      +            N  C+       SE    C       I     D+H  K             C  G+C   IG   + C C +G+        C  +D  +C   +  C +   C +I   Y C C   + ++ +G            +D +E              +EI   C  G+C++ Q  ++C C + FKT      C+
Sbjct: 1057 KCRCDSGFALTMEERNCTDIDECTISPDLCGHGVCVNTPGSFEC---ECFDGYE----------------SGFMMMKN-CMDIDECERDPLLCRGGTCLNTEGSYECDCPPGHQLSTEASACE-DVNECQLSDNLC-KHGQCVNMV-GTYQCSCETGYQVTPDRQGCV---DIDECTIMNGGCDTH--CTNSEGSYECSCSEGYALMPDLRTC-----ADIDECEDTPDICDGGQCTNIPGEYRCLCYDGFMASMDMRTCIDVNECD----------LNPNICLHGDCENTKGSFICHCQLGYFVKKGSTGCTDVDECEIGAHNCDLHAACVNAPGSFKCRCRDGWEGDGIKCIDVDECVTEEHNCNPNAECLNTPGSYRCSCKEGF--NGDGFSCSDMDECADNVNLCE-------NGQCLNA-PGGYRCECEMGFTPTEDSKAC----QDIDECNFQNI---CVFGSCQNLPGMFRCVCDYGYELDRSGGNCTDINECFDPVNCINGVCVNLPGSYLCNCPPDFELNPSGVGCVDTRVGNCFLDTLDRG--DGGISCSAEIGVGVTRA---SCCCSLGGAWGNPCE--LCPSVNSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGS-FQCECPAGYYLNEETRIC----EDIDECTAHIGI------CGPGTCYNTLGNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNFNDTCENELSFNMTKKMCCCAYNVGKAWNRPCEACPTPATSEYQLLCGNQAPGFII----DIHTGKPIDIDECREIPGICANGVCINQIGS--FRCECPMGFSYNNILLICEDID--ECNSGDNLCQRNANCINIPGSYRCECSAGFKLSPSG----------ACIDRNEC-------------QEIPNVCSHGECIDTQGSFRCLCHNGFKTTPDQTMCM 1893          

HSP 6 Score: 93.5893 bits (231), Expect = 1.344e-18
Identity = 215/938 (22.92%), Postives = 325/938 (34.65%), Query Frame = 1
Query:  526 RNYCPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNS----DICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSIC-ELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYC--IKNEQYKDYCQNQ--------------------EISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ--------------TEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXA---TENGRKCSRIEKQVTEEPDNSYCLLQEYLSR--CMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQC-LNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVL--------------------------GYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCP----YCFYGCFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTCRTKS 3087
            R  C  GFT  E+   C DIDEC F++IC+ G C N  G FRC C   + LD +  +C    D  + +     I G CV    G Y C C   + ++ +G  C+   +  V N F    L  G+    G+S  CS   G   +     C +        ++C S    E             Y+ LC G         E  R      ++       E   LC+GG+CV+    + C+C  G+Y  E  R C  I+  T+   +    C  G C      NY C C   +++   G +C+   +     S+C   +   C+  + + +      CA   G + +   + C      +Y+  C NQ                    EI   C  G C++   S+RC C   +  +N    C    +                 P    C     + L   G C+D N          +     T+   +C          PD + C+  +   R  C  G C  +    + CLC PGF    +    D   +D+C ++   +C  G+C  +  S F+C+C    +L+ DG +C+ IN   T P             C  G C N     RCIC PGY+   D  +C  I + +      +      G  +    +++C C  G++ S+NGR C  +     ++S C    E  K  +  P       C C L                           Y      K     D  +C  N   C  G C +    + C C   Y +   G +C         VD  E S  NP              C  G C      ++C C   F+          D N+C      C + C +      C C   Y    D  +C    DE +  L D   R  +
Sbjct: 1433 RCECEMGFTPTEDSKACQDIDECNFQNICVFGSCQNLPGMFRCVCDYGYELDRSGGNCT---DINECFDPVNCINGVCV-NLPGSYLCNCPPDFELNPSGVGCV---DTRVGNCFLDT-LDRGD---GGIS--CSAEIGVGVTRASCCCSLGGAWGNPCELCPSVNSTE-------------YKTLCPG--------GEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICEDIDECTAHIGI----CGPGTCYNT-LGNYTCVCPPEYMQVNGGNNCMDMRK-----SVCYRNFNDTCENELSFNMTKKMCCCAYNVGKAWNRPCEACPTPATSEYQLLCGNQAPGFIIDIHTGKPIDIDECREIPGICANGVCINQIGSFRCECPMGFSYNNILLICEDIDECNSGDNLCQRNANCINIPGSYRCECSAGFKLSPSGACIDRNECQEIPNVCSHGECIDTQGSFRC-LCHNGFKTTPDQTMCMDIDECDRQPCGNGTCK-NTVGSYNCLCFPGFELTHNNDCMD---IDECSVHASQVCRNGQCINNMGS-FKCLCLDGYNLTPDGKNCVDINECVTLPGA-----------CQPGTCQNLDGSFRCICPPGYEVQND--KCVDINECN-----VEPNICQFGTCKNTPGSFQCICQPGFVLSDNGRRCFDT-----RESFCFTRFEAGKCSVPKPRNTTKAKCCCSLLPGEGWGDPCELCPRDTEEAAFHTLCPYGHEAVPKPEGREDMNECVENPEICGNGLCINTDGSFRCECPFGYNLDYTGVNC---------VDTDECSIGNP--------------CGNGTCSNVPGGFECSCQEGFEPGPMMT--CEDINECAVNPLLCAFRCVNTFGSYECMCPTGYVLRDDNRMC-RDQDECAEGLDDCASRGMA 2271          

HSP 7 Score: 93.2041 bits (230), Expect = 1.462e-18
Identity = 197/891 (22.11%), Postives = 322/891 (36.14%), Query Frame = 1
Query:  436 KSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPL-VSRY----CSKSEYYSLCEGGSCVDL------------------NNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQS-----EDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCL-LQEYLSR---CMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLN------------NENICTPGRCERSGNSNFRCVC---PYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKG-GYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            K +P    + + EC  I  V     C+    ++   C  GF  T  +  C DIDEC  +  C NG C N  GS+ C C P   L  N        D+C ++ S     G+C+  + G + C+C+  Y+++ +GK+C+   + N C      C P G CQ    S+ C CP G+    DK   I   N +    P I   C+ G+C +    ++C+C   +   +N + C  + T E    +R+    CS  +  +  +   C  L                     ++  C  G  A              ++C  N   C  G C   D + + C+C  G+     G +C+  +            G+ C  G C  + P  + C+C EG+        ED   C  N     +             +CV+   SY C+C   Y+  ++ + C    +        C++       +G  C                  + G         +T  PD   C+ L E  S+   C  GRC+ +    ++C C  GF +++ G  C       C              N N  T   C  +G   +  +C   P   ++       L   Y T       C+++ N   C +G C+N     RC C  GY +   G  C  +++ S                +  + +Y C C  GYI   +G++C   +    K+  C      C   I        + C C  G+ Q   + +CI  DN +C+     C     C +    + C C   +++   G +C          D+ E    +              +CQ G C      Y+C CP  +  +Y  ++CV D N+C
Sbjct: 1843 KLSPSGACIDRNECQEIPNVCSHGECIDTQGSFRCLCHNGFKTTPDQTMCMDIDECD-RQPCGNGTCKNTVGSYNCLCFPGFELTHNNDCMDI--DECSVHASQVCRNGQCI-NNMGSFKCLCLDGYNLTPDGKNCV---DINECVTLPGACQP-GTCQNLDGSFRCICPPGYEVQNDKCVDINECNVE----PNI---CQFGTCKNTPGSFQCICQPGFVLSDNGRRC--FDTRESFCFTRFEAGKCSVPKPRNTTKAKCCCSLLPGEGWGDPCELCPRDTEEAAFHTLCPYGHEAVPKPEG----REDMNECVENPEICGNGLCINTDGS-FRCECPFGYNLDYTGVNCVDTDECS--------IGNPCGNGTCSNV-PGGFECSCQEGFEPGPMMTCEDINECAVNPLLCAF-------------RCVNTFGSYECMCPTGYVLRDDNRMCRDQDE--------CAEGLDDCASRGMAC----------------KNQIGTFMCICPPGMTRRPDGEGCMDLNECRSKPGICKNGRCV-NTVGSYRCECNEGFEASATGTECIDNRKGFCFTEVLQTMCQQSSTNRNTVTKSECCCNGGRGWGSLCELCPLPGTIQYKKMCPLGPGYTTDGRDINECEVMPNL--CKNGQCINSVGSFRCHCNVGYTNDFTGTSCIDMDECSQ------SPKPCNFLCKNTEGSYLCSCPRGYILQPDGKTCKDLDECSTKQHNCQF---LCVNTI------GGFTCKCPSGFTQ--HQTACI--DNNECSNQPNICGSRASCLNSPGSFNCECQKGFSLDATGLNCD---------DVDECGGNH--------------RCQHG-CQNMMGGYRCGCPQGYVQHYQWNQCV-DENEC 2618          

HSP 8 Score: 75.485 bits (184), Expect = 4.454e-13
Identity = 180/776 (23.20%), Postives = 274/776 (35.31%), Query Frame = 1
Query:  526 RNYCPKGFTQKENRCDDIDECQFK-SICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNG--KSCIKKTNYNVCNYFKKLCLPYG-ECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGE------------CVDTXXXXXXXXXXXXXATENGRK-CSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSC--LINYVTTEPTTKYCDILVNRL-----RCASG------------NCVNDRCICGP-----------------GYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNY 2694
            R  CP G+  + ++C DI+EC  + +IC  G C N  GSF+C C P   L +N   C   R+         G      P +  +  C C       +    + C + T       F  LC PYG E  P         P G    ED   C+ N        PEI   C  G C++    +RC C     GYN D     Y     + +  CS     + C  G+C ++   + C C EGF         +  E I ++CA+N   C   RC      +YEC C  G++  ++ R C   +        C   G  C+  +        ++C C  G ++  D + C+      D  + +     C+ G+CV+   SYRC C+  + +S  G EC+  ++        C      ++CQ               C                 T   +K C       T+  D + C +   L  C  G+CI +    F+C C  G+T+   G SC    +D+C  +   C    C+ +  S + C CP    L  DG +C  L    T +   ++  + VN +     +C SG             C N   ICG                  G+     G  C  +++                        Y C C  GY++      C+                + C +  CY      Y C C  G+        C   D  +C++    C  G C +   GYLC C G +
Sbjct: 2000 RCICPPGYEVQNDKCVDINECNVEPNICQFGTCKNTPGSFQCICQPGFVLSDNGRRCFDTRESFCFTRFEAGKCSVPKPRNTTKAKCCCSLLPGEGWGDPCELCPRDTEEAA---FHTLC-PYGHEAVPK--------PEG---REDMNECVEN--------PEI---CGNGLCINTDGSFRCEC---PFGYNLD-----YTGVNCVDTDECSIG---NPCGNGTCSNVPGGFECSCQEGFEPGPM----MTCEDI-NECAVNPLLC-AFRCVNT-FGSYECMCPTGYVLRDDNRMCRDQDECAEGLDDCASRGMACKNQI------GTFMCICPPGMTRRPDGEGCM------DLNECRSKPGICKNGRCVNTVGSYRCECNEGFEASATGTECIDNRKG------FCFTEVLQTMCQQSSTNRNTVTKSECCCNGGRGWGSLCELCPLPGTIQYKKMCPLGPGYTTDGRDINECEVMPNL--CKNGQCI-NSVGSFRCHCNVGYTNDFTGTSCID--MDECSQSPKPCN-FLCKNTEGS-YLCSCPRGYILQPDGKTCKDLDECSTKQHNCQF--LCVNTIGGFTCKCPSGFTQHQTACIDNNECSNQPNICGSRASCLNSPGSFNCECQKGFSLDATGLNCDDVDECGGNHRCQHGCQNMM-------GGYRCGCPQGYVQHYQWNQCVDENECT--------GNQVCGSASCYNT-LGSYKCVCPSGFDFEATAGGC--QDVNECSMGNNPCSYG-CSNTDGGYLCGCPGGF 2685          

HSP 9 Score: 55.8398 bits (133), Expect = 3.356e-7
Identity = 107/454 (23.57%), Postives = 165/454 (36.34%), Query Frame = 1
Query:  229 VGLNVCECYDKTIRTETCPQNNQKLCTNNCSNK-GQCQNGKCICESGYFGEDCNTAIIST-------------CYVKIDRGLCKSTPENLQ-LSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQ-FKSICLNGECINEKGSF-----------------------------------------RCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGR 1398
            +G  +C C     R    P     +  N C +K G C+NG+C+   G +  +CN    ++             C+ ++ + +C+ +  N   ++K ECC      WG+ C  C        +  CP G     +   DI+EC+   ++C NG+CIN  GSF                                          C CP  + L  +  +C+   D+C     +C     CV T  G +TC C  P   + +  +CI     N C+    +C     C     S+ C C  GF       +C    + D C       RC+ G C +   GYRC C   Y  +    +CV            C+ ++   +C   SC +    Y C C  GF        C  +    ++C++    C  G C   D   Y C C  GF R+  G 
Sbjct: 2276 IGTFMCICPPGMTRR---PDGEGCMDLNECRSKPGICKNGRCVNTVGSYRCECNEGFEASATGTECIDNRKGFCFTEVLQTMCQQSSTNRNTVTKSECCCNGGRGWGSLCELCPLPGTIQYKKMCPLGPGYTTDG-RDINECEVMPNLCKNGQCINSVGSFRCHCNVGYTNDFTGTSCIDMDECSQSPKPCNFLCKNTEGSYLCSCPRGYILQPDGKTCK-DLDECSTKQHNCQFL--CVNTIGG-FTCKC--PSGFTQHQTACIDN---NECSNQPNICGSRASCLNSPGSFNCECQKGFSLDATGLNC---DDVDECGG---NHRCQHG-CQNMMGGYRCGCPQGYVQHYQWNQCVD--------ENECTGNQ---VCGSASCYNTLGSYKCVCPSGFDFEATAGGCQDV----NECSMGNNPCSYG-CSNTD-GGYLCGCPGGFYRAGQGH 2692          
BLAST of Fibrillin-2 vs. Ensembl Zebrafish
Match: fbn2a (fibrillin 2a [Source:ZFIN;Acc:ZDB-GENE-090112-4])

HSP 1 Score: 116.316 bits (290), Expect = 1.028e-25
Identity = 216/1000 (21.60%), Postives = 349/1000 (34.90%), Query Frame = 1
Query:  139 EPLCCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPC-------VFCDRNY-------------------------------------CPKGFTQKEN--RCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYT---CICIKPYSVSFNGKSCIKKTNYNVC-----NYFKKLCLPYG----------ECQPYGLSYYCSCPSG----FHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSE---YYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVT--EEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLP----------GFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESA----LIKKSICDLH------REKCKTGICYPIG------QNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            +  CC GW     G+ CV   C  DCG G C   N+C C      T TC   + K C   C N G C++  C C  GY G  C   +                                    C++++    C         SK  CC+    AWG+ C         C R +                                     CP G+ Q  +  +C+D+DEC   +  C  G CIN  GSF C CP  + L  +   C    DQ      +  + G+C     G++    C C +       G+   ++T + +C     + + ++CL             E  P+  S +   P+      H    +    +     I Q P+I +  R         G++                       P+VS   + +      +LC  G C+ + +DY C C+ GF   +NR  C  ++    +C  +   C  G C      +Y C+C  GF+R    ++CI  +        C   G  C+ G C       + C C  G+  S D + C+ +++          +  C  G C++   S++CVC   +  +++G+ C    +   P V           C  G CV+T  ++ C+C  G     +GR C     + T         CL     +      C  +  Y F   C P             ++  G S D + +++C  + +IC+ G CE     NFRCVC       + G +CL             + +VN L C +G C N      C C  G+    D + C  + +  S            G  +    ++ C+C  G      G  C+ S        ++   C+++      R +C   +    G      Q D +C    G+ Q+   +     D  +C V    C  G+C +    + C C  + T+   GR C+
Sbjct:   58 QSFCCPGWKTLPGGNQCVVPICRSDCGDGFCSRPNMCTCPGGQTAT-TCFTKSSKQCNIRCMNGGVCEDDYCQCPKGYTGSFCGQPVCEKNCQNGGHCIGPNRCACGYGFTGPQCERDYRTGPCFIQVHSRKCAGQSSEFVCSKALCCATVGQAWGHSCEQCPPISSPCTRGFIPNTRTGACQDVDECKVVPDLCKGGRCINTLGSYQCTCPVGYQQHVSILKCEDVDECSTIERACEAGHCINSAGSFSCVCPSGYVLSADRTRC---LDQHTGICFASVVNGRCAHEISGRFNKIQCCCDR-------GRCWSQRTTHEMCPVPGSDEYLRICLVGSALSGYNEEDPEMSPHHHSSFSVSPNDQILHPHNGNGQIKPQIRQTPQILQFPQIPQIPR------HDNGFK--------------------PQRPVVSVNETVNRCRLLPNLCLNGRCIPMESDYRCDCNTGF-KEDNRGECSDVD----ECEFD--PCANGNCINTP-GSYYCRCHTGFLRVPGKQTCIDIDE-------CLQNGVLCKNGRCLNTE-GSFQCICNSGFKLSPDGRNCVDHDECA-------ATNMCLNGMCINEDGSFKCVCKPGFTLNSSGRYCTDIDECRTPGV-----------CMNGRCVNTQGSFRCECFAGLTVGIDGRTCVDTHMRSTCYGAVKRGLCLRPFQRAVTKSQCCCANPDYAFGEPCHPCPAKHSAEFQVLCASGVGFSADGKDINECALDPDICSNGVCENL-RGNFRCVCNIGYESDQSGRNCL----------DIDECVVNSLLCDNGLCRNVPGSYSCTCPAGFIFRHDTETCEDVNECVS-------SPCVNGVCKNSAGSFYCECSQGSKLDSTGLLCVDSVKGSCWLTLQDGRCEVNINGATLRSQCCATLGLAWGSPCEPCQTDLVCE--RGFAQS---RGASCEDVNECEVFPGVCHNGHCVNTRGSFKCQCPESLTLDVTGRLCV 963          

HSP 2 Score: 97.4413 bits (241), Expect = 6.328e-20
Identity = 194/825 (23.52%), Postives = 299/825 (36.24%), Query Frame = 1
Query:  535 CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECV---RYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYY----CQCSEGFYATENRRRCIKIETITS------QCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGEC-VDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEE-----------PDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNN--ENICT---PGRCERSGNSNFR---CVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSED---GKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQA-TDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKT 2892
            C  GF +++NR  C D+DEC+F   C NG CIN  GS+ C+C           +C    D+C   G  C   G+C+ T +G + CIC   + +S +G++C+        N    +CL  G C     S+ C C  GF  +   + C   ++ D C++P +   C  G CV+    +RC C        + + CV      T    V R      +        C   N DY     C      ++ E +  C      ++      +CAL+   C  G C+ L   N+ C C  G+   ++GR+C+  +        C +    C  G+C  + P  Y C C  G+    D + C      +D   N+ +S  C  G C ++  S+ C C       + G  CV              K   +   Q G C V+ N                G  C   +  +  E            D + C  + +   C  G C+  +   FKC C    T    GR C     + C     E++CT   PGR        FR   C C    +  KD   C       EP T+  D L  R               GPG+ +  D   G+  YK      +     +  +          ++ C+C +G+    N ++C   +  +I   +C         G C       + C C  GY+      K+C+ +D  +C  N   C GG C +    Y C+C   + ++ +G  C      V   D+S                     C  G CV     YQC C   ++T
Sbjct:  488 CNTGF-KEDNRGECSDVDECEFDP-CANGNCINTPGSYYCRCHTGFLRVPGKQTC-IDIDECLQNGVLCK-NGRCLNT-EGSFQCICNSGFKLSPDGRNCVDHDECAATN----MCL-NGMCINEDGSFKCVCKPGFTLNSSGRYC---TDIDECRTPGV---CMNGRCVNTQGSFRCECFAGLTVGIDGRTCVDTHMRSTCYGAVKRGLCLRPFQRAVTKSQCCCANPDYAFGEPCHPCPAKHSAEFQVLCASGVGFSADGKDINECALDPDICSNGVCENL-RGNFRCVCNIGYESDQSGRNCLDIDE-------CVVNSLLCDNGLCRNV-PGSYSCTCPAGFIFRHDTETC------EDV--NECVSSPCVNGVCKNSAGSFYCECSQGSKLDSTGLLCVDS-----------VKGSCWLTLQDGRCEVNINGATLRSQCCATLGLAWGSPCEPCQTDLVCERGFAQSRGASCEDVNEC--EVFPGVCHNGHCVNTRG-SFKCQCPESLTLDVTGRLCVDVRSEPCFLTYEEDVCTQPVPGR--------FRMDMCCCTVGLAWGKDCDLC------PEPGTRQFDTLCPR---------------GPGFANKGDVLTGRAVYKDINECKVFQSICVHGKCRNTI----GSFRCRCDSGFALDTNEKNCTDIDECMISPDVC-------GHGTCVNT-LGSFQCDCFPGYESGIMMMKNCMDID--ECERNLSLCNGGTCENTDGSYKCVCPPGHHLSVDGSACE----DVNECDLSST------------------LCPNGWCVNLVGTYQCSCNSGYQT 1200          

HSP 3 Score: 92.0485 bits (227), Expect = 2.552e-18
Identity = 196/808 (24.26%), Postives = 309/808 (38.24%), Query Frame = 1
Query:  334 CQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYS--------------LCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYR---CVCHGKYISS-----NNGQECVR-YKQTEPPAVRLCSKWEYY-SLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRI---------EKQVTEEPDNSYCLLQEYLSRCMGGRCIGDK--------TYGFKCLCL--PGFTSASDGRSCDPEY--VDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSS-EDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSC 2589
            C NG+CI     +  DCNT      + + +RG C    E         C     A GN C+    +Y   C  GF +   +  C DIDEC Q   +C NG C+N +GSF+C C     L  +  +C    D+C    ++  + G C+   DG + C+C   ++++ +G+ C   T+ + C     +C+  G C     S+ C C +G     D ++C+       C        C      +  K   C  N +Y        C    ++E  V   C+    +S              +C  G C +L  ++ C C+ G+ + ++ R C+ I+    +C +N   C  G C+ +   +Y C C  GFI   +  +C           + E     C  GVC       + C C +G         C+  +  K  C       RC   +   NG + R   C   G    S          C R + Q+   +    ++ E +  +C  G CV+T  ++ C+C         GR C  +         E+ V  +P       +  +  C  G   G          T  F  LC   PGF +  D  +    Y  +++C   ++IC  G+C R+   +FRC C    +L  +  +C          T   + +++   C  G CVN     +C C PGY+S     K C  I++         L    GG  E  D +Y+C C  G+  S +G +C            CDL    C  G C  +    Y C+C  GY+   D K C
Sbjct:  472 CLNGRCIPMESDYRCDCNTG-----FKEDNRGECSDVDE---------CEFDPCANGN-CINTPGSYYCRCHTGFLRVPGKQTCIDIDECLQNGVLCKNGRCLNTEGSFQCICNSGFKLSPDGRNC-VDHDECA--ATNMCLNGMCI-NEDGSFKCVCKPGFTLNSSGRYC---TDIDECRT-PGVCM-NGRCVNTQGSFRCECFAGLTVGIDGRTCVDTHMRSTCYGAVKRGLCLRPFQRAVTKSQCCCANPDYAFGEPCHPCPAKHSAEFQV--LCASGVGFSADGKDINECALDPDICSNGVCENLRGNFRCVCNIGYESDQSGRNCLDID----ECVVNSLLCDNGLCRNVP-GSYSCTCPAGFIFRHDTETC---------EDVNECVSSPCVNGVCKN-SAGSFYCECSQGSKLDSTGLLCV--DSVKGSCWLTLQDGRC---EVNINGATLRSQCCATLGLAWGSPCEPCQTDLVCERGFAQSRGASCEDVNECEVFPGVCHNGHCVNTRGSFKCQCPESLTLDVTGRLCVDVRSEPCFLTYEEDVCTQPVPGR--FRMDMCCCTVGLAWGKDCDLCPEPGTRQFDTLCPRGPGFANKGDVLTGRAVYKDINECKVFQSICVHGKC-RNTIGSFRCRCDSGFALDTNEKNC----------TDIDECMISPDVCGHGTCVNTLGSFQCDCFPGYESGIMMMKNCMDIDECER-----NLSLCNGGTCENTDGSYKCVCPPGHHLSVDGSACEDVNE-------CDLSSTLCPNGWCVNL-VGTYQCSCNSGYQTTPDWKGC 1207          

HSP 4 Score: 88.9669 bits (219), Expect = 2.731e-17
Identity = 171/777 (22.01%), Postives = 293/777 (37.71%), Query Frame = 1
Query:  148 CCSGWIKNVYGDCVK-SECDYD-CGYGRCV---GLNVCECYDKTIRTETCPQNNQKLCTNNCSNKG-QCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTC-------ICIKPYSVSFN-GKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKI-ETITSQC-------ALNQFQCQGGRCQELDNNNYEC-QCLRG--FIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYK--------------QTEPPAVRLCSKWEYYSLCQGGEC-----VDTXXXXXXXXXXXXXATENGRKCSR-IEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVC-PYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEK 2313
            C +G+ ++  G+C    EC++D C  G C+   G   C C+   +R    P     +  + C   G  C+NG+C+   G F   CN+               K +P+       + C+   +     C+  D ++   C  GFT   +   C DIDEC+   +C+NG C+N +GSFRC+C                       G + GI G+    +  + TC       +C++P+  +    + C    +Y     F + C P      +   +   C SG   S D K        DI +     + C  G C +    +RC+CN  Y+   + + C+     E +V+          LC+ G C ++   Y C C  GF    +   C  + E ++S C       +   F C+  +  +LD+    C   ++G  ++  ++GR  +        +  C   G    +    P  P +    C  G++QS       +    +D  + +     C  G CV+   S++C C         G+ CV  +              Q  P   R+        L  G +C       T            +A +      R + K + E         + + S C+ G+C  +    F+C C  GF   ++ ++C    +D+C+ + ++C  G C  +  S F+C C P Y S    G   + N +  +   +      N   C  G C N     +C+C PG+  S DG  C  + +
Sbjct:  488 CNTGFKEDNRGECSDVDECEFDPCANGNCINTPGSYYCRCHTGFLRV---PGKQTCIDIDECLQNGVLCKNGRCLNTEGSFQCICNSGF-------------KLSPDGRNCVDHDECAATNMCLNGMCINEDGSFKCVCKPGFTLNSSGRYCTDIDECRTPGVCMNGRCVNTQGSFRCEC---------------------FAGLTVGIDGRTCVDTHMRSTCYGAVKRGLCLRPFQRAVTKSQCCCANPDY----AFGEPCHPCPA--KHSAEFQVLCASGVGFSADGK--------DINECALDPDICSNGVCENLRGNFRCVCNIGYESDQSGRNCLDI--DECVVNSL--------LCDNGLCRNVPGSYSCTCPAGFIFRHDTETCEDVNECVSSPCVNGVCKNSAGSFYCECSQGSKLDSTGLLCVDSVKGSCWLTLQDGRCEVNINGATLRSQCCATLGLAWGS----PCEPCQTDLVCERGFAQS-------RGASCEDVNECEVFPGVCHNGHCVNTRGSFKCQCPESLTLDVTGRLCVDVRSEPCFLTYEEDVCTQPVPGRFRMDMCCCTVGLAWGKDCDLCPEPGTRQFDTLCPRGPGFANKGDVLTGRAVYKDINE--------CKVFQSICVHGKCR-NTIGSFRCRCDSGFALDTNEKNC--TDIDECMISPDVCGHGTCVNTLGS-FQCDCFPGYES----GIMMMKNCMDIDECER------NLSLCNGGTCENTDGSYKCVCPPGHHLSVDGSACEDVNE 1170          

HSP 5 Score: 82.4185 bits (202), Expect = 2.417e-15
Identity = 86/287 (29.97%), Postives = 120/287 (41.81%), Query Frame = 1
Query:  325 KGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR-------NYCPKG--FTQKENRCD------DIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPY-SVSFNGKSCIK----KTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQ 1083
             G C NG C+   G F             G  C       C++  +  +C + P   +   + CC    +AWG  C  C           CP+G  F  K +         DI+EC+ F+SIC++G+C N  GSFRC+C     LD N  +C    D+C +    CG  G CV T  G + C C   Y S     K+C+     + N ++CN         G C+    SY C CP G H S D  +C      D+ +    +  C  G CV+    Y+C CN  YQ
Sbjct:  930 PGVCHNGHCVNTRGSFKCQCPESLTLDVTGRLCVDVRSEPCFLTYEEDVC-TQPVPGRFRMDMCCCTVGLAWGKDCDLCPEPGTRQFDTLCPRGPGFANKGDVLTGRAVYKDINECKVFQSICVHGKCRNTIGSFRCRCDSGFALDTNEKNCT-DIDECMISPDVCG-HGTCVNTL-GSFQCDCFPGYESGIMMMKNCMDIDECERNLSLCN--------GGTCENTDGSYKCVCPPGHHLSVDGSAC-----EDVNECDLSSTLCPNGWCVNLVGTYQCSCNSGYQ 1199          

HSP 6 Score: 75.8702 bits (185), Expect = 2.265e-13
Identity = 108/444 (24.32%), Postives = 171/444 (38.51%), Query Frame = 1
Query: 1927 CMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSES-----ALIKKSIC--DLHREKCKTGIC-----YPIGQNDYICA----------CVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC--PYCFYG-CFDENSISTCSCSENYENLFDTGLCIIKSDEIS--YSLGDSTCRTKSLNRTLNIKFSGIFKFSTGSPSEVKQS 3165
            C  G CI +    + C C  GF      ++C    +D+CL N  +C  GRC  +  S F+C+C     LS DG +C+ +           D       C +G C+N+    +C+C PG+  +  G+ C  I++  +       +C           ++ C+C  G     +GR+C+ +         +K+ +C     R   K+  C     Y  G+  + C           C  G   + D K     D  +CA++   C  G C ++   + C+C   Y   ++GR+C+         DI E           C    ++  C  G C      Y C CP  F    +D E   D N+C    C  G C +      C CS+  + L  TGL  + S + S   +L D  C       TL  +       + GSP E  Q+
Sbjct:  511 CANGNCI-NTPGSYYCRCHTGFLRVPGKQTCID--IDECLQNGVLCKNGRCLNTEGS-FQCICNSGFKLSPDGRNCVDH-----------DECAATNMCLNGMCINEDGSFKCVCKPGFTLNSSGRYCTDIDECRTPGVCMNGRCVNT------QGSFRCECFAGLTVGIDGRTCVDTHMRSTCYGAVKRGLCLRPFQRAVTKSQCCCANPDYAFGEPCHPCPAKHSAEFQVLCASGVGFSADGK-----DINECALDPDICSNGVCENLRGNFRCVCNIGYESDQSGRNCL---------DIDE-----------CVVNSLL--CDNGLCRNVPGSYSCTCPAGF-IFRHDTETCEDVNECVSSPCVNGVCKNSAGSFYCECSQGSK-LDSTGLLCVDSVKGSCWLTLQDGRCEVNINGATLRSQCCATLGLAWGSPCEPCQT 904          

HSP 7 Score: 64.6994 bits (156), Expect = 6.953e-10
Identity = 118/504 (23.41%), Postives = 183/504 (36.31%), Query Frame = 1
Query:  340 NGKCICESGYFGEDC--NTAIISTCYVK---IDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC------------QYRRDQCQLYGSS-----CGIFGKC--VPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI--------VNSNSDICQSPEIAERCRGGSC---VSEGKGYRCLCNGEYQGYNNDQECVR----YGTSEPLVSRYCSKS-----EYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENG----RSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECV 1701
            N +C+C  GY  +    N   I  C V     D GLC++ P +   +                       CP GF  + +   C+D++EC   S C+NG C N  GSF C+C     LD   + C            Q  R +  + G++     C   G     P    Q   +C + ++ S  G SC    + N C  F  +C   G C     S+ C CP         + C+        +    D+C  P +  R R   C   V    G  C    E      D  C R        + L  R   K       + S+C  G C +    + C+C  GF    N + C  I+    +C ++   C  G C      +++C C  G+   E+G    ++C+  +    + S+C   G  C+           Y C C  G+  S D   C      +D  +    S  C  G CV+   +Y+C C+  Y ++ + + C 
Sbjct:  757 NFRCVCNIGYESDQSGRNCLDIDECVVNSLLCDNGLCRNVPGSYSCT-----------------------CPAGFIFRHDTETCEDVNEC-VSSPCVNGVCKNSAGSFYCECSQGSKLDSTGLLCVDSVKGSCWLTLQDGRCEVNINGATLRSQCCATLGLAWGSPCEPCQTDLVCERGFAQS-RGASC---EDVNECEVFPGVCH-NGHCVNTRGSFKCQCPESLTLDVTGRLCVDVRSEPCFLTYEEDVCTQP-VPGRFRMDMCCCTVGLAWGKDCDLCPEPGTRQFDTLCPRGPGFANKGDVLTGRAVYKDINECKVFQSICVHGKCRNTIGSFRCRCDSGFALDTNEKNCTDID----ECMISPDVCGHGTCVNT-LGSFQCDCFPGY---ESGIMMMKNCMDIDECERNLSLCN--GGTCEN------TDGSYKCVCPPGHHLSVDGSAC------EDVNECDLSSTLCPNGWCVNLVGTYQCSCNSGYQTTPDWKGCT 1208          
BLAST of Fibrillin-2 vs. Ensembl Zebrafish
Match: FP102018.1 (latent transforming growth factor beta binding protein 3 [Source:NCBI gene;Acc:562912])

HSP 1 Score: 88.5817 bits (218), Expect = 3.742e-17
Identity = 118/470 (25.11%), Postives = 183/470 (38.94%), Query Frame = 1
Query:  535 CPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRD-------------------QCQLY--------GSSCGIF-----------GKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSC-----------IVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLC---------NGEY-------QGYNNDQECVRYGTSEPLVSRYCSKSEYYS--LCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQ---------YKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQT 1716
            C  G+  +   C DIDEC+   +CLNG C N  GS+RC C      + N   C+   +                   +CQ Y        GS C              G+C+ T  G Y C C K Y++  NG+ C    + N C+  + LC P+G C+     Y C C  GF  SEDK SC           +   ++  C S       +   C S G G+   C         + EY       +G+ +DQE + YG    +  R   +   +S  +C+ G C++    + C C +GFY   N   CI ++    +C  ++  C  G C     + Y C C   ++     + C+    T      C+   + C+ G C     + Y C C   ++ + DR  C+  E+         +       E    CR G+CV+   S+ C+C      S   ++CV   +T
Sbjct:  632 CQPGYRAERGVCHDIDECKKHGVCLNGRCENLAGSYRCLCNEGFLPEANRKGCRDINECQDNRLCANGHCINTDGSFRCQCYAGYQPTQEGSHCEDINECKRAANCQRGRCINTM-GSYRCECQKGYTLE-NGRHC---KDINECDGERSLCQPHGVCENRQGGYVCVCNDGFRLSEDKHSCEKIESDKKECYLNLDDTVFCDSVLATNVTKQECCCSIGVGWGDHCEIYPCPVYRSAEYHSLCPIGRGFYHDQEKIEYGF---VAHRDIDECVLFSNEICKEGRCMNTQPGFECYCQQGFYYDSNLLECIDVD----ECH-DESLCINGHCVNTRGSFY-CVCDPPWVPDAYNKKCVFP--TIIGIDECQDPAN-CKNGQCVNTQ-DSYYCLCSPPWTLASDRNSCVTPEEQAVMGVSVVHLTDVNECEDPSYCRNGRCVNTPGSFHCICTQPLTFSAALKQCVYDDRT 1083          

HSP 2 Score: 84.7297 bits (208), Expect = 4.898e-16
Identity = 210/945 (22.22%), Postives = 343/945 (36.30%), Query Frame = 1
Query:  433 CKSTPENLQLSKEECCSIFQVAWG-NPCVFCD---------------RNYCPKGFTQ-KENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENT-------------------------MSCQYRRDQC-----QLYGSSC--------GIFGKCVPTSDGQ-----YTCICIKPYSVSF---NGKSCIKKTNYNVCNYFKKLCLP---YGECQPYGLSYYCSCPSGFHQSE-DKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSE-YYSLCEGGSCVDLNNDYYCQCSEGFYATE---NRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICE-LYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTP-GRCERSGNSNFRCVCPYYASLSKDGHS----------CLINYVTTEPTTKYCD-ILVNRLR-----CASGNCVNDRCICGP--GYKSSEDGKEC-------YKIEKVSSIXXXXXXXXXXXXXX---------XXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREK-CKTGICYPIGQNDYICACVLGYKQATDKKSCI---IMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCIL----KIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRD 2922
            C S P     ++E+CC     +WG N C  C                 + CP+G+ +     C DI+EC    +C NGEC+N +GSFRC C P + L E T                         +S +  ++ C     + +GS+C          F K  P   G      +  +  +P+  S    N  + +K     +         P   +G  +P  ++   + P      E D         S + +    +  C  G C +   G+ C C   Y GY           S  L  R   ++E     C  G C+++   Y C C  G+  +E    +R C  I    ++C   +    GG+C      +Y+C+CL GF +        K ++  +   I E L    C    C     +     C  GY    +R  C       D C+   +   C  G+C +   SYRC+C+  ++   N + C           R  ++ +   LC  G C++T+ ++ C+C  GY  T+ G  C  I +              +  + C  GRCI +    ++C C  G+T   +GR C  + +++C    ++C P G CE      + CVC     LS+D HS          C +N       T +CD +L   +      C+ G    D C   P   Y+S+E    C       +  EK+      ++   +                    +EC C  G+    N   CI  +         + H E  C  G C    +  + C C   +      K C+   I+   +C  +   CK G C +  D Y C+C   +T+  +   C+      ++ V  V +++V+             E    C+ G+CV     + C C      +    +CV D
Sbjct:  226 CSSNPLPGLTNQEDCCGSVGNSWGQNKCYKCPLLPYTEKHQAIVEDFASTCPQGYKRLNSTHCQDINECMMSGVCWNGECLNTRGSFRCTCKPGYVLKERTRCVAATVELGYCFRMVTETGKCEHALSTRLSQEMCCCTVGKAWGSNCERCPQDGTASFNKICPAGKGMSLQTYHGTLTFQPFLTSIEHINPDTEVKPPEVPIQTTTPMHLSPISTHGPRRPVIVAKPTTPPIVLVPPEADSHEVSQTQVSPMDECKLNSNICGHGVCANTQNGFMCHC---YPGYR----------SHALTKRCEDENECDAQPCGRGVCLNVLGSYKCNCHHGYRLSEISSGKRSCSDI----NECLNTEICGVGGQCIN-QQGSYKCECLPGFRK--------KIQKPPHCEDINECLEPDICPNEQCENTLGSYECLPCQPGYRA--ERGVC----HDIDECKKHGV---CLNGRCENLAGSYRCLCNEGFLPEANRKGC-----------RDINECQDNRLCANGHCINTDGSFRCQCYAGYQPTQEGSHCEDINEC-------------KRAANCQRGRCI-NTMGSYRCECQKGYT-LENGRHC--KDINECDGERSLCQPHGVCENR-QGGYVCVCNDGFRLSEDKHSCEKIESDKKECYLNL----DDTVFCDSVLATNVTKQECCCSIGVGWGDHCEIYPCPVYRSAEYHSLCPIGRGFYHDQEKIEYGFVAHRDIDECVLFSNEICKEGRCMNTQPGFECYCQQGFYYDSNLLECIDVD---------ECHDESLCINGHCVNT-RGSFYCVCDPPWVPDAYNKKCVFPTIIGIDECQ-DPANCKNGQCVNTQDSYYCLCSPPWTLASDRNSCVTPEEQAVMGVSVVHLTDVN-----------ECEDPSYCRNGRCVNTPGSFHCICTQPLTFSAALKQCVYD 1080          

HSP 3 Score: 77.0258 bits (188), Expect = 1.107e-13
Identity = 197/836 (23.56%), Postives = 304/836 (36.36%), Query Frame = 1
Query:  565 RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQ-LYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYC-SCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYC-QNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGY-IKSENGRSCIKSE----SALIKKSICDLHREKCKTGICYPIGQNDYICA--------------CVLGYKQATDKKSC----IIMDNPKC----------------AVNEYRCKGGYCYDIVDGYLCI---CVGNY--TVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVR 2919
            RC+D +EC  +  C  G C+N  GS++C C   + L E +   +   D  + L    CG+ G+C+    G Y C C+  +          +  N       +    P  +C+    SY C  C  G+          V  + D C+   +   C  G C +    YRCLCN  +    N + C           R  ++ +   LC  G C++ +  + CQC  G+  T+    C  I    ++C      CQ GRC      +Y C+C +G+   ENGR C          S+C+ +G      VC       Y+C C +G+  SED+  C K E  K  C  N + +  C      +N     C C    I    G  C  Y     P  R     EY+SLC  G     +                     +IE       D   C+L      C  GRC+  +  GF+C C  GF   S+   C    VD+C ++E++C  G C  +  S F CVC            C+       PT    D   +   C +G CVN +    C+C P +  + D   C   E+ + +            C   +D +Y   C NG  + +     CI ++    SA +K+ + D  R      IC+     D++C               C  G     + ++C     ++ N  C                A + Y  +G    +  D   C    CV +Y  T+ E     +L     +  DI E +           R      C+  +C+     ++C+C   F      H C+R
Sbjct:  516 RCEDENECDAQP-CGRGVCLNVLGSYKCNCHHGYRLSEISSGKRSCSDINECLNTEICGVGGQCI-NQQGSYKCECLPGFRKKIQKPPHCEDIN----ECLEPDICPNEQCENTLGSYECLPCQPGYRAERG-----VCHDIDECKKHGV---CLNGRCENLAGSYRCLCNEGFLPEANRKGC-----------RDINECQDNRLCANGHCINTDGSFRCQCYAGYQPTQEGSHCEDI----NECK-RAANCQRGRCINT-MGSYRCECQKGYTL-ENGRHCKDINECDGERSLCQPHG------VCE-NRQGGYVCVCNDGFRLSEDKHSCEKIESDKKECYLNLDDTVFC-DSVLATNVTKQECCCS---IGVGWGDHCEIYPC---PVYR---SAEYHSLCPIGRGFYHDQ-------------------EKIEYGFVAHRDIDECVLFSN-EICKEGRCMNTQP-GFECYCQQGFYYDSNLLECID--VDEC-HDESLCINGHCVNTRGS-FYCVCDPPWVPDAYNKKCVF------PTIIGIDECQDPANCKNGQCVNTQDSYYCLCSPPWTLASDRNSCVTPEEQAVMGVSVVHLTDVNEC---EDPSY---CRNGRCVNTPGSFHCICTQPLTFSAALKQCVYD-DRTAAHKDICFQEVDEDHMCTMPRNELTVTYSECCCHYGRGWGPECRTCPMRNTVLFNRLCEMHLETESDGEGDFLAAFSTYNPEGDSSEEDSDECSCANGRCVRSYLGTMCECNTGFVLDHSRTRCTDIDECA----------GRGTGQSPCKNARCINTFGSFRCQCKLGFVAARRPHVCLR 1254          

HSP 4 Score: 70.0922 bits (170), Expect = 1.321e-11
Identity = 164/724 (22.65%), Postives = 265/724 (36.60%), Query Frame = 1
Query:  535 CPKGF---TQKENRCDDIDECQFKSICLNGECINEKGSFRC-QCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSK----SEYYSLCEG-GSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQF----------------------------QCQGGRCQELDNNNYECQCL--RGFIRS-ENGRSCIKAERTRNSTSICELYGHR-CQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQ------VTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSC-----DPEYVDQC---LNNENICTPGR------------------------CERSGNSNFRCVCPYYASLSKDGHS-CLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSES 2454
            C  GF    QK   C+DI+EC    IC N +C N  GS+ C  C P +  +       +  D+C+ +G    + G+C   + G Y C+C + +    N K C    + N C    +LC   G C     S+ C C +G+  +++   C      DI +    A  C+ G C++    YRC C   Y   N                R+C          SLC+  G C +    Y C C++GF  +E++  C KIE+   +C LN                               C+   C    +  Y   C   RGF    E       A R  +    C L+ +  C+ G C    P  + C C +G+    +   CI      D C ++ +   C  G CV+   S+ CVC   ++     ++CV       P +    + +  + C+ G+CV+T ++YYC C   +    +   C   E+Q      V    D + C   E  S C  GRC+ +    F C+C    T ++  + C        + D C   ++ +++CT  R                        C       F  +C  +     DG    L  + T  P     +   +   CA+G CV       C C  G+        C  I++ +   +                 ++ CQC  G++ +     C++S +
Sbjct:  589 CLPGFRKKIQKPPHCEDINECLEPDICPNEQCENTLGSYECLPCQPGYRAERGVC---HDIDECKKHGVC--LNGRCENLA-GSYRCLCNEGFLPEANRKGC---RDINECQD-NRLCA-NGHCINTDGSFRCQCYAGYQPTQEGSHC-----EDINECKRAAN-CQRGRCINTMGSYRCECQKGYTLEN---------------GRHCKDINECDGERSLCQPHGVCENRQGGYVCVCNDGFRLSEDKHSCEKIESDKKECYLNLDDTVFCDSVLATNVTKQECCCSIGVGWGDHCEIYPCPVYRSAEYHSLCPIGRGFYHDQEKIEYGFVAHRDIDE---CVLFSNEICKEGRCMNTQPG-FECYCQQGFYYDSNLLECID----VDECHDESL---CINGHCVNTRGSFYCVCDPPWVPDAYNKKCVF------PTIIGIDECQDPANCKNGQCVNTQDSYYCLCSPPWTLASDRNSCVTPEEQAVMGVSVVHLTDVNEC---EDPSYCRNGRCV-NTPGSFHCICTQPLTFSAALKQCVYDDRTAAHKDICFQEVDEDHMCTMPRNELTVTYSECCCHYGRGWGPECRTCPMRNTVLFNRLCEMHLETESDGEGDFLAAFSTYNPEGDSSEEDSDECSCANGRCVRSYLGTMCECNTGFVLDHSRTRCTDIDECAGRGTGQSPCKNARCINTF--GSFRCQCKLGFVAARRPHVCLRSRA 1257          
BLAST of Fibrillin-2 vs. Ensembl Zebrafish
Match: matn4 (matrilin 4 [Source:ZFIN;Acc:ZDB-GENE-050208-64])

HSP 1 Score: 81.6481 bits (200), Expect = 3.845e-15
Identity = 104/394 (26.40%), Postives = 168/394 (42.64%), Query Frame = 1
Query:  535 CPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIV----NSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC 1698
            C  G+T  E+   C  ID C          CI   GSF C C   + L+++  +C+   D C     SC    KCV   +G + C C + YS++ + K+C   T  + C++    C    EC     S+YC C  G+  +ED+ +C +    +  +D C+            CVS   G+ C CN  Y   ++ + C         +  YCS       CE   CV +   ++C+C++G+   ++++ C    T+   C+     C+      L  N + C+C  G+  +E+ ++C   +        C    H C    C  +  N + C C EGY+  ED K C    Q  + C   E    C   QCVS   SY C+C   ++  ++G+ C
Sbjct:  239 CLPGYTLNEDGKTCTPIDLCAEGKHDCEQICIASPGSFTCDCNTGYTLNDDKKTCKMI-DYCSFGNDSCE--HKCVSVLNG-FNCRCDEGYSLNEDLKTC---TMIDYCSFGNDSC--EHECVSVLQSFYCQCRDGYTLNEDETTCTMIDYCSFGNDSCEH----------ECVSVLNGFHCRCNEGYSLNDDLKTCT--------MIDYCSFGN--DSCEH-ECVSVLKGFHCRCNDGYTLNDDKKTC----TMIDYCSFGNDSCEHECVSVL--NGFHCRCKDGYTLNEDKKTCTMID-------YCSFGNHSCDHH-CVSVL-NGFFCRCNEGYTLQEDGKTC----QSDNLCNTVE--HGCEY-QCVSTPGSYHCICPEGHVLQDDGKSC 580          

HSP 2 Score: 61.2326 bits (147), Expect = 7.139e-9
Identity = 96/382 (25.13%), Postives = 157/382 (41.10%), Query Frame = 1
Query:  313 NCSNKGQCQNGK------CICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIV----NSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKI---ETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSC 1404
             C+    C  GK      CI   G F  DCNT       +  D+  CK           + CS    +  + CV     +   C +G++  E+   C  ID C F +     EC++   SF CQC   + L+E+  +C    D C     SC    +CV   +G + C C + YS++ + K+C   T  + C++    C    EC      ++C C  G+  ++DKK+C +    +  +D C+            CVS   G+ C C   Y    + + C         +  YCS   +   C+   CV + N ++C+C+EG+   E+ + C       T+   C   ++QC           +Y C C  G +  ++G+SC
Sbjct:  251 TCTPIDLCAEGKHDCEQICIASPGSFTCDCNTGYT----LNDDKKTCKMI---------DYCSFGNDSCEHKCVSVLNGFNCRCDEGYSLNEDLKTCTMIDYCSFGNDSCEHECVSVLQSFYCQCRDGYTLNEDETTCTM-IDYCSFGNDSCE--HECVSVLNG-FHCRCNEGYSLNDDLKTC---TMIDYCSFGNDSC--EHECVSVLKGFHCRCNDGYTLNDDKKTCTMIDYCSFGNDSCEH----------ECVSVLNGFHCRCKDGYTLNEDKKTCT--------MIDYCSFGNHS--CD-HHCVSVLNGFFCRCNEGYTLQEDGKTCQSDNLCNTVEHGC---EYQCVSTP------GSYHCICPEGHVLQDDGKSC 580          

HSP 3 Score: 51.6026 bits (122), Expect = 5.485e-6
Identity = 107/425 (25.18%), Postives = 165/425 (38.82%), Query Frame = 1
Query:  910 SYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGG---ECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLS---RCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPE----YVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSC 2154
            SY C C  G+  +ED K+C   +  D+C   E    C    C++    + C CN  Y   N+D++  +       +  YCS       CE   CV + N + C+C EG+   E+ + C    T+   C+     C+   C  +  + Y CQC  G+  +E+  +C   +        CE   H C + +      N + C C EGYS ++D K C       DYC     S  C   +CVS    + C C+  Y  +++               + C+  +Y S        ECV               +  NG  C R +   T   D   C + +Y S         C+     GF C C  G+T   DG++C  +     V+     + + TPG        ++ C+CP    L  DG SC
Sbjct:  234 SYQCLCLPGYTLNEDGKTC---TPIDLC--AEGKHDCEQ-ICIASPGSFTCDCNTGYT-LNDDKKTCK-------MIDYCSFGN--DSCEH-KCVSVLNGFNCRCDEGYSLNEDLKTC----TMIDYCSFGNDSCEH-ECVSVLQSFY-CQCRDGYTLNEDETTCTMIDYCSFGNDSCE---HECVSVL------NGFHCRCNEGYSLNDDLKTCT----MIDYCSFGNDS--CEH-ECVSVLKGFHCRCNDGYTLNDDK--------------KTCTMIDYCSFGNDSCEHECV---------------SVLNGFHC-RCKDGYTLNEDKKTCTMIDYCSFGNHSCDHHCVS-VLNGFFCRCNEGYTLQEDGKTCQSDNLCNTVEHGCEYQCVSTPG--------SYHCICPEGHVLQDDGKSC 580          
BLAST of Fibrillin-2 vs. Ensembl Xenopus
Match: FBN3 (fibrillin 3 [Source:NCBI gene;Acc:100151721])

HSP 1 Score: 168.703 bits (426), Expect = 1.504e-41
Identity = 234/954 (24.53%), Postives = 347/954 (36.37%), Query Frame = 1
Query:  148 CCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLP--YGECQPYGLSYYCSCPSG----------------------------FHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQ--ECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTE------EPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICD-----------LHREKCKT-GICY--PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CC GW     G+ C+   C   CG G C   N+C C +  + T  C       C   C N G C    C C+ GY G  C   I                                    C+ +I   +C+     +  +K  CC+    AWG+PC  C    N C +GF    +   C D+DECQ    +C  G CIN  GS+ C+CP  H   E +  C+   D+C    + C   G+C  T+ G Y C+C + ++ S +G  CI +    V + F  L      GE        +C C SG                            FH + +     +    DIC+       C+ G C+     YRC CN    GY  D   EC+            CS S     C  G CV+    Y+C+C EG+ +   ++ CI I+    +C +N   C+ GRC   +  +++C C  GF  + +G++C+  +    +        + C  G+C       + C C  G+  + + +YC+      D CQ   I   C  G+C++   S+RC C G      +G              R+C      S C G                   A + G         VT+       PD+       +   C    C    +  F+ LC  G    +DGR      +++C  N  IC  G CE    S +RC+C         G +C+             +  VNRL C +G C N      C C  GY    D + C  I + +S            G    +  ++ C+C  G      G  C+ S       +I D           L  E C T G  +  P  + +   AC  GY +   KK     D  +C V    C  G C +    + C C    T+  +GR+C+
Sbjct:   45 CCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSNGQLST-NCGAGIVMNCNVRCMNGGSCNEDSCTCQKGYTGTHCGQPICENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQISNQMCQGQLSGIVCTKTLCCATIGRAWGHPCEMCPAQPNPCRRGFIPNIRTGACQDVDECQAIPGLCQGGTCINTVGSYECKCPAGHKQSETSQKCE-DIDECSTIPNVCD-GGECTNTA-GSYVCVCPRGFTTSRDGSRCIDQ---RVGSCFSALIGGRCAGELPGQFTKAHCCCESGRCWAIGQIPEMCPVRGSGKSSFIYLFFTFHLNYNINQLQLLITGDICKL--FTNLCQNGRCIPTPASYRCECN---MGYKQDSRLECIDV--------DECSSSP----CIHGDCVNTPGSYHCRCHEGYQSNPTKQACIDID----ECIMNGVMCRNGRCVNTE-GSFQCICNAGFETTPDGKNCVDHDECATT--------NMCLNGMCIN-EDGSFKCICKPGFVLAPNGRYCVD----VDECQTPGI---CMNGRCINTEGSFRCECLGGLTIGIDG--------------RVCVDTHMRSTCYG-------------------AIKKGTCARPFPGAVTKSECCCASPDHG------FGEPCQ--PCPAKNSAEFQALCSSGIGITADGRD-----INECALNSEICPNGICENLRGS-YRCICNLGYESDASGKNCV----------DVDECAVNRLLCDNGLCRNTPGSYTCTCPKGYVFKIDSETCEDINECAS-------NPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPRGYSR---KKGVACEDVNECEVFPGVCPNGRCVNTAGSFKCECPEGLTLDGSGRNCV 886          

HSP 2 Score: 152.525 bits (384), Expect = 1.441e-36
Identity = 235/990 (23.74%), Postives = 361/990 (36.46%), Query Frame = 1
Query:  253 YDKTIRTETCPQNNQKLCTNNCSNKGQCQN--GKCICESGY------FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-YCPKGFTQKEN-RCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-----------------------QYRRDQCQL-YGSSCGIF-GKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNY---NVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI-----------------VNSNSDI-----------------CQSPEIAER----CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVR-------LCSKWEYYSLCQGG------ECVDTXXXXXXXXXXXXXA----TENGRKCS---------RIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKS--ICDLHRE---KCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            Y   I +ETC   N+  C +N    G C+N  G  +CE  +       G  C  ++  TC++ I  G C+       L K ECC+    AWG+PC  C+ +  CP+G+++K+   C+D++EC+ F  +C NG C+N  GSF+C+CP    LD +  +C                       +YR D C    G++ GI   +C      ++  +C +    +  G     +  Y   N C  F  LC  +G C+    S+ C C SGF    ++++C                  VN+                     C   +  ER    CRGG+C++    + C+C   ++  +    CV            CS S+  +LC  G C+++   Y C C  GF +T +R+ C+ I+  T         C           +YEC C  G+    + RSC   +   ++  IC+  G +C         P EY C C +G+  S D K CI   +      N  I   C  G+C +   S+ C C   Y        C    + E  A         L     +   CQ G       CVD +            A    T    +C+          I   V E  DN        ++ C  G C+ +   G++C C  GFT   D ++C  + +D+C   +NIC  G C+      FRC+C     L + G +C       +P           + C +G CVN      C C   ++ +  G  C      +                           L    + + G SC       + ++   C L R     C+   C      +Y   C  G     +  + I+ D  +C      C+GG C +    + C C   Y + E  R C          DI E S               I  C PG C     +Y C CP  +
Sbjct:  731 YVFKIDSETCEDINE--CASNPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATL-KSECCATLGAAWGSPCERCEIDPACPRGYSRKKGVACEDVNECEVFPGVCPNGRCVNTAGSFKCECPEGLTLDGSGRNCVDVRVEQCYMKWDEDECTAQLPGKYRMDMCCCSVGAAWGIDCEECPKPGSDEFKALCPRGPGFANRGDVLSGRPFYKDVNECKVFNSLCT-HGTCRNSIGSFRCVCDSGFALDAEERNCTDIDECRISPDLCGHGTCVNTPGSFDCECFDGYESGFMMMKNCMDIDECERDPLLCRGGTCINTDGSFECICPPGHELTSEGNACVDI--------NECSLSD--NLCRNGRCINMIGTYQCSCDSGFQSTPDRQGCVDIDECTIMNGGCDTHCTNSE------GSYECSCSEGYALMPDQRSCADIDECEDNPDICD--GGQCTN------IPGEYRCLCFDGFMASLDMKTCIDVNECD---LNPNI---CLHGECENTKGSFICHCQLGYFVKKGTTGCTDIDECEVGAHNCDVHASCLNVPGSFKCQCQTGWVGDGLNCVDLDECTTEDHKCNANANCVNTPGSYRCACNEGFNGDGFICSDVDECADN--------VNLCENGHCL-NAPGGYRCECEMGFTPTEDSKAC--QDIDEC-TFQNICVFGTCQNLPGM-FRCICDDGYELDRSGGNCTDVNECADP-----------VNCINGLCVNTPGNYLCNCPQDFELNPTGVGCVDTRVGNCF-------------------------LETQPRGDGGLSCSAEIGVGVTRASCCCSLGRAWGNPCE--FCPFANSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRIC---------EDIDECSAH-------------IGICGPGTCYNTLGNYTCVCPPEY 1613          

HSP 3 Score: 128.642 bits (322), Expect = 3.224e-29
Identity = 228/966 (23.60%), Postives = 351/966 (36.34%), Query Frame = 1
Query:  307 TNNCSNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKI----DRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSC--------IVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQ-GGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSL----CQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLI---NYVTTEPTTKYCDIL----VNRLRC----ASGNCVNDRC-------------ICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKS---------------ICDLHREKCKTGICYPIGQ---------------NDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
             N C++   C NG C+   G +             G  C    +  C+++     D GL  S    + +++  CC     AWGNPC FC        +  CP G   + N      +DIDECQ    +C  G C+N  GSF+C+CP  +YL+E T  C+   D+C  +   CG  G C  T  G YTC+C   Y     G +C+        +  K +C           +Y  +C +    +  KK C          N   + C SP   E             Y  LC  +  G+  D   +R  T +P+    CS  E  ++C  G C++    + C+C  GF        C  I+    +C+  +  CQ    C  +  + Y C+C  G+  S +G    + E        C+   + C  G C       YIC C  G+  S D+  C+      D C  Q     C  G C +   SY C+C   +  ++N  +C+                E YSL    C+ G+C++   ++ C C  GY  T +G+       + T  P             C  G C  +    F+C+C PGF   +D    +   +++C    NIC  G C  +  S F+CVCP    LS +G  C     ++  T      C +       + RC      G    D C             +C  G+ S  D  EC +   +              G     D ++ C+C  GY     G +C+ ++   I                   CD   E      C  I +                 Y C C  GY    D++ C  +D     +++   +G  C +++  ++CIC        +G  C+                     ++ C  K  I  C  G+CV     Y+C C   F+ +    ECV
Sbjct: 1423 VNECADPVNCINGLCVNTPGNYLCNCPQDFELNPTGVGCVDTRVGNCFLETQPRGDGGLSCSAEIGVGVTRASCCCSLGRAWGNPCEFCPFANSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICE-DIDECSAHIGICGP-GTCYNTL-GNYTCVCPPEYMQVNGGNNCM--------DMRKSVCY---------RNYNDTCENELSSNMTKKMCCCSYNIGKAWNKPCEPCPSPATPE-------------YIFLCGNQAPGFIID---IR--TGKPMDIDECS--EIPAICSNGVCINQIGSFRCECPMGFSYNNILLICEDID----ECSSGENLCQRNADCINIPGS-YRCECSSGYKLSPSGACVGRNE--------CQEIPNVCSHGTCMDTE-GSYICVCHNGFKASGDQTMCMD----IDECDRQP----CGNGTCKNTVGSYNCLCFPGFELTHN-NDCMDID-------------ECYSLVGQVCRNGQCINNVGSFQCLCQEGYEITPDGKN---YINECTSLP-----------GTCSPGTCQ-NLEGSFRCICPPGFEVQND----NCIDINECDEEPNICLFGTCTNTPGS-FQCVCPPGFVLSDNGRRCFDTRQSFCFTRFDNGKCSVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGSVAFQELCPYGHGSIPDVNECSESPGIC-----------VNGVCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCGNGTCSNVVGGFECTCDEGFEPGPMMTCEDINECTNPLLCAFRCINTYGSYECTCPSGYTLREDRRMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMQRRPDGEGCM--------------------DENECRTKPGI--CVNGRCVNTVGSYKCDCNEGFQVSSSGTECV 2259          

HSP 4 Score: 118.242 bits (295), Expect = 5.498e-26
Identity = 164/632 (25.95%), Postives = 243/632 (38.45%), Query Frame = 1
Query:  985 DICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIET-------ITSQCA---LNQFQ-----CQGGRCQELDNNNYECQCLRGFIRSE--------NGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCA---SGNCVNDRCICG-PGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFC 2799
            D CQ+  I   C+GG+C++    Y C C   ++     Q+C                S   ++C+GG C +    Y C C  GF  + +  RCI           I  +CA     QF      C+ GRC  +      C  +RG  +S         +    I   +   +  IC+L+ + CQ G C P  P  Y C C  GY Q + R  CI  ++          S  C  G CV+   SY C CH  Y S+   Q C+   +     V          +C+ G CV+T  ++ C C  G+  T +G+ C   ++  T              + C+ G CI ++   FKC+C PGF  A +GR C    VD+C     IC  GRC  +  S FRC C    ++  DG  C+  ++ +      C   + +  CA    G      C C  P +   E  + C                             ++  C +G   + +GR            + C L+ E C  GIC  + +  Y C C LGY+     K+C+ +D  +CAVN   C  G C +    Y C C   Y         + KI +    DI+E +  NP     C
Sbjct:  226 DECQA--IPGLCQGGTCINTVGSYECKCPAGHKQSETSQKCEDIDEC----------STIPNVCDGGECTNTAGSYVCVCPRGFTTSRDGSRCIDQRVGSCFSALIGGRCAGELPGQFTKAHCCCESGRCWAIGQIPEMCP-VRGSGKSSFIYLFFTFHLNYNINQLQLLITGDICKLFTNLCQNGRCIPT-PASYRCECNMGYKQ-DSRLECIDVDECS--------SSPCIHGDCVNTPGSYHCRCHEGYQSNPTKQACIDIDECIMNGV----------MCRNGRCVNTEGSFQCICNAGFETTPDGKNCVDHDECAT-------------TNMCLNGMCI-NEDGSFKCICKPGFVLAPNGRYC--VDVDEC-QTPGICMNGRCINTEGS-FRCECLGGLTIGIDGRVCVDTHMRST-----CYGAIKKGTCARPFPGAVTKSECCCASPDHGFGEPCQPCPAKNSAE----------------------FQALCSSGIGITADGR----------DINECALNSEICPNGICENL-RGSYRCICNLGYESDASGKNCVDVD--ECAVNRLLCDNGLCRNTPGSYTCTCPKGY---------VFKIDSETCEDINECA-SNPCVNGVC 756          

HSP 5 Score: 117.857 bits (294), Expect = 6.568e-26
Identity = 185/780 (23.72%), Postives = 298/780 (38.21%), Query Frame = 1
Query:  535 CPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVC--NYFKKLCL-PY------GEC----QPYGLSYYCSCPSGFHQSEDKKSC-----IVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALN--------QFQCQGGRCQELDNNNYEC-QCLRG--FIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECV---------RYKQTEPPAVRLCSKWEYYSLC---QGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEP---DNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            C  GF  T     C D DEC   ++CLNG CINE GSF+C C P   L  N   C    D+CQ  G    + G+C+ T +G + C C+   ++  +G+ C+     + C     K  C  P+       EC      +G    C      + +E +  C     I     DI +    +E C  G C +    YRC+CN  Y+   + + CV     E  V+R         LC+ G C +    Y C C +G+    +   C  I    S   +N         F C+     +LD+    C   ++G  ++  ++GR  +        +  C   G    +    P    E   AC  GYS+        K    +D  + +     C  G+CV+   S++C C        +G+ CV         ++ + E  A +L  K+     C        +D                  G   +     ++  P   D + C +  + S C  G C  +    F+C+C  GF   ++ R+C    +D+C  + ++C  G C  +  S F C C        DG+      +        C+   + L C  G C+N      CIC PG++ + +G  C  I + S   +L +               Y+C C +G+  + + + C+  +   I    CD H             +  Y C+C  GY    D++SC  +D  +C  N   C GG C +I   Y C+C   +  + + + CI
Sbjct:  492 CNAGFETTPDGKNCVDHDECATTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYC-VDVDECQTPGIC--MNGRCINT-EGSFRCECLGGLTIGIDGRVCVDTHMRSTCYGAIKKGTCARPFPGAVTKSECCCASPDHGFGEPCQPCPAKNSAEFQALCSSGIGITADGRDINECALNSEICPNGICENLRGSYRCICNLGYESDASGKNCVD--VDECAVNRL--------LCDNGLCRNTPGSYTCTCPKGYVFKIDSETCEDINECASNPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGS----PCERCEIDPACPRGYSRK-------KGVACEDVNECEVFPGVCPNGRCVNTAGSFKCECPEGLTLDGSGRNCVDVRVEQCYMKWDEDECTA-QLPGKYRMDMCCCSVGAAWGIDCEECPKPGSDEFKALCPRGPGFANRGDVLSGRPFYKDVNECKV--FNSLCTHGTCR-NSIGSFRCVCDSGFALDAEERNCTD--IDECRISPDLCGHGTCVNTPGS-FDCEC-------FDGYESGFMMMKNCMDIDECE--RDPLLCRGGTCINTDGSFECICPPGHELTSEGNACVDINECSLSDNLCRNGRCINMI-----GTYQCSCDSGFQSTPDRQGCVDIDECTIMNGGCDTHCTN---------SEGSYECSCSEGYALMPDQRSCADID--ECEDNPDICDGGQCTNIPGEYRCLCFDGFMASLDMKTCI 1214          

HSP 6 Score: 115.161 bits (287), Expect = 4.806e-25
Identity = 214/879 (24.35%), Postives = 325/879 (36.97%), Query Frame = 1
Query:  526 RNYCPKGFTQKEN-RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECV------------RYGTSEPLVSRYCSKSE---------YYSLCEGGSCVDLNN-DYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGEC-VDTXXXXXXXXXXXXXATENGRKCSRIE------------KQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLN--NENICT---PGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSED---GKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQA-TDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY----CFYGCFDENSISTCSCSENYENLFD 3015
            R  C  G+ Q     C D+DEC   S C++G+C+N  GS+ C+C   +  +    +C    D+C + G  C   G+CV T +G + CIC   +  + +GK+C+        N    +CL  G C     S+ C C  GF  + + + C+   + D CQ+P I   C  G C++    +RC C G      + + CV            + GT         +KSE         +   C+   C   N+ ++   CS G   T + R         ++CALN   C  G C+ L   +Y C C  G+    +G++C+  +        C +    C  G+C    P  Y C C +GY    D + C      +D   N+  S  C  G C +N  S+ C C       + G  CV              K   +   Q G C V+ N                G  C R E            K V  E  N     + +   C  GRC+ +    FKC C  G T    GR+C    V+QC    +E+ CT   PG+          C C   A+   D   C       +P +     L  R               GPG+ +  D   G+  YK      + +                 ++ C C +G+      R+C   +        C +  + C  G C       + C C  GY+      K+C+ +D  +C  +   C+GG C +    + CIC   + +T  G  C         VDI+E S  +               C+ G+C+     YQC C   F++      CV D ++C      C   C +      CSCSE Y  + D
Sbjct:  408 RCECNMGYKQDSRLECIDVDECS-SSPCIHGDCVNTPGSYHCRCHEGYQSNPTKQAC-IDIDECIMNGVMC-RNGRCVNT-EGSFQCICNAGFETTPDGKNCVDHDECATTN----MCL-NGMCINEDGSFKCICKPGFVLAPNGRYCV---DVDECQTPGI---CMNGRCINTEGSFRCECLGGLTIGIDGRVCVDTHMRSTCYGAIKKGTCARPFPGAVTKSECCCASPDHGFGEPCQ--PCPAKNSAEFQALCSSGIGITADGRD-------INECALNSEICPNGICENL-RGSYRCICNLGYESDASGKNCVDVDE-------CAVNRLLCDNGLCRNT-PGSYTCTCPKGYVFKIDSETC------EDI--NECASNPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSM-----------KGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPRGYSRKKGVACEDVNE---CEVFPGVCPNGRCV-NTAGSFKCECPEGLTLDGSGRNCVDVRVEQCYMKWDEDECTAQLPGKYRMD-----MCCCSVGAAWGIDCEEC------PKPGSDEFKALCPR---------------GPGFANRGDVLSGRPFYKDVNECKVFNSLCTHGTCRNSI----GSFRCVCDSGFALDAEERNCTDIDE-------CRISPDLCGHGTCVNT-PGSFDCECFDGYESGFMMMKNCMDID--ECERDPLLCRGGTCINTDGSFECICPPGHELTSEGNAC---------VDINECSLSD-------------NLCRNGRCINMIGTYQCSCDSGFQSTPDRQGCV-DIDECTIMNGGCDTHCTNSEGSYECSCSEGYALMPD 1167          

HSP 7 Score: 109.383 bits (272), Expect = 2.483e-23
Identity = 208/867 (23.99%), Postives = 325/867 (37.49%), Query Frame = 1
Query:  460 LSKEECCSIFQV--AWGNPCVFCDRNYCPK----------GFTQ--KENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGF-IRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC--------VRYKQTEP------PAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLS------KDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICDLHREK----------CKTG--------ICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            ++K+ CC  + +  AW  PC  C     P+          GF    +  +  DIDEC +  +IC NG CIN+ GSFRC+CP     +   + C+   D+C    + C     C+    G Y C C   Y +S +G +C+ +   N C     +C  +G C     SY C C +GF  S D+  C+     D        + C  G+C +    Y CLC   ++  +N+ +C+       LV +         +C  G C++    + C C EG+  T + +  I      ++C      C  G CQ L+ + + C C  GF ++++N   CI         +IC L+G    T       P  + C C  G+  S++ + C    Q   +C  +  + +C   +   N    RC C  K      G  C        V +++  P      P V  CS  E   +C  G C++T+ ++ C+C  GY     G  C   ++     P             C  G C  +   GF+C C  GF     G     E +++C N   +    RC  +  S + C CP   +L       KD   C       E     C  L+    C          IC PG +   DG+ C    +  +   +                +Y+C C  G+  S +G  C+ +        + +++C L              C +G        IC   G   +   C  G   ATD +     D  +C V    CK G C + +  + C C   YT    G  C         VD+ E + Q+P+  +F              C   +  YQC CP  +
Sbjct: 1646 MTKKMCCCSYNIGKAWNKPCEPCPSPATPEYIFLCGNQAPGFIIDIRTGKPMDIDECSEIPAICSNGVCINQIGSFRCECPMGFSYNNILLICE-DIDECSSGENLCQRNADCI-NIPGSYRCECSSGYKLSPSG-ACVGR---NECQEIPNVC-SHGTCMDTEGSYICVCHNGFKASGDQTMCMDIDECD-------RQPCGNGTCKNTVGSYNCLCFPGFELTHNN-DCMDIDECYSLVGQ---------VCRNGQCINNVGSFQCLCQEGYEITPDGKNYI------NECTSLPGTCSPGTCQNLEGS-FRCICPPGFEVQNDN---CIDINECDEEPNIC-LFGTCTNT-------PGSFQCVCPPGFVLSDNGRRCFDTRQ--SFCFTRFDNGKCSVPK-AFNTTKARCCCS-KMPGEGWGDPCELCPQEGSVAFQELCPYGHGSIPDVNECS--ESPGICVNGVCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNP-------------CGNGTC-SNVVGGFECTCDEGFEP---GPMMTCEDINECTNP--LLCAFRCINTYGS-YECTCPSGYTLREDRRMCKDLDECAEGLHDCESRGMMCKNLIGTFMC----------ICPPGMQRRPDGEGCMDENECRTKPGICVNGRCVNTV-----GSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQLSSTNRNMVTKSECCCNSGRGWGNQCEICPLPGTGAFKKMCPHGPGFATDGR-----DIDECKVLPNLCKNGQCINTIGSFRCHCKLGYTTDITGTTC---------VDLDECA-QSPKPCNF-------------ICKNTEGSYQCSCPRGY 2401          

HSP 8 Score: 101.293 bits (251), Expect = 6.893e-21
Identity = 217/981 (22.12%), Postives = 348/981 (35.47%), Query Frame = 1
Query:  307 TNNCSNKGQCQNGKCICESGYFGEDC--------------NTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQFKS-ICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSC--IKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSED--------KKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVR-YGTSEPLVSRYCSKSEYY-SLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGG-----------------------RCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISS-NNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRI--------------------------EKQVTEEPDNSYCLLQEYLSRCMGG---RCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGR------DCILKIIAVKSV---------DISEVSYQNPQSQSFCTRKEIIEKCQP-----GKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
             + C   G C NG+CI   G F  +C              +T + STCY  I +G C           E CC+     +G PC  C        +  C  G     +   DI+EC   S IC NG C N +GS+RC C   +  D +  +C    D+C +    C   G C  T  G YTC C K Y    + ++C  I +   N C          G C+    S+ C C  G              K +C +N     C+        +   C + G  +   C    +    D  C R Y   + +     ++ E +  +C  G CV+    + C+C EG     + R C+ +         ++ +C                           C +  ++ ++  C RG   +  G   +         + C+++   C  G C       + C C  G++   + + C   ++ +           C  G CV+   S+ C C   Y S     + C+   + E   +          LC+GG C++T+ ++ C C  G+  T  G  C  I                          +      PD   C+  +  +   GG    C   +   ++C C  G+    D RSC    +D+C +N +IC  G+C       +RC+C      S D  +C+            CD+  N   C  G C N +    C C  GY   +    C  I++      +    C           +++CQC  G++   +G +C+  +    +   C+ +     T          Y CAC  G+    +    I  D  +CA N   C+ G+C +   GY C C   +T TE+ +      +C  + I V             I +  Y+  +S   CT  ++ E   P     G CV    +Y C CP  F+ N     CV
Sbjct:  549 VDECQTPGICMNGRCINTEGSFRCECLGGLTIGIDGRVCVDTHMRSTCYGAIKKGTCARPFPGAVTKSECCCASPDHGFGEPCQPCPAKNSAEFQALCSSGIGITADG-RDINECALNSEICPNGICENLRGSYRCICNLGYESDASGKNC-VDVDECAVNRLLCD-NGLCRNTP-GSYTCTCPKGYVFKIDSETCEDINECASNPC--------VNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPC----ERCEIDPACPRGYSRKKGVACEDVNECEVFPGVCPNGRCVNTAGSFKCECPEGLTLDGSGRNCVDVRVEQCYMKWDEDECTAQLPGKYRMDMCCCSVGAAWGIDCEECPKPGSDEFKALCPRGPGFANRGDV-LSGRPFYKDVNECKVFNSLCTHGTCRNSI-GSFRCVCDSGFALDAEERNCTDIDECRIS------PDLCGHGTCVNTPGSFDCECFDGYESGFMMMKNCMDIDECERDPL----------LCRGGTCINTDGSFECICPPGHELTSEGNACVDINECSLSDNLCRNGRCINMIGTYQCSCDSGFQSTPDRQGCVDIDECTIMNGGCDTHCTNSEG-SYECSCSEGYALMPDQRSC--ADIDECEDNPDICDGGQCTNI-PGEYRCLCFDGFMASLDMKTCI--------DVNECDL--NPNICLHGECENTKGSFICHCQLGYFVKKGTTGCTDIDECE----VGAHNCDVHASCLNVPGSFKCQCQTGWVG--DGLNCVDLDECTTEDHKCNANANCVNT-------PGSYRCACNEGF----NGDGFICSDVDECADNVNLCENGHCLNAPGGYRCECEMGFTPTEDSKACQDIDECTFQNICVFGTCQNLPGMFRCICDDGYELDRSGGNCT--DVNECADPVNCINGLCVNTPGNYLCNCPQDFELNPTGVGCV 1462          

HSP 9 Score: 98.2117 bits (243), Expect = 6.265e-20
Identity = 208/871 (23.88%), Postives = 331/871 (38.00%), Query Frame = 1
Query:  532 YCPKGF-TQKENRCDDIDEC--QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSC-GIFGKCVPTS----DGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNS--------DICQSPEIAERCRGGSCVS----EGKGYRC-LCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ--TEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKC---------SRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDK--------TYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQND---YICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY-----CFYGCFDENSISTCSCSENY 3000
             C  GF     N C DIDEC      +C NG+CIN  GSF+C C   + +  +  +          Y + C  + G C P +    +G + CIC  P        +CI   + N C+    +CL +G C     S+ C CP GF  S++ + C     S          C  P+     +   C S    EG G  C LC  E  G    QE   YG         CS+S    +C  G C++ +  + C+C  G+        C+     T +C++    C  G C  +    +EC C  GF       +C       N      L   RC            Y C C  GY+  EDR+ C    +  D C         RG  C +   ++ C+C        +G+ C+   +  T+P             +C  G CV+T  +Y C C  G+  + +G +C         + + + + +    +  ++ +    C  GR  G++        T  FK +C  G   A+DGR      +D+C    N+C  G+C  +  S FRC C    +    G +C ++      + K C+ +      +       +C C  GY   EDGK C  +++ S+     Q  C           ++ C+C  G+ + ++  SCI +     + S+C         G+C    QN+   + C C  G+   +   +C  +D  +C  N +RC+ G C +++ G+ C C   Y        C         VD +E + Q+               C    C      ++C CP  F  +     C +D ++C       C YGC + +    C C   Y
Sbjct: 1848 LCFPGFELTHNNDCMDIDECYSLVGQVCRNGQCINNVGSFQCLCQEGYEITPDGKN----------YINECTSLPGTCSPGTCQNLEGSFRCIC--PPGFEVQNDNCI---DINECDEEPNICL-FGTCTNTPGSFQCVCPPGFVLSDNGRRCFDTRQSFCFTRFDNGKCSVPKAFNTTKARCCCSKMPGEGWGDPCELCPQE--GSVAFQELCPYGHGSIPDVNECSESP--GICVNGVCINTDGSFRCECPFGYNLDYTGVNCVD----TDECSIGN-PCGNGTCSNV-VGGFECTCDEGFEPGPM-MTCEDINECTNPL----LCAFRCINTY------GSYECTCPSGYTLREDRRMC----KDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMQRRPDGEGCMDENECRTKP------------GICVNGRCVNTVGSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQLSSTNRNMVTKSECCCNSGRGWGNQCEICPLPGTGAFKKMCPHGPGFATDGRD-----IDECKVLPNLCKNGQCINTIGS-FRCHCKLGYTTDITGTTC-VDLDECAQSPKPCNFICKNTEGSY------QCSCPRGYILQEDGKTCKDLDECSTKQHNCQFLCVNTI------GSFNCKCPPGFTQHQS--SCIDNNECSSQPSLCG------SRGVC----QNNPGSFTCECQKGFSLDSSGSNCEDVD--ECDGN-HRCQHG-CQNVLGGFRCGCPQGYVQHYQWNQC---------VDENECTSQS--------------TCGSASCYNTLGSFKCVCPSGFDFDQSFGGC-QDVDECSSGGGNPCSYGCSNTDGGYLCGCPGGY 2606          

HSP 10 Score: 94.3597 bits (233), Expect = 9.531e-19
Identity = 177/740 (23.92%), Postives = 269/740 (36.35%), Query Frame = 1
Query:  346 KCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECC--SIFQVAWGNPCVFCDRN-------YCPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERC--RGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGT--SEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRY---KQTEPPAVRLCSKWEYYSLC----------QGGECVD-----TXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNS---NFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGR 2433
            +C+C  G+     G  C     S C+ + D G C S P+    +K  CC   +    WG+PC  C +         CP G         D++EC +   IC+NG CIN  GSFRC+CP  + LD   ++C    D+C + G+ CG  G C     G + C C +     F     +   + N C     L   +     YG SY C+CPSG+   ED++ C      D+ +  E    C  RG  C +    + C+C    Q   + + C+      ++P             +C  G CV+    Y C C+EGF  + +   C+          + Q  CQ                    + S N     K+E   NS      +G++C+  +C       +   C  G   + D +         D  + + +   C+ GQC++   S+RC C   Y +   G  CV      Q+  P   +C   E    C           G  C D     T  +           + N +      +  +   DN+ C  Q  L    G R +     G F C C  GF+  S G +C  E VD+C  N       RC+    +    FRC CP         + C+     T  +T           C S +C N     +C+C  G+   +    C  +++ SS                  D  Y C C  GY ++  G 
Sbjct: 1968 QCVCPPGFVLSDNGRRCFDTRQSFCFTRFDNGKC-SVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGSVAFQELCPYGHGSIP----DVNECSESPGICVNGVCINTDGSFRCECPFGYNLDYTGVNC-VDTDECSI-GNPCG-NGTCSNVVGG-FECTCDE----GFEPGPMMTCEDINECT--NPLLCAFRCINTYG-SYECTCPSGYTLREDRRMC-----KDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMQRRPDGEGCMDENECRTKP------------GICVNGRCVNTVGSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQ--------------------LSSTNRNMVTKSECCCNSG---RGWGNQCE--ICPLPGTGAFKKMCPHGPGFATDGR---------DIDECKVLPNLCKNGQCINTIGSFRCHCKLGYTTDITGTTCVDLDECAQSPKPCNFICKNTEGSYQCSCPRGYILQEDGKTCKDLDECSTKQHNCQFLCVNTIGSFNCKCPPGFTQHQSSCIDNNECSSQPSLC---GSRGVCQNNPGSFTCECQKGFSLDSSGSNC--EDVDECDGNH------RCQHGCQNVLGGFRCGCPQGYVQHYQWNQCVDENECTSQST-----------CGSASCYNTLGSFKCVCPSGFDFDQSFGGCQDVDECSS-----GGGNPCSYGCSNTDGGYLCGCPGGYFRAGQGH 2613          

HSP 11 Score: 90.5077 bits (223), Expect = 1.673e-17
Identity = 230/1010 (22.77%), Postives = 362/1010 (35.84%), Query Frame = 1
Query:  346 KCICESGYFGEDCNTAIISTCYVKIDR----GLCKSTPENLQLS--------------KEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSC----VSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERT---RNSTSIC--ELYGHRCQTGVC-----------------YPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQ-GGECVDTXXXXXXXXXXXXXATENGRKCSRIE-KQVTEEPDNSYCLLQE--YLSRCMGG-RCIGDKTY----------------------GFKCLCLPGFTSASDGRSCDPEYVDQCLN-NENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICAC-------------------VLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCP---YCFYGCFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGD 3066
            KC C++G+ G+  N   +  C  +  +      C +TP + + +               +EC     +     C+     Y   C  GFT  E+   C DIDEC F++IC+ G C N  G FRC C   + LD +  +C    D  +       I G CV T  G Y C C + + ++  G  C+     N           + E QP G     SC +       + SC  +             R  G  C     +    Y+ LC G         E  R      ++       E   LC+GG+CV+    + C+C  G+Y  E  R C  I+    +C+ +   C  G C      NY C C   +++   G +C+   ++   RN    C  EL  +  +   C                  P  P EYI  C    +Q+      I+  +  D  +  EI   C  G C++   S+RC C   +  +N    C    +        CS  E  +LCQ   +C++   +Y C+C +GY  + +G    R E +++     +  C+  E  Y+  C  G +  GD+T                        + CLC PGF    +    D   +D+C +    +C  G+C  +  S F+C+C     ++ DG +  IN  T+ P T           C+ G C N     RCIC PG++   D   C  I +        +      G       +++C C  G++ S+NGR C  +     ++S C    +  K  +          C C                    + +++        I D  +C+ +   C  G C +    + C C   Y +   G +C         VD  E S  NP              C  G C      ++C C   F+          D N+C     C + C +      C+C   Y    D  +C    DE +  L D
Sbjct: 1282 KCQCQTGWVGDGLNCVDLDECTTEDHKCNANANCVNTPGSYRCACNEGFNGDGFICSDVDECADNVNLCENGHCLNAPGGYRCECEMGFTPTEDSKACQDIDECTFQNICVFGTCQNLPGMFRCICDDGYELDRSGGNCT---DVNECADPVNCINGLCVNTP-GNYLCNCPQDFELNPTGVGCVDTRVGNC----------FLETQPRGDGGL-SCSAEIGVGVTRASCCCS-----------LGRAWGNPCEFCPFANSTEYKTLCPG--------GEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICEDID----ECSAHIGICGPGTCYNT-LGNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNYNDTCENELSSNMTKKMCCCSYNIGKAWNKPCEPCPSPATP-EYIFLC---GNQAPGFIIDIRTGKPMDIDECSEIPAICSNGVCINQIGSFRCECPMGFSYNNILLICEDIDE--------CSSGE--NLCQRNADCINIPGSYRCECSSGYKLSPSGACVGRNECQEIPNVCSHGTCMDTEGSYICVCHNGFKASGDQTMCMDIDECDRQPCGNGTCKNTVGSYNCLCFPGFELTHNNDCMD---IDECYSLVGQVCRNGQCINNVGS-FQCLCQEGYEITPDGKN-YINECTSLPGT-----------CSPGTCQNLEGSFRCICPPGFEVQND--NCIDINECDE-----EPNICLFGTCTNTPGSFQCVCPPGFVLSDNGRRCFDT-----RQSFCFTRFDNGKCSVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGSVAFQELCPYGHGSIPDVNECSESPGICVNGVCINTDGSFRCECPFGYNLDYTGVNC---------VDTDECSIGNP--------------CGNGTCSNVVGGFECTCDEGFEPGPMMT--CEDINECTNPLLCAFRCINTYGSYECTCPSGYTLREDRRMC-KDLDECAEGLHD 2184          

HSP 12 Score: 61.2326 bits (147), Expect = 1.081e-8
Identity = 108/427 (25.29%), Postives = 157/427 (36.77%), Query Frame = 1
Query:  310 NNCSNK-GQCQNGKCICESGYFGEDCN---------TAIIST----CYVKIDRGLCKSTPENLQL-SKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQ-FKSICLNGECINEKGSF-----------------------------------------RCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGR 1398
            N C  K G C NG+C+   G +  DCN         T  + T    C+ ++ + +C+ +  N  + +K ECC      WGN C  C        +  CP G     +   DIDEC+   ++C NG+CIN  GSF                                         +C CP  + L E+  +C+   D+C     +C     CV T  G + C C  P   + +  SCI     N C+    LC   G CQ    S+ C C  GF       +C    + D C       RC+ G C +   G+RC C   Y  +    +CV             ++    S C   SC +    + C C  GF   ++   C  ++  +S        C  G C   D   Y C C  G+ R+  G 
Sbjct: 2220 NECRTKPGICVNGRCVNTVGSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQLSSTNRNMVTKSECCCNSGRGWGNQCEICPLPGTGAFKKMCPHGPGFATDG-RDIDECKVLPNLCKNGQCINTIGSFRCHCKLGYTTDITGTTCVDLDECAQSPKPCNFICKNTEGSYQCSCPRGYILQEDGKTCK-DLDECSTKQHNCQFL--CVNTI-GSFNCKC--PPGFTQHQSSCIDN---NECSSQPSLCGSRGVCQNNPGSFTCECQKGFSLDSSGSNC---EDVDECDG---NHRCQHG-CQNVLGGFRCGCPQGYVQHYQWNQCVDE-----------NECTSQSTCGSASCYNTLGSFKCVCPSGFDFDQSFGGCQDVDECSSG---GGNPCSYG-CSNTD-GGYLCGCPGGYFRAGQGH 2613          
BLAST of Fibrillin-2 vs. Ensembl Xenopus
Match: FBN3 (fibrillin 3 [Source:NCBI gene;Acc:100151721])

HSP 1 Score: 159.458 bits (402), Expect = 1.264e-38
Identity = 232/956 (24.27%), Postives = 348/956 (36.40%), Query Frame = 1
Query:  148 CCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGS--SCGIFGKCVPTSDGQYT-----CICIKPYSVSFNGKSCIKKTNYNVCNYFKKLC---LPYG-----ECQPYGLSYYCSCPSGFHQ-----------------SEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQ--ECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTE------EPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICD-----------LHREKCKT-GICY--PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CC GW     G+ C+   C   CG G C   N+C C +  + T      N   C   C N G C    C C+ GY G  C   I                                    C+ +I   +C+     +  +K  CC+    AWG+PC  C    N C +GF    +   C D+DECQ    +C  G CIN  GS+ C+CP  H   E +  C+ +R      GS  S  I G+C     GQ+T     C   + +++    + C  + +    + F++LC   LP G     E  P  +    +  +G                    S    +  +N   DIC+       C+ G C+     YRC CN    GY  D   EC+            CS S     C  G CV+    Y+C+C EG+ +   ++ CI I+    +C +N   C+ GRC   +  +++C C  GF  + +G++C+  +    +        + C  G+C       + C C  G+  + + +YC+      D CQ   I   C  G+C++   S+RC C G      +G              R+C      S C G                   A + G         VT+       PD+       +   C    C    +  F+ LC  G    +DGR      +++C  N  IC  G CE    S +RC+C         G +C+             +  VNRL C +G C N      C C  GY    D + C  I + +S            G    +  ++ C+C  G      G  C+ S       +I D           L  E C T G  +  P  + +   AC  GY +   KK     D  +C V    C  G C +    + C C    T+  +GR+C+
Sbjct:   58 CCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSNGQLSTNCGAVMN---CNVRCMNGGSCNEDSCTCQKGYTGTHCGQPICENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQISNQMCQGQLSGIVCTKTLCCATIGRAWGHPCEMCPAQPNPCRRGFIPNIRTGACQDVDECQAIPGLCQGGTCINTVGSYECKCPAGHKQSETSQKCEDQR-----VGSCFSALIGGRCAGELPGQFTKAHCCCESGRCWAIGQIPEMCPVRGS----DAFRRLCIEGLPLGPGFGPEVGPGDMRPGETGGNGLRPVRPGPGGPNGPELLPGLSTGIGTATLNQTGDICKL--FTNLCQNGRCIPTPASYRCECN---MGYKQDSRLECIDV--------DECSSSP----CIHGDCVNTPGSYHCRCHEGYQSNPTKQACIDID----ECIMNGVMCRNGRCVNTE-GSFQCICNAGFETTPDGKNCVDHDECATT--------NMCLNGMCIN-EDGSFKCICKPGFVLAPNGRYCVD----VDECQTPGI---CMNGRCINTEGSFRCECLGGLTIGIDG--------------RVCVDTHMRSTCYG-------------------AIKKGTCARPFPGAVTKSECCCASPDHG------FGEPCQ--PCPAKNSAEFQALCSSGIGITADGRD-----INECALNSEICPNGICENLRGS-YRCICNLGYESDASGKNCV----------DVDECAVNRLLCDNGLCRNTPGSYTCTCPKGYVFKIDSETCEDINECAS-------NPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPRGYSR---KKGVACEDVNECEVFPGVCPNGRCVNTAGSFKCECPEGLTLDGSGRNCV 896          

HSP 2 Score: 151.754 bits (382), Expect = 2.775e-36
Identity = 235/990 (23.74%), Postives = 361/990 (36.46%), Query Frame = 1
Query:  253 YDKTIRTETCPQNNQKLCTNNCSNKGQCQN--GKCICESGY------FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-YCPKGFTQKEN-RCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-----------------------QYRRDQCQL-YGSSCGIF-GKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNY---NVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI-----------------VNSNSDI-----------------CQSPEIAER----CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVR-------LCSKWEYYSLCQGG------ECVDTXXXXXXXXXXXXXA----TENGRKCS---------RIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKS--ICDLHRE---KCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            Y   I +ETC   N+  C +N    G C+N  G  +CE  +       G  C  ++  TC++ I  G C+       L K ECC+    AWG+PC  C+ +  CP+G+++K+   C+D++EC+ F  +C NG C+N  GSF+C+CP    LD +  +C                       +YR D C    G++ GI   +C      ++  +C +    +  G     +  Y   N C  F  LC  +G C+    S+ C C SGF    ++++C                  VN+                     C   +  ER    CRGG+C++    + C+C   ++  +    CV            CS S+  +LC  G C+++   Y C C  GF +T +R+ C+ I+  T         C           +YEC C  G+    + RSC   +   ++  IC+  G +C         P EY C C +G+  S D K CI   +      N  I   C  G+C +   S+ C C   Y        C    + E  A         L     +   CQ G       CVD +            A    T    +C+          I   V E  DN        ++ C  G C+ +   G++C C  GFT   D ++C  + +D+C   +NIC  G C+      FRC+C     L + G +C       +P           + C +G CVN      C C   ++ +  G  C      +                           L    + + G SC       + ++   C L R     C+   C      +Y   C  G     +  + I+ D  +C      C+GG C +    + C C   Y + E  R C          DI E S               I  C PG C     +Y C CP  +
Sbjct:  741 YVFKIDSETCEDINE--CASNPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATL-KSECCATLGAAWGSPCERCEIDPACPRGYSRKKGVACEDVNECEVFPGVCPNGRCVNTAGSFKCECPEGLTLDGSGRNCVDVRVEQCYMKWDEDECTAQLPGKYRMDMCCCSVGAAWGIDCEECPKPGSDEFKALCPRGPGFANRGDVLSGRPFYKDVNECKVFNSLCT-HGTCRNSIGSFRCVCDSGFALDAEERNCTDIDECRISPDLCGHGTCVNTPGSFDCECFDGYESGFMMMKNCMDIDECERDPLLCRGGTCINTDGSFECICPPGHELTSEGNACVDI--------NECSLSD--NLCRNGRCINMIGTYQCSCDSGFQSTPDRQGCVDIDECTIMNGGCDTHCTNSE------GSYECSCSEGYALMPDQRSCADIDECEDNPDICD--GGQCTN------IPGEYRCLCFDGFMASLDMKTCIDVNECD---LNPNI---CLHGECENTKGSFICHCQLGYFVKKGTTGCTDIDECEVGAHNCDVHASCLNVPGSFKCQCQTGWVGDGLNCVDLDECTTEDHKCNANANCVNTPGSYRCACNEGFNGDGFICSDVDECADN--------VNLCENGHCL-NAPGGYRCECEMGFTPTEDSKAC--QDIDEC-TFQNICVFGTCQNLPGM-FRCICDDGYELDRSGGNCTDVNECADP-----------VNCINGLCVNTPGNYLCNCPQDFELNPTGVGCVDTRVGNCF-------------------------LETQPRGDGGLSCSAEIGVGVTRASCCCSLGRAWGNPCE--FCPFANSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRIC---------EDIDECSAH-------------IGICGPGTCYNTLGNYTCVCPPEY 1623          

HSP 3 Score: 130.568 bits (327), Expect = 8.656e-30
Identity = 230/968 (23.76%), Postives = 357/968 (36.88%), Query Frame = 1
Query:  307 TNNCSNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKI----DRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSC--------IVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQ-GGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSL----CQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCA---SGNCVNDRCICG--PGYKSSEDGKECYKIEKVS----------SIXXXXXXXXXXXXXXXXD-----------DNNYECQCLNGYIKSENGRSCIKSESALIKKS---------------ICDLHREKCKTGICYPIGQ---------------NDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
             N C++   C NG C+   G +             G  C    +  C+++     D GL  S    + +++  CC     AWGNPC FC        +  CP G   + N      +DIDECQ    +C  G C+N  GSF+C+CP  +YL+E T  C+   D+C  +   CG  G C  T  G YTC+C   Y     G +C+        +  K +C           +Y  +C +    +  KK C          N   + C SP   E             Y  LC  +  G+  D   +R  T +P+    CS  E  ++C  G C++    + C+C  GF        C  I+    +C+  +  CQ    C  +  + Y C+C  G+  S +G    + E        C+   + C  G C       YIC C  G+  S D+  C+      D C  Q     C  G C +   SY C+C   +  ++N  +C+                E YSL    C+ G+C++   ++ C C  GY  T +G+ C  I  + T  P             C  G C  +    F+C+C PGF   +D    +   +++C    NIC  G C  +  S F+CVCP    LS +G  C       +    +C    +  +C+   + N    RC C   PG    +  + C +   V+          SI  +   +     C E             D ++ C+C  GY     G +C+ ++   I                   CD   E      C  I +                 Y C C  GY    D++ C  +D     +++   +G  C +++  ++CIC        +G  C+                     ++ C  K  I  C  G+CV     Y+C C   F+ +    ECV
Sbjct: 1433 VNECADPVNCINGLCVNTPGNYLCNCPQDFELNPTGVGCVDTRVGNCFLETQPRGDGGLSCSAEIGVGVTRASCCCSLGRAWGNPCEFCPFANSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICE-DIDECSAHIGICGP-GTCYNTL-GNYTCVCPPEYMQVNGGNNCM--------DMRKSVCY---------RNYNDTCENELSSNMTKKMCCCSYNIGKAWNKPCEPCPSPATPE-------------YIFLCGNQAPGFIID---IR--TGKPMDIDECS--EIPAICSNGVCINQIGSFRCECPMGFSYNNILLICEDID----ECSSGENLCQRNADCINIPGS-YRCECSSGYKLSPSGACVGRNE--------CQEIPNVCSHGTCMDTE-GSYICVCHNGFKASGDQTMCMD----IDECDRQP----CGNGTCKNTVGSYNCLCFPGFELTHN-NDCMDID-------------ECYSLVGQVCRNGQCINNVGSFQCLCQEGYEITPDGKNCMDI-NECTSLP-----------GTCSPGTCQ-NLEGSFRCICPPGFEVQND----NCIDINECDEEPNICLFGTCTNTPGS-FQCVCPPGFVLSDNGRRCF------DTRQSFCFTRFDNGKCSVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGSVAFQELCPYGHGSIPGMGDTREDVNECSESPGICVNGVCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCGNGTCSNVVGGFECTCDEGFEPGPMMTCEDINECTNPLLCAFRCINTYGSYECTCPSGYTLREDRRMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMQRRPDGEGCM--------------------DENECRTKPGI--CVNGRCVNTVGSYKCDCNEGFQVSSSGTECV 2278          

HSP 4 Score: 119.783 bits (299), Expect = 1.623e-26
Identity = 200/829 (24.13%), Postives = 323/829 (38.96%), Query Frame = 1
Query:  526 RNYCPKGFTQKEN-RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECV------------RYGTSEPLVSRYCSKSE---------YYSLCEGGSCVDLNN-DYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGEC-VDTXXXXXXXXXXXXXATENGRKCSRIE------------KQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLN--NENICT---PGR--------------------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCD--ILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKE 2811
            R  C  G+ Q     C D+DEC   S C++G+C+N  GS+ C+C   +  +    +C    D+C + G  C   G+CV T +G + CIC   +  + +GK+C+        N    +CL  G C     S+ C C  GF  + + + C+   + D CQ+P I   C  G C++    +RC C G      + + CV            + GT         +KSE         +   C+   C   N+ ++   CS G   T + R         ++CALN   C  G C+ L   +Y C C  G+    +G++C+  +        C +    C  G+C    P  Y C C +GY       + I +E  +D   N+  S  C  G C +N  S+ C C       + G  CV              K   +   Q G C V+ N                G  C R E            K V  E  N     + +   C  GRC+ +    FKC C  G T    GR+C    V+QC    +E+ CT   PG+                    C + G+  F+ +CP     +  G     + ++  P  K  +   + N L C  G C N     RC+C  G+    + + C  I++             G G       +++C+C +GY   E+G   +K+    +    C+     C+ G C       + C C  G++  ++  +C+ ++  +C++++  C+ G C +++  Y C C   +  T + + C         VDI E +  N    + CT  E
Sbjct:  418 RCECNMGYKQDSRLECIDVDECS-SSPCIHGDCVNTPGSYHCRCHEGYQSNPTKQAC-IDIDECIMNGVMC-RNGRCVNT-EGSFQCICNAGFETTPDGKNCVDHDECATTN----MCL-NGMCINEDGSFKCICKPGFVLAPNGRYCV---DVDECQTPGI---CMNGRCINTEGSFRCECLGGLTIGIDGRVCVDTHMRSTCYGAIKKGTCARPFPGAVTKSECCCASPDHGFGEPCQ--PCPAKNSAEFQALCSSGIGITADGRD-------INECALNSEICPNGICENL-RGSYRCICNLGYESDASGKNCVDVDE-------CAVNRLLCDNGLCRNT-PGSYTCTCPKGYV------FKIDSETCEDI--NECASNPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSM-----------KGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPRGYSRKKGVACEDVNE---CEVFPGVCPNGRCV-NTAGSFKCECPEGLTLDGSGRNCVDVRVEQCYMKWDEDECTAQLPGKYRMDMCCCSVGAAWGIDCEECPKPGSDEFKALCPRGPGFANRG-----DVLSGRPFYKDVNECKVFNSL-CTHGTCRNSIGSFRCVCDSGFALDAEERNCTDIDECR-----ISPDLCGHGTCVNTPGSFDCECFDGY---ESGFMMMKN---CMDIDECERDPLLCRGGTCINT-DGSFECICPPGHELTSEGNACVDIN--ECSLSDNLCRNGRCINMIGTYQCSCDSGFQSTPDRQGC---------VDIDECTIMNGGCDTHCTNSE 1161          

HSP 5 Score: 114.005 bits (284), Expect = 8.915e-25
Identity = 204/877 (23.26%), Postives = 329/877 (37.51%), Query Frame = 1
Query:  334 CQNGKCICESGYFGEDCNTAIISTCYVK-IDRGLCKSTP------------------ENLQ--------LSKEECCSIFQVAWGNPCVFCDRNY---CPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVC--NYFKKLCL-PY------GEC----QPYGLSYYCSCPSGFHQSEDKKSC-----IVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALN--------QFQCQGGRCQELDNNNYEC-QCLRG--FIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECV---------RYKQTEPPAVRLCSKWEYYSLC---QGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEP---DNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CQNG+CI     +  +CN        ++ ID   C S+P                  E  Q        +  +EC     +     CV  + ++   C  GF  T     C D DEC   ++CLNG CINE GSF+C C P   L  N   C    D+CQ  G    + G+C+ T +G + C C+   ++  +G+ C+     + C     K  C  P+       EC      +G    C      + +E +  C     I     DI +    +E C  G C +    YRC+CN  Y+   + + CV     E  V+R         LC+ G C +    Y C C +G+    +   C  I    S   +N         F C+     +LD+    C   ++G  ++  ++GR  +        +  C   G    +    P    E   AC  GYS+        K    +D  + +     C  G+CV+   S++C C        +G+ CV         ++ + E  A +L  K+     C        +D                  G   +     ++  P   D + C +  + S C  G C  +    F+C+C  GF   ++ R+C    +D+C  + ++C  G C  +  S F C C        DG+      +        C+   + L C  G C+N      CIC PG++ + +G  C  I + S   +L +               Y+C C +G+  + + + C+  +   I    CD H             +  Y C+C  GY    D++SC  +D  +C  N   C GG C +I   Y C+C   +  + + + CI
Sbjct:  405 CQNGRCIPTPASYRCECNMGYKQDSRLECIDVDECSSSPCIHGDCVNTPGSYHCRCHEGYQSNPTKQACIDIDECIMNGVMCRNGRCVNTEGSFQCICNAGFETTPDGKNCVDHDECATTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYC-VDVDECQTPGIC--MNGRCINT-EGSFRCECLGGLTIGIDGRVCVDTHMRSTCYGAIKKGTCARPFPGAVTKSECCCASPDHGFGEPCQPCPAKNSAEFQALCSSGIGITADGRDINECALNSEICPNGICENLRGSYRCICNLGYESDASGKNCVD--VDECAVNRL--------LCDNGLCRNTPGSYTCTCPKGYVFKIDSETCEDINECASNPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGS----PCERCEIDPACPRGYSRK-------KGVACEDVNECEVFPGVCPNGRCVNTAGSFKCECPEGLTLDGSGRNCVDVRVEQCYMKWDEDECTA-QLPGKYRMDMCCCSVGAAWGIDCEECPKPGSDEFKALCPRGPGFANRGDVLSGRPFYKDVNECKV--FNSLCTHGTCR-NSIGSFRCVCDSGFALDAEERNC--TDIDECRISPDLCGHGTCVNTPGS-FDCEC-------FDGYESGFMMMKNCMDIDECE--RDPLLCRGGTCINTDGSFECICPPGHELTSEGNACVDINECSLSDNLCRNGRCINMI-----GTYQCSCDSGFQSTPDRQGCVDIDECTIMNGGCDTHCTN---------SEGSYECSCSEGYALMPDQRSCADID--ECEDNPDICDGGQCTNIPGEYRCLCFDGFMASLDMKTCI 1224          

HSP 6 Score: 108.612 bits (270), Expect = 4.452e-23
Identity = 210/874 (24.03%), Postives = 323/874 (36.96%), Query Frame = 1
Query:  460 LSKEECCSIFQV--AWGNPCVFCDRNYCPK----------GFTQ--KENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGF-IRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNG--------------QECVRYKQTEPPA-------VRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLS------KDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICDLHREK----------CKTG--------ICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            ++K+ CC  + +  AW  PC  C     P+          GF    +  +  DIDEC +  +IC NG CIN+ GSFRC+CP     +   + C+   D+C    + C     C+    G Y C C   Y +S +G +C+ +   N C     +C  +G C     SY C C +GF  S D+  C+     D        + C  G+C +    Y CLC   ++  +N+ +C+       LV +         +C  G C++    + C C EG+  T + + C+ I   TS        C  G CQ L+ + + C C  GF ++++N   CI         +IC L+G    T       P  + C C  G+  S++ + C    Q   +C  +  + +C   +   N    RC C  K      G              QE   Y     P        V  CS  E   +C  G C++T+ ++ C+C  GY     G  C   ++     P             C  G C  +   GF+C C  GF     G     E +++C N   +    RC  +  S + C CP   +L       KD   C       E     C  L+    C          IC PG +   DG+ C    +  +   +                +Y+C C  G+  S +G  C+ +        + +++C L              C +G        IC   G   +   C  G   ATD +     D  +C V    CK G C + +  + C C   YT    G  C         VD+ E + Q+P+  +F              C   +  YQC CP  +
Sbjct: 1656 MTKKMCCCSYNIGKAWNKPCEPCPSPATPEYIFLCGNQAPGFIIDIRTGKPMDIDECSEIPAICSNGVCINQIGSFRCECPMGFSYNNILLICE-DIDECSSGENLCQRNADCI-NIPGSYRCECSSGYKLSPSG-ACVGR---NECQEIPNVC-SHGTCMDTEGSYICVCHNGFKASGDQTMCMDIDECD-------RQPCGNGTCKNTVGSYNCLCFPGFELTHNN-DCMDIDECYSLVGQ---------VCRNGQCINNVGSFQCLCQEGYEITPDGKNCMDINECTSL----PGTCSPGTCQNLEGS-FRCICPPGFEVQNDN---CIDINECDEEPNIC-LFGTCTNT-------PGSFQCVCPPGFVLSDNGRRCFDTRQ--SFCFTRFDNGKCSVPK-AFNTTKARCCCS-KMPGEGWGDPCELCPQEGSVAFQELCPYGHGSIPGMGDTREDVNECS--ESPGICVNGVCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNP-------------CGNGTC-SNVVGGFECTCDEGFEP---GPMMTCEDINECTNP--LLCAFRCINTYGS-YECTCPSGYTLREDRRMCKDLDECAEGLHDCESRGMMCKNLIGTFMC----------ICPPGMQRRPDGEGCMDENECRTKPGICVNGRCVNTV-----GSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQLSSTNRNMVTKSECCCNSGRGWGNQCEICPLPGTGAFKKMCPHGPGFATDGR-----DIDECKVLPNLCKNGQCINTIGSFRCHCKLGYTTDITGTTC---------VDLDECA-QSPKPCNF-------------ICKNTEGSYQCSCPRGY 2420          

HSP 7 Score: 105.531 bits (262), Expect = 4.191e-22
Identity = 212/907 (23.37%), Postives = 334/907 (36.82%), Query Frame = 1
Query:  346 KCICESGYFGEDC--NTAIISTCYVK---IDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQK--ENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC----------QYRRDQCQLYGSSCGIFGKCVPTSDGQYTCIC----IKPY-SVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKS---EYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEK-QVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGR------DCILKIIAVKSV---------DISEVSYQNPQSQSFCTRKEIIEKCQP-----GKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            +CIC  GY  +    N   +  C V     D GLC++TP +   +                       CPKG+  K     C+DI+EC   + C+NG C N  GSF C+C     LD     C            +  +C++  +   +  +C  T    +   C    I P     ++ K  +   + N C  F  +C P G C     S+ C CP G       ++C V+   + C      + C   +    GK            Y  D  C   G +  +    C K    E+ +LC  G       D        FY   N            +C +    C  G C+     ++ C C  GF      R+C   +  R S  +C   GH    G C    P  + C C +GY   E     +KN    D C+   +   CRGG C++   S+ C+C   +  ++ G  CV   +        CS  +  +LC+ G C++    Y C C +G+ +T + + C  I++  +     +++C   E                 ++C C  G+    D RSC    +D+C +N +IC  G+C       +RC+C      S D  +C+            CD+  N   C  G C N +    C C  GY   +    C  I++      +    C           +++CQC  G++   +G +C+  +    +   C+ +     T          Y CAC  G+    +    I  D  +CA N   C+ G+C +   GY C C   +T TE+ +      +C  + I V             I +  Y+  +S   CT  ++ E   P     G CV    +Y C CP  F+ N     CV
Sbjct:  692 RCICNLGYESDASGKNCVDVDECAVNRLLCDNGLCRNTPGSYTCT-----------------------CPKGYVFKIDSETCEDINECA-SNPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPRGYSRKKGVACEDVNECEVFPGVC-PNGRCVNTAGSFKCECPEGLTLDGSGRNC-VDVRVEQCYMKWDEDEC---TAQLPGK------------YRMDMCCCSVGAAWGIDCEECPKPGSDEFKALCPRGPGFANRGDVLS--GRPFYKDVN------------ECKVFNSLCTHGTCRN-SIGSFRCVCDSGFALDAEERNCTDIDECRISPDLC---GH----GTCVNT-PGSFDCECFDGY---ESGFMMMKNCMDIDECERDPL--LCRGGTCINTDGSFECICPPGHELTSEGNACVDINE--------CSLSD--NLCRNGRCINMIGTYQCSCDSGFQSTPDRQGCVDIDECTIMNGGCDTHCTNSEG---------------SYECSCSEGYALMPDQRSC--ADIDECEDNPDICDGGQCTNI-PGEYRCLCFDGFMASLDMKTCI--------DVNECDL--NPNICLHGECENTKGSFICHCQLGYFVKKGTTGCTDIDECE----VGAHNCDVHASCLNVPGSFKCQCQTGWVG--DGLNCVDLDECTTEDHKCNANANCVNT-------PGSYRCACNEGF----NGDGFICSDVDECADNVNLCENGHCLNAPGGYRCECEMGFTPTEDSKACQDIDECTFQNICVFGTCQNLPGMFRCICDDGYELDRSGGNCT--DVNECADPVNCINGLCVNTPGNYLCNCPQDFELNPTGVGCV 1472          

HSP 8 Score: 105.145 bits (261), Expect = 5.780e-22
Identity = 224/926 (24.19%), Postives = 342/926 (36.93%), Query Frame = 1
Query:  526 RNYCPKGFTQKENR--CDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGF----------------------IRSENGRSC---IKAERTRNST--SICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGR------------------CIGDKTYGFKCLC---LPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGK-----ECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYD----HECVRDSNKCPYCFYGCFDENSISTCSC------SENYENLFDT--GLCIIKSDEISYSLGDSTCRTKS 3087
            R  C  GF    +   C D++EC    +ICL+GEC N KGSF C C   +++ + T  C    D+C++   +C +   C+    G + C C   +    +G +C+   + + C      C     C     SY C+C  GF+   D   C     SD+ +  +    C  G C++   GYRC C   +    + + C               +  + ++C  G+C +L   + C C +G+    +   C  +    ++CA +   C  G C     N Y C C + F                       R + G SC   I    TR S   S+   +G+ C+   C      EY   C  G     +    I     +D  + QE+   C+GG CV+   S++C C   Y  +   + C    +        CS   +  +C  G C +T  NY C C   Y     G  C  + K V     N  C  +  LS  M  +                  C    T  +  LC    PGF    D R+  P  +D+C     IC+ G C     S FRC CP   S +        N +        C    N  +  + +C+N     RC C  GYK S  G      EC +I  V S            G     + +Y C C NG+  S +   C+  +        CD  R+ C  G C       Y C C  G+ + T    C+ +D     V +  C+ G C + V  + C+C   Y +T +G++C+         DI+E +              +   C PG C   +  ++C CP  F+    +    +EC  + N C   F  C +      C C      S+N    FDT    C  + D    S+  +   TK+
Sbjct: 1207 RCLCFDGFMASLDMKTCIDVNECDLNPNICLHGECENTKGSFICHCQLGYFVKKGTTGCT-DIDECEVGAHNCDVHASCL-NVPGSFKCQCQTGWV--GDGLNCV---DLDECTTEDHKCNANANCVNTPGSYRCACNEGFNG--DGFIC-----SDVDECADNVNLCENGHCLNAPGGYRCECEMGFTPTEDSKACQDI-----------DECTFQNICVFGTCQNLPGMFRCICDDGYELDRSGGNCTDV----NECA-DPVNCINGLCVNTPGN-YLCNCPQDFELNPTGVGCVDTRVGNCFLETQPRGDGGLSCSAEIGVGVTRASCCCSLGRAWGNPCE--FCPFANSTEYKTLCPGGEGFRPNPITVI----LEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICEDIDE--------CSA--HIGICGPGTCYNTLGNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNYNDTC--ENELSSNMTKKMCCCSYNIGKAWNKPCEPCPSPATPEYIFLCGNQAPGFII--DIRTGKPMDIDECSEIPAICSNGVCINQIGS-FRCECPMGFSYN--------NILLICEDIDECSSGENLCQ-RNADCINIPGSYRCECSSGYKLSPSGACVGRNECQEIPNVCS-----------HGTCMDTEGSYICVCHNGFKASGDQTMCMDIDE-------CD--RQPCGNGTCKNT-VGSYNCLCFPGF-ELTHNNDCMDIDECYSLVGQV-CRNGQCINNVGSFQCLCQEGYEITPDGKNCM---------DINECT-------------SLPGTCSPGTCQNLEGSFRCICPPGFEVQNDNCIDINECDEEPNIC--LFGTCTNTPGSFQCVCPPGFVLSDNGRRCFDTRQSFCFTRFDNGKCSVPKAFNTTKA 2024          

HSP 9 Score: 97.0561 bits (240), Expect = 1.548e-19
Identity = 209/875 (23.89%), Postives = 332/875 (37.94%), Query Frame = 1
Query:  532 YCPKGF-TQKENRCDDIDEC--QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTS----DGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNS--------DICQSPEIAERCRGGSCVS----EGKGYRC-LCNGEYQGYNNDQECVRYG-TSEPLVSRYCSK----SEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ--TEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKC---------SRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDK--------TYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQND---YICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY-----CFYGCFDENSISTCSCSENY 3000
             C  GF     N C DIDEC      +C NG+CIN  GSF+C C   + +  +  +C    +   L G+       C P +    +G + CIC  P        +CI   + N C+    +CL +G C     S+ C CP GF  S++ + C     S          C  P+     +   C S    EG G  C LC  E  G    QE   YG  S P +          SE   +C  G C++ +  + C+C  G+        C+     T +C++    C  G C  +    +EC C  GF       +C       N      L   RC            Y C C  GY+  EDR+ C    +  D C         RG  C +   ++ C+C        +G+ C+   +  T+P             +C  G CV+T  +Y C C  G+  + +G +C         + + + + +    +  ++ +    C  GR  G++        T  FK +C  G   A+DGR      +D+C    N+C  G+C  +  S FRC C    +    G +C ++      + K C+ +      +       +C C  GY   EDGK C  +++ S+     Q  C           ++ C+C  G+ + ++  SCI +     + S+C         G+C    QN+   + C C  G+   +   +C  +D  +C  N +RC+ G C +++ G+ C C   Y        C         VD +E + Q+               C    C      ++C CP  F  +     C +D ++C       C YGC + +    C C   Y
Sbjct: 1858 LCFPGFELTHNNDCMDIDECYSLVGQVCRNGQCINNVGSFQCLCQEGYEITPDGKNCMDINECTSLPGT-------CSPGTCQNLEGSFRCIC--PPGFEVQNDNCI---DINECDEEPNICL-FGTCTNTPGSFQCVCPPGFVLSDNGRRCFDTRQSFCFTRFDNGKCSVPKAFNTTKARCCCSKMPGEGWGDPCELCPQE--GSVAFQELCPYGHGSIPGMGDTREDVNECSESPGICVNGVCINTDGSFRCECPFGYNLDYTGVNCVD----TDECSIGN-PCGNGTCSNV-VGGFECTCDEGFEPGPM-MTCEDINECTNPL----LCAFRCINTY------GSYECTCPSGYTLREDRRMC----KDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMQRRPDGEGCMDENECRTKP------------GICVNGRCVNTVGSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQLSSTNRNMVTKSECCCNSGRGWGNQCEICPLPGTGAFKKMCPHGPGFATDGRD-----IDECKVLPNLCKNGQCINTIGS-FRCHCKLGYTTDITGTTC-VDLDECAQSPKPCNFICKNTEGSY------QCSCPRGYILQEDGKTCKDLDECSTKQHNCQFLCVNTI------GSFNCKCPPGFTQHQS--SCIDNNECSSQPSLCG------SRGVC----QNNPGSFTCECQKGFSLDSSGSNCEDVD--ECDGN-HRCQHG-CQNVLGGFRCGCPQGYVQHYQWNQC---------VDENECTSQS--------------TCGSASCYNTLGSFKCVCPSGFDFDQSFGGC-QDVDECSSGGGNPCSYGCSNTDGGYLCGCPGGY 2625          

HSP 10 Score: 94.7449 bits (234), Expect = 7.395e-19
Identity = 178/741 (24.02%), Postives = 268/741 (36.17%), Query Frame = 1
Query:  346 KCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECC--SIFQVAWGNPCVFCDRN-------YCPKGFTQKENRCD---DIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERC--RGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRY---KQTEPPAVRLCSKWEYYSLC----------QGGECVD-----TXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNS---NFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGR 2433
            +C+C  G+     G  C     S C+ + D G C S P+    +K  CC   +    WG+PC  C +         CP G        D   D++EC +   IC+NG CIN  GSFRC+CP  + LD   ++C    D+C + G+ CG  G C     G + C C +     F     +   + N C     L   +     YG SY C+CPSG+   ED++ C      D+ +  E    C  RG  C +    + C+C    Q   + + C        +    C       +C  G CV+    Y C C+EGF  + +   C+          + Q  CQ                    + S N     K+E   NS      +G++C+  +C       +   C  G   + D          +D  + + +   C+ GQC++   S+RC C   Y +   G  CV      Q+  P   +C   E    C           G  C D     T  +           + N +      +  +   DN+ C  Q  L    G R +     G F C C  GF+  S G +C  E VD+C  N       RC+    +    FRC CP         + C+     T  +T           C S +C N     +C+C  G+   +    C  +++ SS                  D  Y C C  GY ++  G 
Sbjct: 1980 QCVCPPGFVLSDNGRRCFDTRQSFCFTRFDNGKC-SVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGSVAFQELCPYGHGSIPGMGDTREDVNECSESPGICVNGVCINTDGSFRCECPFGYNLDYTGVNC-VDTDECSI-GNPCG-NGTCSNVVGG-FECTCDE----GFEPGPMMTCEDINECT--NPLLCAFRCINTYG-SYECTCPSGYTLREDRRMC-----KDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMQRRPDGEGC--------MDENECRTKP--GICVNGRCVNTVGSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQ--------------------LSSTNRNMVTKSECCCNSG---RGWGNQCE--ICPLPGTGAFKKMCPHGPGFATDG---------RDIDECKVLPNLCKNGQCINTIGSFRCHCKLGYTTDITGTTCVDLDECAQSPKPCNFICKNTEGSYQCSCPRGYILQEDGKTCKDLDECSTKQHNCQFLCVNTIGSFNCKCPPGFTQHQSSCIDNNECSSQPSLC---GSRGVCQNNPGSFTCECQKGFSLDSSGSNC--EDVDECDGNH------RCQHGCQNVLGGFRCGCPQGYVQHYQWNQCVDENECTSQST-----------CGSASCYNTLGSFKCVCPSGFDFDQSFGGCQDVDECSS-----GGGNPCSYGCSNTDGGYLCGCPGGYFRAGQGH 2632          

HSP 11 Score: 90.8929 bits (224), Expect = 1.234e-17
Identity = 189/787 (24.02%), Postives = 299/787 (37.99%), Query Frame = 1
Query:  346 KCICESGYFGEDCNTAIISTCYVKIDR----GLCKSTPENLQLS--------------KEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSC----VSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERT---RNSTSIC--ELYGHRCQTGVC-----------------YPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQ-GGECVDTXXXXXXXXXXXXXATENGRKCSRIE-KQVTEEPDNSYCLLQE--YLSRCMGG-RCIGDKTY----------------------GFKCLCLPGFTSASDGRSCDPEYVDQCLN-NENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL 2460
            KC C++G+ G+  N   +  C  +  +      C +TP + + +               +EC     +     C+     Y   C  GFT  E+   C DIDEC F++IC+ G C N  G FRC C   + LD +  +C    D  +       I G CV T  G Y C C + + ++  G  C+     N           + E QP G     SC +       + SC  +             R  G  C     +    Y+ LC G         E  R      ++       E   LC+GG+CV+    + C+C  G+Y  E  R C  I+    +C+ +   C  G C      NY C C   +++   G +C+   ++   RN    C  EL  +  +   C                  P  P EYI  C    +Q+      I+  +  D  +  EI   C  G C++   S+RC C   +  +N    C    +        CS  E  +LCQ   +C++   +Y C+C +GY  + +G    R E +++     +  C+  E  Y+  C  G +  GD+T                        + CLC PGF    +    D   +D+C +    +C  G+C  +  S F+C+C     ++ DG +C+ IN  T+ P T           C+ G C N     RCIC PG++   D   C  I +        +      G       +++C C  G++ S+NGR C  +  + 
Sbjct: 1292 KCQCQTGWVGDGLNCVDLDECTTEDHKCNANANCVNTPGSYRCACNEGFNGDGFICSDVDECADNVNLCENGHCLNAPGGYRCECEMGFTPTEDSKACQDIDECTFQNICVFGTCQNLPGMFRCICDDGYELDRSGGNCT---DVNECADPVNCINGLCVNTP-GNYLCNCPQDFELNPTGVGCVDTRVGNC----------FLETQPRGDGGL-SCSAEIGVGVTRASCCCS-----------LGRAWGNPCEFCPFANSTEYKTLCPG--------GEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICEDID----ECSAHIGICGPGTCYNT-LGNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNYNDTCENELSSNMTKKMCCCSYNIGKAWNKPCEPCPSPATP-EYIFLC---GNQAPGFIIDIRTGKPMDIDECSEIPAICSNGVCINQIGSFRCECPMGFSYNNILLICEDIDE--------CSSGE--NLCQRNADCINIPGSYRCECSSGYKLSPSGACVGRNECQEIPNVCSHGTCMDTEGSYICVCHNGFKASGDQTMCMDIDECDRQPCGNGTCKNTVGSYNCLCFPGFELTHNNDCMD---IDECYSLVGQVCRNGQCINNVGS-FQCLCQEGYEITPDGKNCMDINECTSLPGT-----------CSPGTCQNLEGSFRCICPPGFEVQND--NCIDINECDE-----EPNICLFGTCTNTPGSFQCVCPPGFVLSDNGRRCFDTRQSF 2003          

HSP 12 Score: 61.2326 bits (147), Expect = 1.167e-8
Identity = 108/427 (25.29%), Postives = 157/427 (36.77%), Query Frame = 1
Query:  310 NNCSNK-GQCQNGKCICESGYFGEDCN---------TAIIST----CYVKIDRGLCKSTPENLQL-SKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQ-FKSICLNGECINEKGSF-----------------------------------------RCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGR 1398
            N C  K G C NG+C+   G +  DCN         T  + T    C+ ++ + +C+ +  N  + +K ECC      WGN C  C        +  CP G     +   DIDEC+   ++C NG+CIN  GSF                                         +C CP  + L E+  +C+   D+C     +C     CV T  G + C C  P   + +  SCI     N C+    LC   G CQ    S+ C C  GF       +C    + D C       RC+ G C +   G+RC C   Y  +    +CV             ++    S C   SC +    + C C  GF   ++   C  ++  +S        C  G C   D   Y C C  G+ R+  G 
Sbjct: 2239 NECRTKPGICVNGRCVNTVGSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQLSSTNRNMVTKSECCCNSGRGWGNQCEICPLPGTGAFKKMCPHGPGFATDG-RDIDECKVLPNLCKNGQCINTIGSFRCHCKLGYTTDITGTTCVDLDECAQSPKPCNFICKNTEGSYQCSCPRGYILQEDGKTCK-DLDECSTKQHNCQFL--CVNTI-GSFNCKC--PPGFTQHQSSCIDN---NECSSQPSLCGSRGVCQNNPGSFTCECQKGFSLDSSGSNC---EDVDECDG---NHRCQHG-CQNVLGGFRCGCPQGYVQHYQWNQCVDE-----------NECTSQSTCGSASCYNTLGSFKCVCPSGFDFDQSFGGCQDVDECSSG---GGNPCSYG-CSNTD-GGYLCGCPGGYFRAGQGH 2632          
BLAST of Fibrillin-2 vs. Ensembl Xenopus
Match: FBN3 (fibrillin 3 [Source:NCBI gene;Acc:100151721])

HSP 1 Score: 156.762 bits (395), Expect = 9.004e-38
Identity = 223/945 (23.60%), Postives = 348/945 (36.83%), Query Frame = 1
Query:  148 CCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLP--YGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSE--------YYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKC----------SRIEKQVTEEPDNSYCLLQE---------YLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICD-----------LHREKCKT-GICY--PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CC GW     G+ C+   C   CG G C   N+C C +  + T  C       C   C N G C    C C+ GY G  C   I                                    C+ +I   +C+     +  +K  CC+    AWG+PC  C    N C +GF    +   C D+DECQ    +C  G CIN  GS+ C+CP  H   E +  C+   D+C    + C   G+C  T+ G Y C+C + ++ S +G  CI +    V + F  L      GE        +C C SG       +   +    ++C      + C  G  +  G G   +  G+ +               P +S   +           + +LC+ G C+     Y C+C+ G Y  ++R  CI ++  +S        C  G C     + Y C+C  G+  +   ++CI  +        C + G  C+ G C       + C C  G+  + D K C+ +++          +  C  G C++   S++C+C   ++ + NG+ CV   + + P +           C  G C++T  ++ C+C  G     +GR C            I+K     P        E         +   C    C    +  F+ LC  G    +DGR      +++C  N  IC  G CE    S +RC+C         G +C+             +  VNRL C +G C N      C C  GY    D + C  I + +S            G    +  ++ C+C  G      G  C+ S       +I D           L  E C T G  +  P  + +   AC  GY +   KK     D  +C V    C  G C +    + C C    T+  +GR+C+
Sbjct:   36 CCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSNGQLST-NCGAGIVMNCNVRCMNGGSCNEDSCTCQKGYTGTHCGQPICENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQISNQMCQGQLSGIVCTKTLCCATIGRAWGHPCEMCPAQPNPCRRGFIPNIRTGACQDVDECQAIPGLCQGGTCINTVGSYECKCPAGHKQSETSQKCE-DIDECSTIPNVCD-GGECTNTA-GSYVCVCPRGFTTSRDGSRCIDQ---RVGSCFSALIGGRCAGELPGQFTKAHCCCESG-------RCWAIGQIPEMCPVRGSGKLCIEGLPLGPGFGPE-VGPGDMRPVRPGPGGPNGPELLPGLSTGTATLNQTGDICKLFTNLCQNGRCIPTPASYRCECNMG-YKQDSRLECIDVDECSSS------PCIHGDCVNTPGS-YHCRCHEGYQSNPTKQACIDIDE-------CIMNGVMCRNGRCVNTE-GSFQCICNAGFETTPDGKNCVDHDECA-------TTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCVDVDECQTPGI-----------CMNGRCINTEGSFRCECLGGLTIGIDGRVCVDTHMRSTCYGAIKKGTCARPFPGAVTKSECCCASPDHGFGEPCQ--PCPAKNSAEFQALCSSGIGITADGRD-----INECALNSEICPNGICENLRGS-YRCICNLGYESDASGKNCV----------DVDECAVNRLLCDNGLCRNTPGSYTCTCPKGYVFKIDSETCEDINECAS-------NPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPRGYSR---KKGVACEDVNECEVFPGVCPNGRCVNTAGSFKCECPEGLTLDGSGRNCV 903          

HSP 2 Score: 151.754 bits (382), Expect = 2.493e-36
Identity = 235/990 (23.74%), Postives = 361/990 (36.46%), Query Frame = 1
Query:  253 YDKTIRTETCPQNNQKLCTNNCSNKGQCQN--GKCICESGY------FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-YCPKGFTQKEN-RCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-----------------------QYRRDQCQL-YGSSCGIF-GKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNY---NVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI-----------------VNSNSDI-----------------CQSPEIAER----CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVR-------LCSKWEYYSLCQGG------ECVDTXXXXXXXXXXXXXA----TENGRKCS---------RIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKS--ICDLHRE---KCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            Y   I +ETC   N+  C +N    G C+N  G  +CE  +       G  C  ++  TC++ I  G C+       L K ECC+    AWG+PC  C+ +  CP+G+++K+   C+D++EC+ F  +C NG C+N  GSF+C+CP    LD +  +C                       +YR D C    G++ GI   +C      ++  +C +    +  G     +  Y   N C  F  LC  +G C+    S+ C C SGF    ++++C                  VN+                     C   +  ER    CRGG+C++    + C+C   ++  +    CV            CS S+  +LC  G C+++   Y C C  GF +T +R+ C+ I+  T         C           +YEC C  G+    + RSC   +   ++  IC+  G +C         P EY C C +G+  S D K CI   +      N  I   C  G+C +   S+ C C   Y        C    + E  A         L     +   CQ G       CVD +            A    T    +C+          I   V E  DN        ++ C  G C+ +   G++C C  GFT   D ++C  + +D+C   +NIC  G C+      FRC+C     L + G +C       +P           + C +G CVN      C C   ++ +  G  C      +                           L    + + G SC       + ++   C L R     C+   C      +Y   C  G     +  + I+ D  +C      C+GG C +    + C C   Y + E  R C          DI E S               I  C PG C     +Y C CP  +
Sbjct:  748 YVFKIDSETCEDINE--CASNPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATL-KSECCATLGAAWGSPCERCEIDPACPRGYSRKKGVACEDVNECEVFPGVCPNGRCVNTAGSFKCECPEGLTLDGSGRNCVDVRVEQCYMKWDEDECTAQLPGKYRMDMCCCSVGAAWGIDCEECPKPGSDEFKALCPRGPGFANRGDVLSGRPFYKDVNECKVFNSLCT-HGTCRNSIGSFRCVCDSGFALDAEERNCTDIDECRISPDLCGHGTCVNTPGSFDCECFDGYESGFMMMKNCMDIDECERDPLLCRGGTCINTDGSFECICPPGHELTSEGNACVDI--------NECSLSD--NLCRNGRCINMIGTYQCSCDSGFQSTPDRQGCVDIDECTIMNGGCDTHCTNSE------GSYECSCSEGYALMPDQRSCADIDECEDNPDICD--GGQCTN------IPGEYRCLCFDGFMASLDMKTCIDVNECD---LNPNI---CLHGECENTKGSFICHCQLGYFVKKGTTGCTDIDECEVGAHNCDVHASCLNVPGSFKCQCQTGWVGDGLNCVDLDECTTEDHKCNANANCVNTPGSYRCACNEGFNGDGFICSDVDECADN--------VNLCENGHCL-NAPGGYRCECEMGFTPTEDSKAC--QDIDEC-TFQNICVFGTCQNLPGM-FRCICDDGYELDRSGGNCTDVNECADP-----------VNCINGLCVNTPGNYLCNCPQDFELNPTGVGCVDTRVGNCF-------------------------LETQPRGDGGLSCSAEIGVGVTRASCCCSLGRAWGNPCE--FCPFANSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRIC---------EDIDECSAH-------------IGICGPGTCYNTLGNYTCVCPPEY 1630          

HSP 3 Score: 130.568 bits (327), Expect = 7.907e-30
Identity = 230/968 (23.76%), Postives = 357/968 (36.88%), Query Frame = 1
Query:  307 TNNCSNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKI----DRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSC--------IVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQ-GGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSL----CQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCA---SGNCVNDRCICG--PGYKSSEDGKECYKIEKVS----------SIXXXXXXXXXXXXXXXXD-----------DNNYECQCLNGYIKSENGRSCIKSESALIKKS---------------ICDLHREKCKTGICYPIGQ---------------NDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
             N C++   C NG C+   G +             G  C    +  C+++     D GL  S    + +++  CC     AWGNPC FC        +  CP G   + N      +DIDECQ    +C  G C+N  GSF+C+CP  +YL+E T  C+   D+C  +   CG  G C  T  G YTC+C   Y     G +C+        +  K +C           +Y  +C +    +  KK C          N   + C SP   E             Y  LC  +  G+  D   +R  T +P+    CS  E  ++C  G C++    + C+C  GF        C  I+    +C+  +  CQ    C  +  + Y C+C  G+  S +G    + E        C+   + C  G C       YIC C  G+  S D+  C+      D C  Q     C  G C +   SY C+C   +  ++N  +C+                E YSL    C+ G+C++   ++ C C  GY  T +G+ C  I  + T  P             C  G C  +    F+C+C PGF   +D    +   +++C    NIC  G C  +  S F+CVCP    LS +G  C       +    +C    +  +C+   + N    RC C   PG    +  + C +   V+          SI  +   +     C E             D ++ C+C  GY     G +C+ ++   I                   CD   E      C  I +                 Y C C  GY    D++ C  +D     +++   +G  C +++  ++CIC        +G  C+                     ++ C  K  I  C  G+CV     Y+C C   F+ +    ECV
Sbjct: 1440 VNECADPVNCINGLCVNTPGNYLCNCPQDFELNPTGVGCVDTRVGNCFLETQPRGDGGLSCSAEIGVGVTRASCCCSLGRAWGNPCEFCPFANSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICE-DIDECSAHIGICGP-GTCYNTL-GNYTCVCPPEYMQVNGGNNCM--------DMRKSVCY---------RNYNDTCENELSSNMTKKMCCCSYNIGKAWNKPCEPCPSPATPE-------------YIFLCGNQAPGFIID---IR--TGKPMDIDECS--EIPAICSNGVCINQIGSFRCECPMGFSYNNILLICEDID----ECSSGENLCQRNADCINIPGS-YRCECSSGYKLSPSGACVGRNE--------CQEIPNVCSHGTCMDTE-GSYICVCHNGFKASGDQTMCMD----IDECDRQP----CGNGTCKNTVGSYNCLCFPGFELTHN-NDCMDID-------------ECYSLVGQVCRNGQCINNVGSFQCLCQEGYEITPDGKNCMDI-NECTSLP-----------GTCSPGTCQ-NLEGSFRCICPPGFEVQND----NCIDINECDEEPNICLFGTCTNTPGS-FQCVCPPGFVLSDNGRRCF------DTRQSFCFTRFDNGKCSVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGSVAFQELCPYGHGSIPGMGDTREDVNECSESPGICVNGVCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCGNGTCSNVVGGFECTCDEGFEPGPMMTCEDINECTNPLLCAFRCINTYGSYECTCPSGYTLREDRRMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMQRRPDGEGCM--------------------DENECRTKPGI--CVNGRCVNTVGSYKCDCNEGFQVSSSGTECV 2285          

HSP 4 Score: 114.39 bits (285), Expect = 8.280e-25
Identity = 204/877 (23.26%), Postives = 329/877 (37.51%), Query Frame = 1
Query:  334 CQNGKCICESGYFGEDCNTAIISTCYVK-IDRGLCKSTP------------------ENLQ--------LSKEECCSIFQVAWGNPCVFCDRNY---CPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVC--NYFKKLCL-PY------GEC----QPYGLSYYCSCPSGFHQSEDKKSC-----IVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALN--------QFQCQGGRCQELDNNNYEC-QCLRG--FIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECV---------RYKQTEPPAVRLCSKWEYYSLC---QGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEP---DNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CQNG+CI     +  +CN        ++ ID   C S+P                  E  Q        +  +EC     +     CV  + ++   C  GF  T     C D DEC   ++CLNG CINE GSF+C C P   L  N   C    D+CQ  G    + G+C+ T +G + C C+   ++  +G+ C+     + C     K  C  P+       EC      +G    C      + +E +  C     I     DI +    +E C  G C +    YRC+CN  Y+   + + CV     E  V+R         LC+ G C +    Y C C +G+    +   C  I    S   +N         F C+     +LD+    C   ++G  ++  ++GR  +        +  C   G    +    P    E   AC  GYS+        K    +D  + +     C  G+CV+   S++C C        +G+ CV         ++ + E  A +L  K+     C        +D                  G   +     ++  P   D + C +  + S C  G C  +    F+C+C  GF   ++ R+C    +D+C  + ++C  G C  +  S F C C        DG+      +        C+   + L C  G C+N      CIC PG++ + +G  C  I + S   +L +               Y+C C +G+  + + + C+  +   I    CD H             +  Y C+C  GY    D++SC  +D  +C  N   C GG C +I   Y C+C   +  + + + CI
Sbjct:  412 CQNGRCIPTPASYRCECNMGYKQDSRLECIDVDECSSSPCIHGDCVNTPGSYHCRCHEGYQSNPTKQACIDIDECIMNGVMCRNGRCVNTEGSFQCICNAGFETTPDGKNCVDHDECATTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYC-VDVDECQTPGIC--MNGRCINT-EGSFRCECLGGLTIGIDGRVCVDTHMRSTCYGAIKKGTCARPFPGAVTKSECCCASPDHGFGEPCQPCPAKNSAEFQALCSSGIGITADGRDINECALNSEICPNGICENLRGSYRCICNLGYESDASGKNCVD--VDECAVNRL--------LCDNGLCRNTPGSYTCTCPKGYVFKIDSETCEDINECASNPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGS----PCERCEIDPACPRGYSRK-------KGVACEDVNECEVFPGVCPNGRCVNTAGSFKCECPEGLTLDGSGRNCVDVRVEQCYMKWDEDECTA-QLPGKYRMDMCCCSVGAAWGIDCEECPKPGSDEFKALCPRGPGFANRGDVLSGRPFYKDVNECKV--FNSLCTHGTCR-NSIGSFRCVCDSGFALDAEERNC--TDIDECRISPDLCGHGTCVNTPGS-FDCEC-------FDGYESGFMMMKNCMDIDECE--RDPLLCRGGTCINTDGSFECICPPGHELTSEGNACVDINECSLSDNLCRNGRCINMI-----GTYQCSCDSGFQSTPDRQGCVDIDECTIMNGGCDTHCTN---------SEGSYECSCSEGYALMPDQRSCADID--ECEDNPDICDGGQCTNIPGEYRCLCFDGFMASLDMKTCI 1231          

HSP 5 Score: 113.62 bits (283), Expect = 1.388e-24
Identity = 168/657 (25.57%), Postives = 245/657 (37.29%), Query Frame = 1
Query:  985 DICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIET-------ITSQCA---LNQFQ-----CQGGRCQELDNNNYECQ-------CLRGF-----IRSENGRSCIKAER--------------------TRNSTS-ICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCA---SGNCVNDRCICG-PGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFC 2799
            D CQ+  I   C+GG+C++    Y C C   ++     Q+C                S   ++C+GG C +    Y C C  GF  + +  RCI           I  +CA     QF      C+ GRC  +      C        C+ G         E G   ++  R                    T N T  IC+L+ + CQ G C P  P  Y C C  GY Q + R  CI  ++          S  C  G CV+   SY C CH  Y S+   Q C+   +     V          +C+ G CV+T  ++ C C  G+  T +G+ C   ++  T              + C+ G CI ++   FKC+C PGF  A +GR C    VD+C     IC  GRC  +  S FRC C    ++  DG  C+  ++ +      C   + +  CA    G      C C  P +   E  + C                             ++  C +G   + +GR            + C L+ E C  GIC  + +  Y C C LGY+     K+C+ +D  +CAVN   C  G C +    Y C C   Y         + KI +    DI+E +  NP     C
Sbjct:  217 DECQA--IPGLCQGGTCINTVGSYECKCPAGHKQSETSQKCEDIDEC----------STIPNVCDGGECTNTAGSYVCVCPRGFTTSRDGSRCIDQRVGSCFSALIGGRCAGELPGQFTKAHCCCESGRCWAIGQIPEMCPVRGSGKLCIEGLPLGPGFGPEVGPGDMRPVRPGPGGPNGPELLPGLSTGTATLNQTGDICKLFTNLCQNGRCIPT-PASYRCECNMGYKQ-DSRLECIDVDECS--------SSPCIHGDCVNTPGSYHCRCHEGYQSNPTKQACIDIDECIMNGV----------MCRNGRCVNTEGSFQCICNAGFETTPDGKNCVDHDECAT-------------TNMCLNGMCI-NEDGSFKCICKPGFVLAPNGRYC--VDVDEC-QTPGICMNGRCINTEGS-FRCECLGGLTIGIDGRVCVDTHMRST-----CYGAIKKGTCARPFPGAVTKSECCCASPDHGFGEPCQPCPAKNSAE----------------------FQALCSSGIGITADGR----------DINECALNSEICPNGICENL-RGSYRCICNLGYESDASGKNCVDVD--ECAVNRLLCDNGLCRNTPGSYTCTCPKGY---------VFKIDSETCEDINECA-SNPCVNGVC 773          

HSP 6 Score: 107.457 bits (267), Expect = 1.113e-22
Identity = 209/874 (23.91%), Postives = 327/874 (37.41%), Query Frame = 1
Query:  460 LSKEECCSIFQV--AWGNPCVFCDRNYCPK----------GFTQ--KENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGF-IRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC--------VRYKQTEP------PA-------VRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLS------KDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICDLHREK----------CKTG--------ICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            ++K+ CC  + +  AW  PC  C     P+          GF    +  +  DIDEC +  +IC NG CIN+ GSFRC+CP     +   + C+   D+C    + C     C+    G Y C C   Y +S +G +C+ +   N C     +C  +G C     SY C C +GF  S D+  C+     D        + C  G+C +    Y CLC   ++  +N+ +C+       LV +         +C  G C++    + C C EG+  T + + C+ I   TS        C  G CQ L+ + + C C  GF ++++N   CI         +IC L+G    T       P  + C C  G+  S++ + C   +  + +C  +  + +C   +   N    RC C  K      G  C        V +++  P      P        V  CS  E   +C  G C++T+ ++ C+C  GY     G  C   ++     P             C  G C  +   GF+C C  GF     G     E +++C N   +    RC  +  S + C CP   +L       KD   C       E     C  L+    C          IC PG +   DG+ C    +  +   +                +Y+C C  G+  S +G  C+ +        + +++C L              C +G        IC   G   +   C  G   ATD +     D  +C V    CK G C + +  + C C   YT    G  C         VD+ E + Q+P+  +F              C   +  YQC CP  +
Sbjct: 1663 MTKKMCCCSYNIGKAWNKPCEPCPSPATPEYIFLCGNQAPGFIIDIRTGKPMDIDECSEIPAICSNGVCINQIGSFRCECPMGFSYNNILLICE-DIDECSSGENLCQRNADCI-NIPGSYRCECSSGYKLSPSG-ACVGR---NECQEIPNVC-SHGTCMDTEGSYICVCHNGFKASGDQTMCMDIDECD-------RQPCGNGTCKNTVGSYNCLCFPGFELTHNN-DCMDIDECYSLVGQ---------VCRNGQCINNVGSFQCLCQEGYEITPDGKNCMDINECTSL----PGTCSPGTCQNLEGS-FRCICPPGFEVQNDN---CIDINECDEEPNIC-LFGTCTNT-------PGSFQCVCPPGFVLSDNGRRCF--DTRQSFCFTRFDNGKCSVPK-AFNTTKARCCCS-KMPGEGWGDPCELCPQEGSVAFQELCPYGHGSIPGMGDTREDVNECS--ESPGICVNGVCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNP-------------CGNGTC-SNVVGGFECTCDEGFEP---GPMMTCEDINECTNP--LLCAFRCINTYGS-YECTCPSGYTLREDRRMCKDLDECAEGLHDCESRGMMCKNLIGTFMC----------ICPPGMQRRPDGEGCMDENECRTKPGICVNGRCVNTV-----GSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQLSSTNRNMVTKSECCCNSGRGWGNQCEICPLPGTGAFKKMCPHGPGFATDGR-----DIDECKVLPNLCKNGQCINTIGSFRCHCKLGYTTDITGTTC---------VDLDECA-QSPKPCNF-------------ICKNTEGSYQCSCPRGY 2427          

HSP 7 Score: 105.531 bits (262), Expect = 4.060e-22
Identity = 212/907 (23.37%), Postives = 334/907 (36.82%), Query Frame = 1
Query:  346 KCICESGYFGEDC--NTAIISTCYVK---IDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQK--ENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC----------QYRRDQCQLYGSSCGIFGKCVPTSDGQYTCIC----IKPY-SVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKS---EYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEK-QVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGR------DCILKIIAVKSV---------DISEVSYQNPQSQSFCTRKEIIEKCQP-----GKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            +CIC  GY  +    N   +  C V     D GLC++TP +   +                       CPKG+  K     C+DI+EC   + C+NG C N  GSF C+C     LD     C            +  +C++  +   +  +C  T    +   C    I P     ++ K  +   + N C  F  +C P G C     S+ C CP G       ++C V+   + C      + C   +    GK            Y  D  C   G +  +    C K    E+ +LC  G       D        FY   N            +C +    C  G C+     ++ C C  GF      R+C   +  R S  +C   GH    G C    P  + C C +GY   E     +KN    D C+   +   CRGG C++   S+ C+C   +  ++ G  CV   +        CS  +  +LC+ G C++    Y C C +G+ +T + + C  I++  +     +++C   E                 ++C C  G+    D RSC    +D+C +N +IC  G+C       +RC+C      S D  +C+            CD+  N   C  G C N +    C C  GY   +    C  I++      +    C           +++CQC  G++   +G +C+  +    +   C+ +     T          Y CAC  G+    +    I  D  +CA N   C+ G+C +   GY C C   +T TE+ +      +C  + I V             I +  Y+  +S   CT  ++ E   P     G CV    +Y C CP  F+ N     CV
Sbjct:  699 RCICNLGYESDASGKNCVDVDECAVNRLLCDNGLCRNTPGSYTCT-----------------------CPKGYVFKIDSETCEDINECA-SNPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPRGYSRKKGVACEDVNECEVFPGVC-PNGRCVNTAGSFKCECPEGLTLDGSGRNC-VDVRVEQCYMKWDEDEC---TAQLPGK------------YRMDMCCCSVGAAWGIDCEECPKPGSDEFKALCPRGPGFANRGDVLS--GRPFYKDVN------------ECKVFNSLCTHGTCRN-SIGSFRCVCDSGFALDAEERNCTDIDECRISPDLC---GH----GTCVNT-PGSFDCECFDGY---ESGFMMMKNCMDIDECERDPL--LCRGGTCINTDGSFECICPPGHELTSEGNACVDINE--------CSLSD--NLCRNGRCINMIGTYQCSCDSGFQSTPDRQGCVDIDECTIMNGGCDTHCTNSEG---------------SYECSCSEGYALMPDQRSC--ADIDECEDNPDICDGGQCTNI-PGEYRCLCFDGFMASLDMKTCI--------DVNECDL--NPNICLHGECENTKGSFICHCQLGYFVKKGTTGCTDIDECE----VGAHNCDVHASCLNVPGSFKCQCQTGWVG--DGLNCVDLDECTTEDHKCNANANCVNT-------PGSYRCACNEGF----NGDGFICSDVDECADNVNLCENGHCLNAPGGYRCECEMGFTPTEDSKACQDIDECTFQNICVFGTCQNLPGMFRCICDDGYELDRSGGNCT--DVNECADPVNCINGLCVNTPGNYLCNCPQDFELNPTGVGCV 1479          

HSP 8 Score: 104.76 bits (260), Expect = 6.146e-22
Identity = 224/926 (24.19%), Postives = 342/926 (36.93%), Query Frame = 1
Query:  526 RNYCPKGFTQKENR--CDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGF----------------------IRSENGRSC---IKAERTRNST--SICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGR------------------CIGDKTYGFKCLC---LPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGK-----ECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYD----HECVRDSNKCPYCFYGCFDENSISTCSC------SENYENLFDT--GLCIIKSDEISYSLGDSTCRTKS 3087
            R  C  GF    +   C D++EC    +ICL+GEC N KGSF C C   +++ + T  C    D+C++   +C +   C+    G + C C   +    +G +C+   + + C      C     C     SY C+C  GF+   D   C     SD+ +  +    C  G C++   GYRC C   +    + + C               +  + ++C  G+C +L   + C C +G+    +   C  +    ++CA +   C  G C     N Y C C + F                       R + G SC   I    TR S   S+   +G+ C+   C      EY   C  G     +    I     +D  + QE+   C+GG CV+   S++C C   Y  +   + C    +        CS   +  +C  G C +T  NY C C   Y     G  C  + K V     N  C  +  LS  M  +                  C    T  +  LC    PGF    D R+  P  +D+C     IC+ G C     S FRC CP   S +        N +        C    N  +  + +C+N     RC C  GYK S  G      EC +I  V S            G     + +Y C C NG+  S +   C+  +        CD  R+ C  G C       Y C C  G+ + T    C+ +D     V +  C+ G C + V  + C+C   Y +T +G++C+         DI+E +              +   C PG C   +  ++C CP  F+    +    +EC  + N C   F  C +      C C      S+N    FDT    C  + D    S+  +   TK+
Sbjct: 1214 RCLCFDGFMASLDMKTCIDVNECDLNPNICLHGECENTKGSFICHCQLGYFVKKGTTGCT-DIDECEVGAHNCDVHASCL-NVPGSFKCQCQTGWV--GDGLNCV---DLDECTTEDHKCNANANCVNTPGSYRCACNEGFNG--DGFIC-----SDVDECADNVNLCENGHCLNAPGGYRCECEMGFTPTEDSKACQDI-----------DECTFQNICVFGTCQNLPGMFRCICDDGYELDRSGGNCTDV----NECA-DPVNCINGLCVNTPGN-YLCNCPQDFELNPTGVGCVDTRVGNCFLETQPRGDGGLSCSAEIGVGVTRASCCCSLGRAWGNPCE--FCPFANSTEYKTLCPGGEGFRPNPITVI----LEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICEDIDE--------CSA--HIGICGPGTCYNTLGNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNYNDTC--ENELSSNMTKKMCCCSYNIGKAWNKPCEPCPSPATPEYIFLCGNQAPGFII--DIRTGKPMDIDECSEIPAICSNGVCINQIGS-FRCECPMGFSYN--------NILLICEDIDECSSGENLCQ-RNADCINIPGSYRCECSSGYKLSPSGACVGRNECQEIPNVCS-----------HGTCMDTEGSYICVCHNGFKASGDQTMCMDIDE-------CD--RQPCGNGTCKNT-VGSYNCLCFPGF-ELTHNNDCMDIDECYSLVGQV-CRNGQCINNVGSFQCLCQEGYEITPDGKNCM---------DINECT-------------SLPGTCSPGTCQNLEGSFRCICPPGFEVQNDNCIDINECDEEPNIC--LFGTCTNTPGSFQCVCPPGFVLSDNGRRCFDTRQSFCFTRFDNGKCSVPKAFNTTKA 2031          

HSP 9 Score: 97.0561 bits (240), Expect = 1.716e-19
Identity = 208/875 (23.77%), Postives = 332/875 (37.94%), Query Frame = 1
Query:  532 YCPKGF-TQKENRCDDIDEC--QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTS----DGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNS--------DICQSPEIAERCRGGSCVS----EGKGYRC-LCNGEYQGYNNDQECVRYG-TSEPLVSRYCSK----SEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ--TEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKC---------SRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDK--------TYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQND---YICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY-----CFYGCFDENSISTCSCSENY 3000
             C  GF     N C DIDEC      +C NG+CIN  GSF+C C   + +  +  +C    +   L G+       C P +    +G + CIC  P        +CI   + N C+    +CL +G C     S+ C CP GF  S++ + C     S          C  P+     +   C S    EG G  C LC    +G    QE   YG  S P +          SE   +C  G C++ +  + C+C  G+        C+     T +C++    C  G C  +    +EC C  GF       +C       N      L   RC            Y C C  GY+  EDR+ C    +  D C         RG  C +   ++ C+C        +G+ C+   +  T+P             +C  G CV+T  +Y C C  G+  + +G +C         + + + + +    +  ++ +    C  GR  G++        T  FK +C  G   A+DGR      +D+C    N+C  G+C  +  S FRC C    +    G +C ++      + K C+ +      +       +C C  GY   EDGK C  +++ S+     Q  C           ++ C+C  G+ + ++  SCI +     + S+C         G+C    QN+   + C C  G+   +   +C  +D  +C  N +RC+ G C +++ G+ C C   Y        C         VD +E + Q+               C    C      ++C CP  F  +     C +D ++C       C YGC + +    C C   Y
Sbjct: 1865 LCFPGFELTHNNDCMDIDECYSLVGQVCRNGQCINNVGSFQCLCQEGYEITPDGKNCMDINECTSLPGT-------CSPGTCQNLEGSFRCIC--PPGFEVQNDNCI---DINECDEEPNICL-FGTCTNTPGSFQCVCPPGFVLSDNGRRCFDTRQSFCFTRFDNGKCSVPKAFNTTKARCCCSKMPGEGWGDPCELC--PQEGSVAFQELCPYGHGSIPGMGDTREDVNECSESPGICVNGVCINTDGSFRCECPFGYNLDYTGVNCVD----TDECSIGN-PCGNGTCSNV-VGGFECTCDEGFEPGPM-MTCEDINECTNPL----LCAFRCINTY------GSYECTCPSGYTLREDRRMC----KDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMQRRPDGEGCMDENECRTKP------------GICVNGRCVNTVGSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQLSSTNRNMVTKSECCCNSGRGWGNQCEICPLPGTGAFKKMCPHGPGFATDGRD-----IDECKVLPNLCKNGQCINTIGS-FRCHCKLGYTTDITGTTC-VDLDECAQSPKPCNFICKNTEGSY------QCSCPRGYILQEDGKTCKDLDECSTKQHNCQFLCVNTI------GSFNCKCPPGFTQHQS--SCIDNNECSSQPSLCG------SRGVC----QNNPGSFTCECQKGFSLDSSGSNCEDVD--ECDGN-HRCQHG-CQNVLGGFRCGCPQGYVQHYQWNQC---------VDENECTSQS--------------TCGSASCYNTLGSFKCVCPSGFDFDQSFGGC-QDVDECSSGGGNPCSYGCSNTDGGYLCGCPGGY 2632          

HSP 10 Score: 94.7449 bits (234), Expect = 7.102e-19
Identity = 177/741 (23.89%), Postives = 267/741 (36.03%), Query Frame = 1
Query:  346 KCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECC--SIFQVAWGNPCVFCDRN-------YCPKGFTQKENRCD---DIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERC--RGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRY---KQTEPPAVRLCSKWEYYSLC----------QGGECVD-----TXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNS---NFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGR 2433
            +C+C  G+     G  C     S C+ + D G C S P+    +K  CC   +    WG+PC  C +         CP G        D   D++EC +   IC+NG CIN  GSFRC+CP  + LD   ++C    D+C + G+ CG  G C     G + C C +     F     +   + N C     L   +     YG SY C+CPSG+   ED++ C      D+ +  E    C  RG  C +    + C+C    Q   + + C+                    +C  G CV+    Y C C+EGF  + +   C+          + Q  CQ                    + S N     K+E   NS      +G++C+  +C       +   C  G   + D          +D  + + +   C+ GQC++   S+RC C   Y +   G  CV      Q+  P   +C   E    C           G  C D     T  +           + N +      +  +   DN+ C  Q  L    G R +     G F C C  GF+  S G +C  E VD+C  N       RC+    +    FRC CP         + C+     T  +T           C S +C N     +C+C  G+   +    C  +++ SS                  D  Y C C  GY ++  G 
Sbjct: 1987 QCVCPPGFVLSDNGRRCFDTRQSFCFTRFDNGKC-SVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGSVAFQELCPYGHGSIPGMGDTREDVNECSESPGICVNGVCINTDGSFRCECPFGYNLDYTGVNC-VDTDECSI-GNPCG-NGTCSNVVGG-FECTCDE----GFEPGPMMTCEDINECT--NPLLCAFRCINTYG-SYECTCPSGYTLREDRRMC-----KDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMQRRPDGEGCMDENECR----------TKPGICVNGRCVNTVGSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQ--------------------LSSTNRNMVTKSECCCNSG---RGWGNQCE--ICPLPGTGAFKKMCPHGPGFATDG---------RDIDECKVLPNLCKNGQCINTIGSFRCHCKLGYTTDITGTTCVDLDECAQSPKPCNFICKNTEGSYQCSCPRGYILQEDGKTCKDLDECSTKQHNCQFLCVNTIGSFNCKCPPGFTQHQSSCIDNNECSSQPSLC---GSRGVCQNNPGSFTCECQKGFSLDSSGSNC--EDVDECDGNH------RCQHGCQNVLGGFRCGCPQGYVQHYQWNQCVDENECTSQST-----------CGSASCYNTLGSFKCVCPSGFDFDQSFGGCQDVDECSS-----GGGNPCSYGCSNTDGGYLCGCPGGYFRAGQGH 2639          

HSP 11 Score: 90.8929 bits (224), Expect = 1.268e-17
Identity = 189/787 (24.02%), Postives = 299/787 (37.99%), Query Frame = 1
Query:  346 KCICESGYFGEDCNTAIISTCYVKIDR----GLCKSTPENLQLS--------------KEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSC----VSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERT---RNSTSIC--ELYGHRCQTGVC-----------------YPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQ-GGECVDTXXXXXXXXXXXXXATENGRKCSRIE-KQVTEEPDNSYCLLQE--YLSRCMGG-RCIGDKTY----------------------GFKCLCLPGFTSASDGRSCDPEYVDQCLN-NENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL 2460
            KC C++G+ G+  N   +  C  +  +      C +TP + + +               +EC     +     C+     Y   C  GFT  E+   C DIDEC F++IC+ G C N  G FRC C   + LD +  +C    D  +       I G CV T  G Y C C + + ++  G  C+     N           + E QP G     SC +       + SC  +             R  G  C     +    Y+ LC G         E  R      ++       E   LC+GG+CV+    + C+C  G+Y  E  R C  I+    +C+ +   C  G C      NY C C   +++   G +C+   ++   RN    C  EL  +  +   C                  P  P EYI  C    +Q+      I+  +  D  +  EI   C  G C++   S+RC C   +  +N    C    +        CS  E  +LCQ   +C++   +Y C+C +GY  + +G    R E +++     +  C+  E  Y+  C  G +  GD+T                        + CLC PGF    +    D   +D+C +    +C  G+C  +  S F+C+C     ++ DG +C+ IN  T+ P T           C+ G C N     RCIC PG++   D   C  I +        +      G       +++C C  G++ S+NGR C  +  + 
Sbjct: 1299 KCQCQTGWVGDGLNCVDLDECTTEDHKCNANANCVNTPGSYRCACNEGFNGDGFICSDVDECADNVNLCENGHCLNAPGGYRCECEMGFTPTEDSKACQDIDECTFQNICVFGTCQNLPGMFRCICDDGYELDRSGGNCT---DVNECADPVNCINGLCVNTP-GNYLCNCPQDFELNPTGVGCVDTRVGNC----------FLETQPRGDGGL-SCSAEIGVGVTRASCCCSLG-----------RAWGNPCEFCPFANSTEYKTLCPG--------GEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICEDID----ECSAHIGICGPGTCYNT-LGNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNYNDTCENELSSNMTKKMCCCSYNIGKAWNKPCEPCPSPATP-EYIFLC---GNQAPGFIIDIRTGKPMDIDECSEIPAICSNGVCINQIGSFRCECPMGFSYNNILLICEDIDE--------CSSGE--NLCQRNADCINIPGSYRCECSSGYKLSPSGACVGRNECQEIPNVCSHGTCMDTEGSYICVCHNGFKASGDQTMCMDIDECDRQPCGNGTCKNTVGSYNCLCFPGFELTHNNDCMD---IDECYSLVGQVCRNGQCINNVGS-FQCLCQEGYEITPDGKNCMDINECTSLPGT-----------CSPGTCQNLEGSFRCICPPGFEVQND--NCIDINECDE-----EPNICLFGTCTNTPGSFQCVCPPGFVLSDNGRRCFDTRQSF 2010          

HSP 12 Score: 61.2326 bits (147), Expect = 1.168e-8
Identity = 108/427 (25.29%), Postives = 157/427 (36.77%), Query Frame = 1
Query:  310 NNCSNK-GQCQNGKCICESGYFGEDCN---------TAIIST----CYVKIDRGLCKSTPENLQL-SKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQ-FKSICLNGECINEKGSF-----------------------------------------RCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGR 1398
            N C  K G C NG+C+   G +  DCN         T  + T    C+ ++ + +C+ +  N  + +K ECC      WGN C  C        +  CP G     +   DIDEC+   ++C NG+CIN  GSF                                         +C CP  + L E+  +C+   D+C     +C     CV T  G + C C  P   + +  SCI     N C+    LC   G CQ    S+ C C  GF       +C    + D C       RC+ G C +   G+RC C   Y  +    +CV             ++    S C   SC +    + C C  GF   ++   C  ++  +S        C  G C   D   Y C C  G+ R+  G 
Sbjct: 2246 NECRTKPGICVNGRCVNTVGSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQLSSTNRNMVTKSECCCNSGRGWGNQCEICPLPGTGAFKKMCPHGPGFATDG-RDIDECKVLPNLCKNGQCINTIGSFRCHCKLGYTTDITGTTCVDLDECAQSPKPCNFICKNTEGSYQCSCPRGYILQEDGKTCK-DLDECSTKQHNCQFL--CVNTI-GSFNCKC--PPGFTQHQSSCIDN---NECSSQPSLCGSRGVCQNNPGSFTCECQKGFSLDSSGSNC---EDVDECDG---NHRCQHG-CQNVLGGFRCGCPQGYVQHYQWNQCVDE-----------NECTSQSTCGSASCYNTLGSFKCVCPSGFDFDQSFGGCQDVDECSSG---GGNPCSYG-CSNTD-GGYLCGCPGGYFRAGQGH 2639          

HSP 13 Score: 59.6918 bits (143), Expect = 3.324e-8
Identity = 118/518 (22.78%), Postives = 188/518 (36.29%), Query Frame = 1
Query: 1405 IKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGF---KCLCLPG--FTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTT-----KYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            I   +T    +I   +GH C+     P  PN     C  G+  +      I+    +D  + Q I   C+GG C++   SY C C   +  S   Q+C    +        CS     ++C GGEC +T  +Y C C  G+  + +G +C  I+++V               S  +GGRC G+    F    C C  G  +        C      +         PG     G  + R   P            L+  ++T   T       C +  N   C +G C+      RC C  GYK  +   EC  +++ SS            G       +Y C+C  GY  +   ++CI  +  ++   +C       + G C    +  + C C  G++   D K+C+  D+ +CA     C  G C +    + CIC   + +  NGR C         VD+ E   Q P              C  G+C+  +  ++C+C            CV
Sbjct:  171 IVCTKTLCCATIGRAWGHPCEM---CPAQPN----PCRRGFIPN------IRTGACQDVDECQAIPGLCQGGTCINTVGSYECKCPAGHKQSETSQKCEDIDE--------CSTIP--NVCDGGECTNTAGSYVCVCPRGFTTSRDGSRC--IDQRVGS-----------CFSALIGGRCAGELPGQFTKAHCCCESGRCWAIGQIPEMCPVRGSGKLCIEGLPLGPGFGPEVGPGDMR---PVRPGPGGPNGPELLPGLSTGTATLNQTGDICKLFTNL--CQNGRCIPTPASYRCECNMGYKQ-DSRLECIDVDECSS-------SPCIHGDCVNTPGSYHCRCHEGYQSNPTKQACIDIDECIMNGVMC-------RNGRCVNT-EGSFQCICNAGFETTPDGKNCV--DHDECATTNM-CLNGMCINEDGSFKCICKPGFVLAPNGRYC---------VDVDEC--QTPG------------ICMNGRCINTEGSFRCECLGGLTIGIDGRVCV 605          
BLAST of Fibrillin-2 vs. Ensembl Xenopus
Match: FBN3 (fibrillin 3 [Source:NCBI gene;Acc:100151721])

HSP 1 Score: 156.377 bits (394), Expect = 9.343e-38
Identity = 229/986 (23.23%), Postives = 362/986 (36.71%), Query Frame = 1
Query:   25 FSFFRDKLMIFLIFLFYFDTILWNHIVVASICDYSDNGEPLCCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLP--YGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSE--------YYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKC----------SRIEKQVTEEPDNSYCLLQE---------YLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICD-----------LHREKCKT-GICY--PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            F+   D+L+   +     DT+   ++  +    Y       CC GW     G+ C+   C   CG G C   N+C C +  + T  C       C   C N G C    C C+ GY G  C   I                                    C+ +I   +C+     +  +K  CC+    AWG+PC  C    N C +GF    +   C D+DECQ    +C  G CIN  GS+ C+CP  H   E +  C+   D+C    + C   G+C  T+ G Y C+C + ++ S +G  CI +    V + F  L      GE        +C C SG       +   +    ++C      + C  G  +  G G   +  G+ +               P +S   +           + +LC+ G C+     Y C+C+ G Y  ++R  CI ++  +S        C  G C     + Y C+C  G+  +   ++CI  +        C + G  C+ G C       + C C  G+  + D K C+ +++          +  C  G C++   S++C+C   ++ + NG+ CV   + + P +           C  G C++T  ++ C+C  G     +GR C            I+K     P        E         +   C    C    +  F+ LC  G    +DGR      +++C  N  IC  G CE    S +RC+C         G +C+             +  VNRL C +G C N      C C  GY    D + C  I + +S            G    +  ++ C+C  G      G  C+ S       +I D           L  E C T G  +  P  + +   AC  GY +   KK     D  +C V    C  G C +    + C C    T+  +GR+C+
Sbjct:   27 FAGQEDRLIPQRVRRRGQDTLRGPNVCGSRFHSY-------CCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSNGQLST-NCGAGIVMNCNVRCMNGGSCNEDSCTCQKGYTGTHCGQPICENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQISNQMCQGQLSGIVCTKTLCCATIGRAWGHPCEMCPAQPNPCRRGFIPNIRTGACQDVDECQAIPGLCQGGTCINTVGSYECKCPAGHKQSETSQKCE-DIDECSTIPNVCD-GGECTNTA-GSYVCVCPRGFTTSRDGSRCIDQ---RVGSCFSALIGGRCAGELPGQFTKAHCCCESG-------RCWAIGQIPEMCPVRGSGKLCIEGLPLGPGFGPE-VGPGDMRPVRPGPGGPNGPELLPGLSTGTATLNQTGDICKLFTNLCQNGRCIPTPASYRCECNMG-YKQDSRLECIDVDECSSS------PCIHGDCVNTPGS-YHCRCHEGYQSNPTKQACIDIDE-------CIMNGVMCRNGRCVNTE-GSFQCICNAGFETTPDGKNCVDHDECA-------TTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCVDVDECQTPGI-----------CMNGRCINTEGSFRCECLGGLTIGIDGRVCVDTHMRSTCYGAIKKGTCARPFPGAVTKSECCCASPDHGFGEPCQ--PCPAKNSAEFQALCSSGIGITADGRD-----INECALNSEICPNGICENLRGS-YRCICNLGYESDASGKNCV----------DVDECAVNRLLCDNGLCRNTPGSYTCTCPKGYVFKIDSETCEDINECAS-------NPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPRGYSR---KKGVACEDVNECEVFPGVCPNGRCVNTAGSFKCECPEGLTLDGSGRNCV 928          

HSP 2 Score: 151.369 bits (381), Expect = 4.201e-36
Identity = 235/990 (23.74%), Postives = 361/990 (36.46%), Query Frame = 1
Query:  253 YDKTIRTETCPQNNQKLCTNNCSNKGQCQN--GKCICESGY------FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-YCPKGFTQKEN-RCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-----------------------QYRRDQCQL-YGSSCGIF-GKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNY---NVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI-----------------VNSNSDI-----------------CQSPEIAER----CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVR-------LCSKWEYYSLCQGG------ECVDTXXXXXXXXXXXXXA----TENGRKCS---------RIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKS--ICDLHRE---KCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            Y   I +ETC   N+  C +N    G C+N  G  +CE  +       G  C  ++  TC++ I  G C+       L K ECC+    AWG+PC  C+ +  CP+G+++K+   C+D++EC+ F  +C NG C+N  GSF+C+CP    LD +  +C                       +YR D C    G++ GI   +C      ++  +C +    +  G     +  Y   N C  F  LC  +G C+    S+ C C SGF    ++++C                  VN+                     C   +  ER    CRGG+C++    + C+C   ++  +    CV            CS S+  +LC  G C+++   Y C C  GF +T +R+ C+ I+  T         C           +YEC C  G+    + RSC   +   ++  IC+  G +C         P EY C C +G+  S D K CI   +      N  I   C  G+C +   S+ C C   Y        C    + E  A         L     +   CQ G       CVD +            A    T    +C+          I   V E  DN        ++ C  G C+ +   G++C C  GFT   D ++C  + +D+C   +NIC  G C+      FRC+C     L + G +C       +P           + C +G CVN      C C   ++ +  G  C      +                           L    + + G SC       + ++   C L R     C+   C      +Y   C  G     +  + I+ D  +C      C+GG C +    + C C   Y + E  R C          DI E S               I  C PG C     +Y C CP  +
Sbjct:  773 YVFKIDSETCEDINE--CASNPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATL-KSECCATLGAAWGSPCERCEIDPACPRGYSRKKGVACEDVNECEVFPGVCPNGRCVNTAGSFKCECPEGLTLDGSGRNCVDVRVEQCYMKWDEDECTAQLPGKYRMDMCCCSVGAAWGIDCEECPKPGSDEFKALCPRGPGFANRGDVLSGRPFYKDVNECKVFNSLCT-HGTCRNSIGSFRCVCDSGFALDAEERNCTDIDECRISPDLCGHGTCVNTPGSFDCECFDGYESGFMMMKNCMDIDECERDPLLCRGGTCINTDGSFECICPPGHELTSEGNACVDI--------NECSLSD--NLCRNGRCINMIGTYQCSCDSGFQSTPDRQGCVDIDECTIMNGGCDTHCTNSE------GSYECSCSEGYALMPDQRSCADIDECEDNPDICD--GGQCTN------IPGEYRCLCFDGFMASLDMKTCIDVNECD---LNPNI---CLHGECENTKGSFICHCQLGYFVKKGTTGCTDIDECEVGAHNCDVHASCLNVPGSFKCQCQTGWVGDGLNCVDLDECTTEDHKCNANANCVNTPGSYRCACNEGFNGDGFICSDVDECADN--------VNLCENGHCL-NAPGGYRCECEMGFTPTEDSKAC--QDIDEC-TFQNICVFGTCQNLPGM-FRCICDDGYELDRSGGNCTDVNECADP-----------VNCINGLCVNTPGNYLCNCPQDFELNPTGVGCVDTRVGNCF-------------------------LETQPRGDGGLSCSAEIGVGVTRASCCCSLGRAWGNPCE--FCPFANSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRIC---------EDIDECSAH-------------IGICGPGTCYNTLGNYTCVCPPEY 1655          

HSP 3 Score: 130.183 bits (326), Expect = 1.075e-29
Identity = 230/968 (23.76%), Postives = 357/968 (36.88%), Query Frame = 1
Query:  307 TNNCSNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKI----DRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSC--------IVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQ-GGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSL----CQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCA---SGNCVNDRCICG--PGYKSSEDGKECYKIEKVS----------SIXXXXXXXXXXXXXXXXD-----------DNNYECQCLNGYIKSENGRSCIKSESALIKKS---------------ICDLHREKCKTGICYPIGQ---------------NDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
             N C++   C NG C+   G +             G  C    +  C+++     D GL  S    + +++  CC     AWGNPC FC        +  CP G   + N      +DIDECQ    +C  G C+N  GSF+C+CP  +YL+E T  C+   D+C  +   CG  G C  T  G YTC+C   Y     G +C+        +  K +C           +Y  +C +    +  KK C          N   + C SP   E             Y  LC  +  G+  D   +R  T +P+    CS  E  ++C  G C++    + C+C  GF        C  I+    +C+  +  CQ    C  +  + Y C+C  G+  S +G    + E        C+   + C  G C       YIC C  G+  S D+  C+      D C  Q     C  G C +   SY C+C   +  ++N  +C+                E YSL    C+ G+C++   ++ C C  GY  T +G+ C  I  + T  P             C  G C  +    F+C+C PGF   +D    +   +++C    NIC  G C  +  S F+CVCP    LS +G  C       +    +C    +  +C+   + N    RC C   PG    +  + C +   V+          SI  +   +     C E             D ++ C+C  GY     G +C+ ++   I                   CD   E      C  I +                 Y C C  GY    D++ C  +D     +++   +G  C +++  ++CIC        +G  C+                     ++ C  K  I  C  G+CV     Y+C C   F+ +    ECV
Sbjct: 1465 VNECADPVNCINGLCVNTPGNYLCNCPQDFELNPTGVGCVDTRVGNCFLETQPRGDGGLSCSAEIGVGVTRASCCCSLGRAWGNPCEFCPFANSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICE-DIDECSAHIGICGP-GTCYNTL-GNYTCVCPPEYMQVNGGNNCM--------DMRKSVCY---------RNYNDTCENELSSNMTKKMCCCSYNIGKAWNKPCEPCPSPATPE-------------YIFLCGNQAPGFIID---IR--TGKPMDIDECS--EIPAICSNGVCINQIGSFRCECPMGFSYNNILLICEDID----ECSSGENLCQRNADCINIPGS-YRCECSSGYKLSPSGACVGRNE--------CQEIPNVCSHGTCMDTE-GSYICVCHNGFKASGDQTMCMD----IDECDRQP----CGNGTCKNTVGSYNCLCFPGFELTHN-NDCMDID-------------ECYSLVGQVCRNGQCINNVGSFQCLCQEGYEITPDGKNCMDI-NECTSLP-----------GTCSPGTCQ-NLEGSFRCICPPGFEVQND----NCIDINECDEEPNICLFGTCTNTPGS-FQCVCPPGFVLSDNGRRCF------DTRQSFCFTRFDNGKCSVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGSVAFQELCPYGHGSIPGMGDTREDVNECSESPGICVNGVCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCGNGTCSNVVGGFECTCDEGFEPGPMMTCEDINECTNPLLCAFRCINTYGSYECTCPSGYTLREDRRMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMQRRPDGEGCM--------------------DENECRTKPGI--CVNGRCVNTVGSYKCDCNEGFQVSSSGTECV 2310          

HSP 4 Score: 114.005 bits (284), Expect = 1.052e-24
Identity = 204/877 (23.26%), Postives = 329/877 (37.51%), Query Frame = 1
Query:  334 CQNGKCICESGYFGEDCNTAIISTCYVK-IDRGLCKSTP------------------ENLQ--------LSKEECCSIFQVAWGNPCVFCDRNY---CPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVC--NYFKKLCL-PY------GEC----QPYGLSYYCSCPSGFHQSEDKKSC-----IVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALN--------QFQCQGGRCQELDNNNYEC-QCLRG--FIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECV---------RYKQTEPPAVRLCSKWEYYSLC---QGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEP---DNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CQNG+CI     +  +CN        ++ ID   C S+P                  E  Q        +  +EC     +     CV  + ++   C  GF  T     C D DEC   ++CLNG CINE GSF+C C P   L  N   C    D+CQ  G    + G+C+ T +G + C C+   ++  +G+ C+     + C     K  C  P+       EC      +G    C      + +E +  C     I     DI +    +E C  G C +    YRC+CN  Y+   + + CV     E  V+R         LC+ G C +    Y C C +G+    +   C  I    S   +N         F C+     +LD+    C   ++G  ++  ++GR  +        +  C   G    +    P    E   AC  GYS+        K    +D  + +     C  G+CV+   S++C C        +G+ CV         ++ + E  A +L  K+     C        +D                  G   +     ++  P   D + C +  + S C  G C  +    F+C+C  GF   ++ R+C    +D+C  + ++C  G C  +  S F C C        DG+      +        C+   + L C  G C+N      CIC PG++ + +G  C  I + S   +L +               Y+C C +G+  + + + C+  +   I    CD H             +  Y C+C  GY    D++SC  +D  +C  N   C GG C +I   Y C+C   +  + + + CI
Sbjct:  437 CQNGRCIPTPASYRCECNMGYKQDSRLECIDVDECSSSPCIHGDCVNTPGSYHCRCHEGYQSNPTKQACIDIDECIMNGVMCRNGRCVNTEGSFQCICNAGFETTPDGKNCVDHDECATTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYC-VDVDECQTPGIC--MNGRCINT-EGSFRCECLGGLTIGIDGRVCVDTHMRSTCYGAIKKGTCARPFPGAVTKSECCCASPDHGFGEPCQPCPAKNSAEFQALCSSGIGITADGRDINECALNSEICPNGICENLRGSYRCICNLGYESDASGKNCVD--VDECAVNRL--------LCDNGLCRNTPGSYTCTCPKGYVFKIDSETCEDINECASNPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGS----PCERCEIDPACPRGYSRK-------KGVACEDVNECEVFPGVCPNGRCVNTAGSFKCECPEGLTLDGSGRNCVDVRVEQCYMKWDEDECTA-QLPGKYRMDMCCCSVGAAWGIDCEECPKPGSDEFKALCPRGPGFANRGDVLSGRPFYKDVNECKV--FNSLCTHGTCR-NSIGSFRCVCDSGFALDAEERNC--TDIDECRISPDLCGHGTCVNTPGS-FDCEC-------FDGYESGFMMMKNCMDIDECE--RDPLLCRGGTCINTDGSFECICPPGHELTSEGNACVDINECSLSDNLCRNGRCINMI-----GTYQCSCDSGFQSTPDRQGCVDIDECTIMNGGCDTHCTN---------SEGSYECSCSEGYALMPDQRSCADID--ECEDNPDICDGGQCTNIPGEYRCLCFDGFMASLDMKTCI 1256          

HSP 5 Score: 106.686 bits (265), Expect = 1.731e-22
Identity = 209/874 (23.91%), Postives = 327/874 (37.41%), Query Frame = 1
Query:  460 LSKEECCSIFQV--AWGNPCVFCDRNYCPK----------GFTQ--KENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGF-IRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC--------VRYKQTEP------PA-------VRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLS------KDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICDLHREK----------CKTG--------ICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            ++K+ CC  + +  AW  PC  C     P+          GF    +  +  DIDEC +  +IC NG CIN+ GSFRC+CP     +   + C+   D+C    + C     C+    G Y C C   Y +S +G +C+ +   N C     +C  +G C     SY C C +GF  S D+  C+     D        + C  G+C +    Y CLC   ++  +N+ +C+       LV +         +C  G C++    + C C EG+  T + + C+ I   TS        C  G CQ L+ + + C C  GF ++++N   CI         +IC L+G    T       P  + C C  G+  S++ + C   +  + +C  +  + +C   +   N    RC C  K      G  C        V +++  P      P        V  CS  E   +C  G C++T+ ++ C+C  GY     G  C   ++     P             C  G C  +   GF+C C  GF     G     E +++C N   +    RC  +  S + C CP   +L       KD   C       E     C  L+    C          IC PG +   DG+ C    +  +   +                +Y+C C  G+  S +G  C+ +        + +++C L              C +G        IC   G   +   C  G   ATD +     D  +C V    CK G C + +  + C C   YT    G  C         VD+ E + Q+P+  +F              C   +  YQC CP  +
Sbjct: 1688 MTKKMCCCSYNIGKAWNKPCEPCPSPATPEYIFLCGNQAPGFIIDIRTGKPMDIDECSEIPAICSNGVCINQIGSFRCECPMGFSYNNILLICE-DIDECSSGENLCQRNADCI-NIPGSYRCECSSGYKLSPSG-ACVGR---NECQEIPNVC-SHGTCMDTEGSYICVCHNGFKASGDQTMCMDIDECD-------RQPCGNGTCKNTVGSYNCLCFPGFELTHNN-DCMDIDECYSLVGQ---------VCRNGQCINNVGSFQCLCQEGYEITPDGKNCMDINECTSL----PGTCSPGTCQNLEGS-FRCICPPGFEVQNDN---CIDINECDEEPNIC-LFGTCTNT-------PGSFQCVCPPGFVLSDNGRRCF--DTRQSFCFTRFDNGKCSVPK-AFNTTKARCCCS-KMPGEGWGDPCELCPQEGSVAFQELCPYGHGSIPGMGDTREDVNECS--ESPGICVNGVCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNP-------------CGNGTC-SNVVGGFECTCDEGFEP---GPMMTCEDINECTNP--LLCAFRCINTYGS-YECTCPSGYTLREDRRMCKDLDECAEGLHDCESRGMMCKNLIGTFMC----------ICPPGMQRRPDGEGCMDENECRTKPGICVNGRCVNTV-----GSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQLSSTNRNMVTKSECCCNSGRGWGNQCEICPLPGTGAFKKMCPHGPGFATDGR-----DIDECKVLPNLCKNGQCINTIGSFRCHCKLGYTTDITGTTC---------VDLDECA-QSPKPCNF-------------ICKNTEGSYQCSCPRGY 2452          

HSP 6 Score: 105.145 bits (261), Expect = 5.423e-22
Identity = 212/907 (23.37%), Postives = 334/907 (36.82%), Query Frame = 1
Query:  346 KCICESGYFGEDC--NTAIISTCYVK---IDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQK--ENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC----------QYRRDQCQLYGSSCGIFGKCVPTSDGQYTCIC----IKPY-SVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKS---EYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEK-QVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGR------DCILKIIAVKSV---------DISEVSYQNPQSQSFCTRKEIIEKCQP-----GKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            +CIC  GY  +    N   +  C V     D GLC++TP +   +                       CPKG+  K     C+DI+EC   + C+NG C N  GSF C+C     LD     C            +  +C++  +   +  +C  T    +   C    I P     ++ K  +   + N C  F  +C P G C     S+ C CP G       ++C V+   + C      + C   +    GK            Y  D  C   G +  +    C K    E+ +LC  G       D        FY   N            +C +    C  G C+     ++ C C  GF      R+C   +  R S  +C   GH    G C    P  + C C +GY   E     +KN    D C+   +   CRGG C++   S+ C+C   +  ++ G  CV   +        CS  +  +LC+ G C++    Y C C +G+ +T + + C  I++  +     +++C   E                 ++C C  G+    D RSC    +D+C +N +IC  G+C       +RC+C      S D  +C+            CD+  N   C  G C N +    C C  GY   +    C  I++      +    C           +++CQC  G++   +G +C+  +    +   C+ +     T          Y CAC  G+    +    I  D  +CA N   C+ G+C +   GY C C   +T TE+ +      +C  + I V             I +  Y+  +S   CT  ++ E   P     G CV    +Y C CP  F+ N     CV
Sbjct:  724 RCICNLGYESDASGKNCVDVDECAVNRLLCDNGLCRNTPGSYTCT-----------------------CPKGYVFKIDSETCEDINECA-SNPCVNGVCRNNAGSFVCECSFGSKLDSTGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPRGYSRKKGVACEDVNECEVFPGVC-PNGRCVNTAGSFKCECPEGLTLDGSGRNC-VDVRVEQCYMKWDEDEC---TAQLPGK------------YRMDMCCCSVGAAWGIDCEECPKPGSDEFKALCPRGPGFANRGDVLS--GRPFYKDVN------------ECKVFNSLCTHGTCRN-SIGSFRCVCDSGFALDAEERNCTDIDECRISPDLC---GH----GTCVNT-PGSFDCECFDGY---ESGFMMMKNCMDIDECERDPL--LCRGGTCINTDGSFECICPPGHELTSEGNACVDINE--------CSLSD--NLCRNGRCINMIGTYQCSCDSGFQSTPDRQGCVDIDECTIMNGGCDTHCTNSEG---------------SYECSCSEGYALMPDQRSC--ADIDECEDNPDICDGGQCTNI-PGEYRCLCFDGFMASLDMKTCI--------DVNECDL--NPNICLHGECENTKGSFICHCQLGYFVKKGTTGCTDIDECE----VGAHNCDVHASCLNVPGSFKCQCQTGWVG--DGLNCVDLDECTTEDHKCNANANCVNT-------PGSYRCACNEGF----NGDGFICSDVDECADNVNLCENGHCLNAPGGYRCECEMGFTPTEDSKACQDIDECTFQNICVFGTCQNLPGMFRCICDDGYELDRSGGNCT--DVNECADPVNCINGLCVNTPGNYLCNCPQDFELNPTGVGCV 1504          

HSP 7 Score: 104.375 bits (259), Expect = 9.162e-22
Identity = 224/926 (24.19%), Postives = 342/926 (36.93%), Query Frame = 1
Query:  526 RNYCPKGFTQKENR--CDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGF----------------------IRSENGRSC---IKAERTRNST--SICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGR------------------CIGDKTYGFKCLC---LPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGK-----ECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYD----HECVRDSNKCPYCFYGCFDENSISTCSC------SENYENLFDT--GLCIIKSDEISYSLGDSTCRTKS 3087
            R  C  GF    +   C D++EC    +ICL+GEC N KGSF C C   +++ + T  C    D+C++   +C +   C+    G + C C   +    +G +C+   + + C      C     C     SY C+C  GF+   D   C     SD+ +  +    C  G C++   GYRC C   +    + + C               +  + ++C  G+C +L   + C C +G+    +   C  +    ++CA +   C  G C     N Y C C + F                       R + G SC   I    TR S   S+   +G+ C+   C      EY   C  G     +    I     +D  + QE+   C+GG CV+   S++C C   Y  +   + C    +        CS   +  +C  G C +T  NY C C   Y     G  C  + K V     N  C  +  LS  M  +                  C    T  +  LC    PGF    D R+  P  +D+C     IC+ G C     S FRC CP   S +        N +        C    N  +  + +C+N     RC C  GYK S  G      EC +I  V S            G     + +Y C C NG+  S +   C+  +        CD  R+ C  G C       Y C C  G+ + T    C+ +D     V +  C+ G C + V  + C+C   Y +T +G++C+         DI+E +              +   C PG C   +  ++C CP  F+    +    +EC  + N C   F  C +      C C      S+N    FDT    C  + D    S+  +   TK+
Sbjct: 1239 RCLCFDGFMASLDMKTCIDVNECDLNPNICLHGECENTKGSFICHCQLGYFVKKGTTGCT-DIDECEVGAHNCDVHASCL-NVPGSFKCQCQTGWV--GDGLNCV---DLDECTTEDHKCNANANCVNTPGSYRCACNEGFNG--DGFIC-----SDVDECADNVNLCENGHCLNAPGGYRCECEMGFTPTEDSKACQDI-----------DECTFQNICVFGTCQNLPGMFRCICDDGYELDRSGGNCTDV----NECA-DPVNCINGLCVNTPGN-YLCNCPQDFELNPTGVGCVDTRVGNCFLETQPRGDGGLSCSAEIGVGVTRASCCCSLGRAWGNPCE--FCPFANSTEYKTLCPGGEGFRPNPITVI----LEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICEDIDE--------CSA--HIGICGPGTCYNTLGNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNYNDTC--ENELSSNMTKKMCCCSYNIGKAWNKPCEPCPSPATPEYIFLCGNQAPGFII--DIRTGKPMDIDECSEIPAICSNGVCINQIGS-FRCECPMGFSYN--------NILLICEDIDECSSGENLCQ-RNADCINIPGSYRCECSSGYKLSPSGACVGRNECQEIPNVCS-----------HGTCMDTEGSYICVCHNGFKASGDQTMCMDIDE-------CD--RQPCGNGTCKNT-VGSYNCLCFPGF-ELTHNNDCMDIDECYSLVGQV-CRNGQCINNVGSFQCLCQEGYEITPDGKNCM---------DINECT-------------SLPGTCSPGTCQNLEGSFRCICPPGFEVQNDNCIDINECDEEPNIC--LFGTCTNTPGSFQCVCPPGFVLSDNGRRCFDTRQSFCFTRFDNGKCSVPKAFNTTKA 2056          

HSP 8 Score: 96.2857 bits (238), Expect = 2.411e-19
Identity = 208/875 (23.77%), Postives = 332/875 (37.94%), Query Frame = 1
Query:  532 YCPKGF-TQKENRCDDIDEC--QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTS----DGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNS--------DICQSPEIAERCRGGSCVS----EGKGYRC-LCNGEYQGYNNDQECVRYG-TSEPLVSRYCSK----SEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ--TEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKC---------SRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDK--------TYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQND---YICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY-----CFYGCFDENSISTCSCSENY 3000
             C  GF     N C DIDEC      +C NG+CIN  GSF+C C   + +  +  +C    +   L G+       C P +    +G + CIC  P        +CI   + N C+    +CL +G C     S+ C CP GF  S++ + C     S          C  P+     +   C S    EG G  C LC    +G    QE   YG  S P +          SE   +C  G C++ +  + C+C  G+        C+     T +C++    C  G C  +    +EC C  GF       +C       N      L   RC            Y C C  GY+  EDR+ C    +  D C         RG  C +   ++ C+C        +G+ C+   +  T+P             +C  G CV+T  +Y C C  G+  + +G +C         + + + + +    +  ++ +    C  GR  G++        T  FK +C  G   A+DGR      +D+C    N+C  G+C  +  S FRC C    +    G +C ++      + K C+ +      +       +C C  GY   EDGK C  +++ S+     Q  C           ++ C+C  G+ + ++  SCI +     + S+C         G+C    QN+   + C C  G+   +   +C  +D  +C  N +RC+ G C +++ G+ C C   Y        C         VD +E + Q+               C    C      ++C CP  F  +     C +D ++C       C YGC + +    C C   Y
Sbjct: 1890 LCFPGFELTHNNDCMDIDECYSLVGQVCRNGQCINNVGSFQCLCQEGYEITPDGKNCMDINECTSLPGT-------CSPGTCQNLEGSFRCIC--PPGFEVQNDNCI---DINECDEEPNICL-FGTCTNTPGSFQCVCPPGFVLSDNGRRCFDTRQSFCFTRFDNGKCSVPKAFNTTKARCCCSKMPGEGWGDPCELC--PQEGSVAFQELCPYGHGSIPGMGDTREDVNECSESPGICVNGVCINTDGSFRCECPFGYNLDYTGVNCVD----TDECSIGN-PCGNGTCSNV-VGGFECTCDEGFEPGPM-MTCEDINECTNPL----LCAFRCINTY------GSYECTCPSGYTLREDRRMC----KDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMQRRPDGEGCMDENECRTKP------------GICVNGRCVNTVGSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQLSSTNRNMVTKSECCCNSGRGWGNQCEICPLPGTGAFKKMCPHGPGFATDGRD-----IDECKVLPNLCKNGQCINTIGS-FRCHCKLGYTTDITGTTC-VDLDECAQSPKPCNFICKNTEGSY------QCSCPRGYILQEDGKTCKDLDECSTKQHNCQFLCVNTI------GSFNCKCPPGFTQHQS--SCIDNNECSSQPSLCG------SRGVC----QNNPGSFTCECQKGFSLDSSGSNCEDVD--ECDGN-HRCQHG-CQNVLGGFRCGCPQGYVQHYQWNQC---------VDENECTSQS--------------TCGSASCYNTLGSFKCVCPSGFDFDQSFGGC-QDVDECSSGGGNPCSYGCSNTDGGYLCGCPGGY 2657          

HSP 9 Score: 94.3597 bits (233), Expect = 1.032e-18
Identity = 178/741 (24.02%), Postives = 268/741 (36.17%), Query Frame = 1
Query:  346 KCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECC--SIFQVAWGNPCVFCDRN-------YCPKGFTQKENRCD---DIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERC--RGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRY---KQTEPPAVRLCSKWEYYSLC----------QGGECVD-----TXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNS---NFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGR 2433
            +C+C  G+     G  C     S C+ + D G C S P+    +K  CC   +    WG+PC  C +         CP G        D   D++EC +   IC+NG CIN  GSFRC+CP  + LD   ++C    D+C + G+ CG  G C     G + C C +     F     +   + N C     L   +     YG SY C+CPSG+   ED++ C      D+ +  E    C  RG  C +    + C+C    Q   + + C        +    C       +C  G CV+    Y C C+EGF  + +   C+          + Q  CQ                    + S N     K+E   NS      +G++C+  +C       +   C  G   + D          +D  + + +   C+ GQC++   S+RC C   Y +   G  CV      Q+  P   +C   E    C           G  C D     T  +           + N +      +  +   DN+ C  Q  L    G R +     G F C C  GF+  S G +C  E VD+C  N       RC+    +    FRC CP         + C+     T  +T           C S +C N     +C+C  G+   +    C  +++ SS                  D  Y C C  GY ++  G 
Sbjct: 2012 QCVCPPGFVLSDNGRRCFDTRQSFCFTRFDNGKC-SVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGSVAFQELCPYGHGSIPGMGDTREDVNECSESPGICVNGVCINTDGSFRCECPFGYNLDYTGVNC-VDTDECSI-GNPCG-NGTCSNVVGG-FECTCDE----GFEPGPMMTCEDINECT--NPLLCAFRCINTYG-SYECTCPSGYTLREDRRMC-----KDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMQRRPDGEGC--------MDENECRTKP--GICVNGRCVNTVGSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQ--------------------LSSTNRNMVTKSECCCNSG---RGWGNQCE--ICPLPGTGAFKKMCPHGPGFATDG---------RDIDECKVLPNLCKNGQCINTIGSFRCHCKLGYTTDITGTTCVDLDECAQSPKPCNFICKNTEGSYQCSCPRGYILQEDGKTCKDLDECSTKQHNCQFLCVNTIGSFNCKCPPGFTQHQSSCIDNNECSSQPSLC---GSRGVCQNNPGSFTCECQKGFSLDSSGSNC--EDVDECDGNH------RCQHGCQNVLGGFRCGCPQGYVQHYQWNQCVDENECTSQST-----------CGSASCYNTLGSFKCVCPSGFDFDQSFGGCQDVDECSS-----GGGNPCSYGCSNTDGGYLCGCPGGYFRAGQGH 2664          

HSP 10 Score: 90.1225 bits (222), Expect = 1.735e-17
Identity = 189/787 (24.02%), Postives = 299/787 (37.99%), Query Frame = 1
Query:  346 KCICESGYFGEDCNTAIISTCYVKIDR----GLCKSTPENLQLS--------------KEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSC----VSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERT---RNSTSIC--ELYGHRCQTGVC-----------------YPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQ-GGECVDTXXXXXXXXXXXXXATENGRKCSRIE-KQVTEEPDNSYCLLQE--YLSRCMGG-RCIGDKTY----------------------GFKCLCLPGFTSASDGRSCDPEYVDQCLN-NENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL 2460
            KC C++G+ G+  N   +  C  +  +      C +TP + + +               +EC     +     C+     Y   C  GFT  E+   C DIDEC F++IC+ G C N  G FRC C   + LD +  +C    D  +       I G CV T  G Y C C + + ++  G  C+     N           + E QP G     SC +       + SC  +             R  G  C     +    Y+ LC G         E  R      ++       E   LC+GG+CV+    + C+C  G+Y  E  R C  I+    +C+ +   C  G C      NY C C   +++   G +C+   ++   RN    C  EL  +  +   C                  P  P EYI  C    +Q+      I+  +  D  +  EI   C  G C++   S+RC C   +  +N    C    +        CS  E  +LCQ   +C++   +Y C+C +GY  + +G    R E +++     +  C+  E  Y+  C  G +  GD+T                        + CLC PGF    +    D   +D+C +    +C  G+C  +  S F+C+C     ++ DG +C+ IN  T+ P T           C+ G C N     RCIC PG++   D   C  I +        +      G       +++C C  G++ S+NGR C  +  + 
Sbjct: 1324 KCQCQTGWVGDGLNCVDLDECTTEDHKCNANANCVNTPGSYRCACNEGFNGDGFICSDVDECADNVNLCENGHCLNAPGGYRCECEMGFTPTEDSKACQDIDECTFQNICVFGTCQNLPGMFRCICDDGYELDRSGGNCT---DVNECADPVNCINGLCVNTP-GNYLCNCPQDFELNPTGVGCVDTRVGNC----------FLETQPRGDGGL-SCSAEIGVGVTRASCCCSLG-----------RAWGNPCEFCPFANSTEYKTLCPG--------GEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICEDID----ECSAHIGICGPGTCYNT-LGNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNYNDTCENELSSNMTKKMCCCSYNIGKAWNKPCEPCPSPATP-EYIFLC---GNQAPGFIIDIRTGKPMDIDECSEIPAICSNGVCINQIGSFRCECPMGFSYNNILLICEDIDE--------CSSGE--NLCQRNADCINIPGSYRCECSSGYKLSPSGACVGRNECQEIPNVCSHGTCMDTEGSYICVCHNGFKASGDQTMCMDIDECDRQPCGNGTCKNTVGSYNCLCFPGFELTHNNDCMD---IDECYSLVGQVCRNGQCINNVGS-FQCLCQEGYEITPDGKNCMDINECTSLPGT-----------CSPGTCQNLEGSFRCICPPGFEVQND--NCIDINECDE-----EPNICLFGTCTNTPGSFQCVCPPGFVLSDNGRRCFDTRQSF 2035          

HSP 11 Score: 61.2326 bits (147), Expect = 1.338e-8
Identity = 108/427 (25.29%), Postives = 157/427 (36.77%), Query Frame = 1
Query:  310 NNCSNK-GQCQNGKCICESGYFGEDCN---------TAIIST----CYVKIDRGLCKSTPENLQL-SKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQ-FKSICLNGECINEKGSF-----------------------------------------RCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGR 1398
            N C  K G C NG+C+   G +  DCN         T  + T    C+ ++ + +C+ +  N  + +K ECC      WGN C  C        +  CP G     +   DIDEC+   ++C NG+CIN  GSF                                         +C CP  + L E+  +C+   D+C     +C     CV T  G + C C  P   + +  SCI     N C+    LC   G CQ    S+ C C  GF       +C    + D C       RC+ G C +   G+RC C   Y  +    +CV             ++    S C   SC +    + C C  GF   ++   C  ++  +S        C  G C   D   Y C C  G+ R+  G 
Sbjct: 2271 NECRTKPGICVNGRCVNTVGSYKCDCNEGFQVSSSGTECVDTRQGFCFTEVLQTMCQLSSTNRNMVTKSECCCNSGRGWGNQCEICPLPGTGAFKKMCPHGPGFATDG-RDIDECKVLPNLCKNGQCINTIGSFRCHCKLGYTTDITGTTCVDLDECAQSPKPCNFICKNTEGSYQCSCPRGYILQEDGKTCK-DLDECSTKQHNCQFL--CVNTI-GSFNCKC--PPGFTQHQSSCIDN---NECSSQPSLCGSRGVCQNNPGSFTCECQKGFSLDSSGSNC---EDVDECDG---NHRCQHG-CQNVLGGFRCGCPQGYVQHYQWNQCVDE-----------NECTSQSTCGSASCYNTLGSFKCVCPSGFDFDQSFGGCQDVDECSSG---GGNPCSYG-CSNTD-GGYLCGCPGGYFRAGQGH 2664          

HSP 12 Score: 59.6918 bits (143), Expect = 3.589e-8
Identity = 118/518 (22.78%), Postives = 188/518 (36.29%), Query Frame = 1
Query: 1405 IKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGF---KCLCLPG--FTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTT-----KYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            I   +T    +I   +GH C+     P  PN     C  G+  +      I+    +D  + Q I   C+GG C++   SY C C   +  S   Q+C    +        CS     ++C GGEC +T  +Y C C  G+  + +G +C  I+++V               S  +GGRC G+    F    C C  G  +        C      +         PG     G  + R   P            L+  ++T   T       C +  N   C +G C+      RC C  GYK  +   EC  +++ SS            G       +Y C+C  GY  +   ++CI  +  ++   +C       + G C    +  + C C  G++   D K+C+  D+ +CA     C  G C +    + CIC   + +  NGR C         VD+ E   Q P              C  G+C+  +  ++C+C            CV
Sbjct:  196 IVCTKTLCCATIGRAWGHPCEM---CPAQPN----PCRRGFIPN------IRTGACQDVDECQAIPGLCQGGTCINTVGSYECKCPAGHKQSETSQKCEDIDE--------CSTIP--NVCDGGECTNTAGSYVCVCPRGFTTSRDGSRC--IDQRVGS-----------CFSALIGGRCAGELPGQFTKAHCCCESGRCWAIGQIPEMCPVRGSGKLCIEGLPLGPGFGPEVGPGDMR---PVRPGPGGPNGPELLPGLSTGTATLNQTGDICKLFTNL--CQNGRCIPTPASYRCECNMGYKQ-DSRLECIDVDECSS-------SPCIHGDCVNTPGSYHCRCHEGYQSNPTKQACIDIDECIMNGVMC-------RNGRCVNT-EGSFQCICNAGFETTPDGKNCV--DHDECATTNM-CLNGMCINEDGSFKCICKPGFVLAPNGRYC---------VDVDEC--QTPG------------ICMNGRCINTEGSFRCECLGGLTIGIDGRVCV 630          
BLAST of Fibrillin-2 vs. Ensembl Xenopus
Match: FBN2 (fibrillin 2 (congenital contractural arachnodactyly) [Source:NCBI gene;Acc:100494368])

HSP 1 Score: 154.836 bits (390), Expect = 2.918e-37
Identity = 237/981 (24.16%), Postives = 356/981 (36.29%), Query Frame = 1
Query:   49 MIFLIFLFYFDTILWNHIVVASICDYSDNGEPLCCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY--CPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVC--------------NYFKKL--CLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYN----NDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVT--EEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLP----------GFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICD-----------LHREKCKT-GICY--PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            ++F +  ++  ++  +H +  ++C         CC GW     G+ C+   C   CG G C   N+C C    I +  C     + C+  C N G C    C C+ GY G  C   +                                    C+ ++   +C+     +  +K  CC+    AWG+PC  C      C +GF    +   C D+DECQ    +C  G CIN  GS+ C+CP  H   E T  C+   D+C      C   G+C  T  G Y CIC + Y  S +G  CI + +  VC                F K+  C   G C   G S    CP      E ++ CI                  GG+    G G     NG + G      + Q  V  G    L        +Y +LC  G C+   N Y C+C+ G Y  + +  CI ++  TS        C  G C     + Y C+C  GF R+   ++CI  +        C   G  C+ G C       + C C  G+  + D K C  +++          +  C  G C++   S++C+C   ++ ++NG+ C    + + P +           C  G C++T  ++ C C  G     +GR C     + T         C+     +      C  +  YGF   C P          G  S   G + D   +++C  + +IC  G CE    S FRC C         G +C+             + LVNRL C +G C N      C C  GY    D + C  I +  S   +N               ++ C+C  G      G  CI S       +I D           L  E C T G  +  P  + +   AC  G+ +    K     D  +C V    C  G C +    +LC C    T+   GR C+
Sbjct:    5 LMFCLDCYFLYSV--SHSIRPNVC--GSRFHSYCCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSTGQI-SPNCGSKTIQQCSVRCMNGGTCVEDHCQCQKGYVGAHCGQPVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVSNQMCQGQVTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRSGACQDVDECQAIPGLCQGGNCINTDGSYECRCPVGHKQSETTQKCE-DIDECTTIPGVCN-GGECSNTI-GSYYCICPRGYVTSGDGSRCIDQRS-GVCFSSLVNGHCAQEQAGRFTKMQCCCESGRCWALG-SIPEMCPI-RGTDEYRRLCIEGVPFGGPGGFVPNGFGPGGTGFIPGPGG----NGFHPGIGGTGIDGQGPVINGGVATLNQTIDICKQYPNLCLNGRCIPNLNSYRCECNMG-YKQDTQTECIDVDECTSN------PCTNGDCVNTPGS-YYCKCHSGFQRTPTKQACIDIDE-------CIQNGILCKHGRCVNTE-GSFQCICNAGFELTPDGKNCADHDECS-------TTNMCLNGMCINEDGSFKCICKPGFVLASNGRYCTDIDECQTPGI-----------CMNGHCINTEGSFRCDCPPGLAIGVDGRVCVDTHMRSTCYGGIKKGLCVRPFPGAVTKSECCCANPDYGFGEPCHPCPPRNSAEFQGLCSGGVGITVDGRDINECALDPDICANGICENLRGS-FRCNCNSGFESDSTGKNCI----------DIDECLVNRLLCDNGLCRNTPGSYSCTCPKGYVFRSDSETCEDINECESSPCVNGACRNIL-------GSFNCECSPGSRLDATGLICIDSLKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPRGFARV---KGVSCEDVNECEVFPGVCPNGLCLNTKGSFLCECPDGLTLDGTGRLCL 915          

HSP 2 Score: 132.494 bits (332), Expect = 2.311e-30
Identity = 234/964 (24.27%), Postives = 347/964 (36.00%), Query Frame = 1
Query:  307 TNNCSNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYV----KIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR-NYCPKGFTQKENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSV-----------------SFNGKSCIKKTNYNV------CNY-----FKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGY-----------------NNDQECVRYG--TSEPLVSR-YCSKS----------------EYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG---FKCLC--LPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSI--CDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
             + C++   C NG C+   G +             G  C    +  CY+    + D  +  ST   + +S+  CC     AWGNPC  C   N C K F        DIDECQ    +C  G CIN  GSF+C+CP  +YL E T  C+   D+C  +   CG  G C  T  G YTCIC   Y                   ++NG +C  +  +NV      C Y     + K C P          + C    GF         +     DI +  EI   C  G C+++   +RC C   ++                   + D  C R     + P   R  CS                  E  ++C  G+CVD    Y+C C+ GF  + ++  C+ I+    Q       C  G C+    + Y C C  GF  + N   C+  +   +      LYG  C+ G C+      +IC C EGY  + D K CI      D  +       C  G C +   S+RC+C   Y      + C+   +            E  ++C  G C +T  ++ C C  G+  +ENGR+C    +        S+C      +R   G+C   K Y     KC C  +PG      G  C+                  C + G   F+ +CPY       GH  +     T      C  L N   CA+G+C+N     RC C  GY     G  C   ++ S         C            +EC C  G+          +    ++ + I  C L+   C        G   Y C C  GY    D+K C  +D      ++   +G  C +++  ++CIC        +G  C+                     ++ C  K  I  C+ G+CV     Y+C C   F++     EC+
Sbjct: 1452 VDECADPINCVNGFCVNTPGRYECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSRSSCCCSLGKAWGNPCEICPPVNSCKKHFLLSA----DIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICE-DIDECFTHPGVCGP-GTCYNTL-GNYTCICPSEYMQVNGGHNCMDMRKSFCYRTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCEPCPTPGTANFKHLCGSIPGFTFDIHTGKAV-----DIDECKEIPGICTNGVCINQIGSFRCECPTGFKTITQITIYFILLLYIDECSSGDYFCQRNADCINSPGTYRCECSTGFKLLPNGACIDRNECLEIPNVCSHGTCVDTEGSYHCVCNNGFKVSPDQTMCMDIDECERQ------PCGNGTCKNTVGS-YNCLCYPGFEITHN-NDCLDIDECSS------LYGQVCRNGHCFNEI-GSFICLCNEGYELTPDGKNCI------DINECVAFPGSCSPGTCQNLEGSFRCICPPGYEVER--ENCIDIDEC----------IEEPNICLFGACSNTPGSFQCICPPGFVLSENGRRCFDTRQ--------SFCF-----TRFENGKCSVPKAYNSTKAKCCCSKMPG---EGWGDPCE-----------------LCPKEGEVAFQDLCPY-------GHGTIPGIGDTREDVNEC--LENPGICANGHCINTDGSFRCECPMGYNLDYTGVNCVDTDECSIGNPCGNGTCTNAI------GTFECLCDEGF----------EPGPMMVCEDINECILNPLLCAFRCINTYGA--YECTCPAGYILREDQKMCKDLDECIEGFHDCESRGMVCKNLIGTFMCICPPGMVRRPDGEGCM--------------------DENECRTKPGI--CENGRCVNTIGSYRCDCNEGFQSTPSGTECL 2288          

HSP 3 Score: 130.954 bits (328), Expect = 6.237e-30
Identity = 207/851 (24.32%), Postives = 321/851 (37.72%), Query Frame = 1
Query:  325 KGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-------YCPKG--FTQKENRCD------DIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSF-NGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGG---SCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCH----GKYISSNNGQECVR-YKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVS---SIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESA----LIKKSI--CDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
             G C NG C+   G F             G  C    +  C++K D   C   P   +   + CC     AWG  C  C +         CP+G  FT + +         DI+EC+ F  IC NG+C N  GSF+C+C     LD    +C    D+C++    CG  G C+ T  G + C C + +   F   K+C+   + + C     LC   GEC     S+ C+CP+G   +    +C+     DI +       CR G CV+    Y+C CN  YQ                L    C+  +  ++  GG    C +    Y C C EG+    ++R C  I+    +C  N   C GG+C  +    Y C C  GF+ S + ++CI           C++  + C  G C       ++C C  GY+  +    C   ++ +    N  +        C++   S++C C     G  I  N+  EC+    +    A  L +   Y+  C  G                   T +G  CS +++              E ++ C  G+C+ +    ++C C  GFT ASD RSC  + +D+C   +NIC  G C       FRC+C     L + G +C              D   + + C +G CVN      C C P ++ +  G  C      +   +  +             +  +   C C  G         C    S     L+   I  C      C+ G C       + C C  GY  + + + C  +D  +C  +   C  G CY+ +  Y CIC   Y     G +C+
Sbjct:  882 PGVCPNGLCLNTKGSFLCECPDGLTLDGTGRLCLDLRMEHCFLKWDEDECVH-PVPGKFRLDACCCAVGAAWGTECEECPKPGSQEFELLCPRGPGFTNRGDVLSGRPFYKDINECKAFPGICTNGKCRNTIGSFKCKCNNGFALDMEERNCT-DIDECRISPDLCG-SGTCINTP-GSFECECFEGFESGFMMMKNCM---DIDECERNPLLCR-GGECINTEGSFLCNCPNGHELTPSGDACV-----DINECALSDNLCRNGKCVNIVGTYQCSCNPGYQAT--------------LDRLGCTDIDECTIMNGGCDTHCTNSEGSYECSCLEGYALMPDKRTCTDID----ECEDNPDICDGGQCTNIP-GEYRCLCFDGFMASMDMKTCIDVNE-------CDINSNICMFGECENTK-GSFVCHCQVGYAVKKGTTGCTDVDECEIDTHNCHLHA-----TCLNVPGSFKCTCKEGWIGNGIKCNDLDECLNGTHRCSVSAHCLNTPGSYHCSCAEG------------------YTGDGFTCSDVDE------------CTENINLCENGQCL-NIPGSYRCECDMGFTPASDSRSC--QDIDECA-FQNICVFGTCSNLPGM-FRCICNEGYELDRTGGNC-----------TDVDECADPINCVNGFCVNTPGRYECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSRSSCCCSLGKAWGNPCEICPPVNSCKKHFLLSADIDECQELPGLCQGGNCINT-FGSFQCECPQGYYLSEETRICEDID--ECFTHPGVCGPGTCYNTLGNYTCICPSEYMQVNGGHNCM 1638          

HSP 4 Score: 117.857 bits (294), Expect = 6.528e-26
Identity = 215/911 (23.60%), Postives = 341/911 (37.43%), Query Frame = 1
Query:  526 RNYCPKGFTQKENR--CDDIDECQFKS-ICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIK---------------------------AERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQV-----------TEEPDN--------SYCLLQEYLSRCMGGRCIGDKTYGFKCLC--LPGFT-SASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGN--------CVND----RCICGPGYKSSEDGK-----ECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISE-VSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYD----HECVRDSNKCPYCFYGCFDENSISTCSC------SENYENLFDT 3018
            R  C  GF    +   C D++EC   S IC+ GEC N KGSF C C   + + + T  C    D+C++   +C +   C+    G + C C + +    NG   IK  + + C      C     C     SY+CSC  G+  + D  +C     SD+ +  E    C  G C++    YRC C+  +   ++ + C               +  + ++C  G+C +L   + C C+EG+        C  ++    +CA +   C  G C       YEC C   F  +  G  C+                              R+    S+ + +G+ C+  +C P+       +C + +  S D   C            QE+   C+GG C++   S++C C   Y  S   + C    +           + +  +C  G C +T  NY C C + Y     G  C  + K              E P N        +Y + + +   C    C    T  FK LC  +PGFT     G++ D   +D+C     ICT G C     S FRC CP               + T    T Y  +L+    C+SG+        C+N     RC C  G+K   +G      EC +I  V S            G     + +Y C C NG+  S +   C+  +         +  R+ C  G C       Y C C  G+ + T    C+ +D       +  C+ G+C++ +  ++C+C   Y +T +G++CI         DI+E V++                 C PG C   +  ++C CP  ++    +     EC+ + N C   F  C +      C C      SEN    FDT
Sbjct: 1226 RCLCFDGFMASMDMKTCIDVNECDINSNICMFGECENTKGSFVCHCQVGYAVKKGTTGCT-DVDECEIDTHNCHLHATCL-NVPGSFKCTCKEGWI--GNG---IKCNDLDECLNGTHRCSVSAHCLNTPGSYHCSCAEGY--TGDGFTC-----SDVDECTENINLCENGQCLNIPGSYRCECDMGFTPASDSRSCQDI-----------DECAFQNICVFGTCSNLPGMFRCICNEGYELDRTGGNCTDVD----ECA-DPINCVNGFCVNTPGR-YECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSRSSCCCSLGKAWGNPCE--ICPPVN------SCKKHFLLSADIDEC------------QELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDEC----------FTHPGVCGPGTCYNTLGNYTCICPSEYMQVNGGHNCMDMRKSFCYRTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCE--PCPTPGTANFKHLCGSIPGFTFDIHTGKAVD---IDECKEIPGICTNGVCINQIGS-FRCECP-------------TGFKTITQITIYFILLLYIDECSSGDYFCQRNADCINSPGTYRCECSTGFKLLPNGACIDRNECLEIPNVCS-----------HGTCVDTEGSYHCVCNNGFKVSPDQTMCMDID---------ECERQPCGNGTCKNT-VGSYNCLCYPGF-EITHNNDCLDIDECSSLYGQV-CRNGHCFNEIGSFICLCNEGYELTPDGKNCI---------DINECVAFPG--------------SCSPGTCQNLEGSFRCICPPGYEVERENCIDIDECIEEPNIC--LFGACSNTPGSFQCICPPGFVLSENGRRCFDT 2008          

HSP 5 Score: 111.309 bits (277), Expect = 7.546e-24
Identity = 233/962 (24.22%), Postives = 352/962 (36.59%), Query Frame = 1
Query:  340 NGKCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQV--AWGNPCVFCD-------RNYCP--KGFT--QKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENT---MSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGY--NNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGF-IRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC-VRYKQTEPPAVRLCSK------------------WEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLS------KDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICDL------HREK----CKTG--------ICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY----CFYGCFDENSISTCSCSENY 3000
            N  CIC S Y     G +C     S CY   +   C +      ++K+ CC  + +  AW  PC  C        ++ C    GFT      +  DIDEC +   IC NG CIN+ GSFRC+CP                   D+C      C     C+  S G Y C C   + +  NG +CI +   N C     +C  +G C     SY+C C +GF  S D+  C+   + D C+     + C  G+C +    Y CLC   Y G+   ++ +C+       L         Y  +C  G C +    + C C+EG+  T + + CI I    ++C      C  G CQ L+ + + C C  G+ +  EN   CI  +      +IC L+G    T       P  + C C  G+  SE+ + C    Q   +C  +  + +C   +   N    +C C  K      G  C +  K+ E     LC                     E   +C  G C++T+ ++ C+C  GY     G  C   ++     P             C  G C  +    F+CLC  GF     G     E +++C+ N  +C   RC  +  + + C CP    L       KD   C+  +   E     C  L+    C          IC PG     DG+ C    +  +   + +              +Y C C  G+  + +G  C+ +        + +++C +      H  K    C  G        IC   G   Y   C  G    TD K     D  +C V    C+ G C + +  Y C C   YT    G  C         VD+ E S Q+P+  +F              C   +  YQC CP  +        C +D ++C      C + C +     TC C   +
Sbjct: 1619 NYTCICPSEYMQVNGGHNCMDMRKSFCYRTYNGTTCDNELP-FNVTKKMCCCTYNIGKAWSKPCEPCPTPGTANFKHLCGSIPGFTFDIHTGKAVDIDECKEIPGICTNGVCINQIGSFRCECPTGFKTITQITIYFILLLYIDECSSGDYFCQRNADCI-NSPGTYRCECSTGFKLLPNG-ACIDR---NECLEIPNVC-SHGTCVDTEGSYHCVCNNGFKVSPDQTMCM---DIDECER----QPCGNGTCKNTVGSYNCLC---YPGFEITHNNDCLDIDECSSL---------YGQVCRNGHCFNEIGSFICLCNEGYELTPDGKNCIDI----NECVAFPGSCSPGTCQNLEGS-FRCICPPGYEVEREN---CIDIDECIEEPNIC-LFGACSNT-------PGSFQCICPPGFVLSENGRRCFDTRQ--SFCFTRFENGKCSVPK-AYNSTKAKCCCS-KMPGEGWGDPCELCPKEGEVAFQDLCPYGHGTIPGIGDTREDVNECLENPGICANGHCINTDGSFRCECPMGYNLDYTGVNCVDTDECSIGNP-------------CGNGTCT-NAIGTFECLCDEGF---EPGPMMVCEDINECILNPLLCA-FRCINTYGA-YECTCPAGYILREDQKMCKDLDECIEGFHDCESRGMVCKNLIGTFMC----------ICPPGMVRRPDGEGCMDENECRTKPGICENGRCVNTI-----GSYRCDCNEGFQSTPSGTECLDTRQGFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPLPGTAQYKKMCPHGPGYTTDGK-----DIDECKVMPNLCRNGQCINNIGSYRCFCNPGYTTDIGGTAC---------VDLDECS-QSPKPCNF-------------ICKNTEGSYQCSCPRGYILQEDGKSC-KDLDECQTKQHNCQFLCVNTIGGFTCKCPPGF 2471          

HSP 6 Score: 105.916 bits (263), Expect = 3.020e-22
Identity = 214/891 (24.02%), Postives = 317/891 (35.58%), Query Frame = 1
Query:  325 KGQCQNGKCICESGYFGEDCNTAI-----------ISTCYVKID---RGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSI-CLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERS-----GNSNFRCVCPYYASLSKD-GHSCLI--------NYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKG--GYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKT 2892
             G C NGKC    G F   CN              I  C +  D    G C +TP + +    EC   F+                 GF   +N C DIDEC+   + C  GECIN +GSF C CP  H L  +  +C    ++C L  + C   GKCV    G Y C C   Y  + +   C   T+ + C      C  +  C     SY CSC  G+    DK++C     +DI +  +  + C GG C +    YRCLC   +    + + C+     +             ++C  G C +    + C C  G+   +    C  ++    +C ++   C           +++C C  G+I   NG  C   +   N T  C +  H   T       P  Y C+C EGY+   D   C       D  +  E    C  GQC++   SYRC C   +  +++ + C    +             + ++C  G C +    + C C  GY     G  C+ +++    +P N           C+ G C+      ++C C P F     G  C    V  C  N      G    S     G S   C C    SL K  G+ C I         +         C  L     C  GNC+N     +C C  GY  SE+ + C  I++  +   +                NY C C + Y++   G +C+      ++KS C             P      +C C     +A   K C     P  A  ++ C    G+ +DI  G                         K+VDI E              KEI   C  G C+ +   ++C+CP  FKT
Sbjct: 1000 PGICTNGKCRNTIGSFKCKCNNGFALDMEERNCTDIDECRISPDLCGSGTCINTPGSFEC---ECFEGFE----------------SGFMMMKN-CMDIDECERNPLLCRGGECINTEGSFLCNCPNGHELTPSGDAC-VDINECALSDNLC-RNGKCVNIV-GTYQCSCNPGYQATLDRLGC---TDIDECTIMNGGCDTH--CTNSEGSYECSCLEGYALMPDKRTC-----TDIDECEDNPDICDGGQCTNIPGEYRCLCFDGFMASMDMKTCIDVNECD----------INSNICMFGECENTKGSFVCHCQVGYAVKKGTTGCTDVD----ECEIDTHNCHLHATCLNVPGSFKCTCKEGWIG--NGIKCNDLDECLNGTHRCSVSAHCLNT-------PGSYHCSCAEGYTG--DGFTC------SDVDECTENINLCENGQCLNIPGSYRCECDMGFTPASDSRSCQDIDEC-----------AFQNICVFGTCSNLPGMFRCICNEGYELDRTGGNCTDVDE--CADPIN-----------CVNGFCVNTPGR-YECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSRSSCCC----SLGKAWGNPCEICPPVNSCKKHFLLSADIDECQELPG--LCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFTHPGVCGPGTCYNTL-----GNYTCICPSEYMQVNGGHNCMD-----MRKSFCYRTYNGTTCDNELPFNVTKKMCCCTYNIGKAW-SKPCEPCPTPGTANFKHLCGSIPGFTFDIHTG-------------------------KAVDIDEC-------------KEIPGICTNGVCINQIGSFRCECPTGFKT 1746          

HSP 7 Score: 103.219 bits (256), Expect = 2.186e-21
Identity = 212/865 (24.51%), Postives = 330/865 (38.15%), Query Frame = 1
Query:  532 YCPKGF-TQKENRCDDIDECQ--FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNS--------DICQSPEIAERCRGGSCVS----EGKGYRC-LCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYY---SLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ--TEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKC---------SRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDK--------TYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY----CFYGCFDENSISTCSCSENY 3000
             C  GF     N C DIDEC   +  +C NG C NE GSF C C   + L  +  +C    ++C  +  SC   G C    +G + CIC   Y V    ++CI   + + C     +CL +G C     S+ C CP GF  SE+ + C     S          C  P+     +   C S    EG G  C LC  E +    D     +GT   +       +E      +C  G C++ +  + C+C  G+        C+     T +C++    C  G C       +EC C  GF   E G   +  +        C L    C    C   Y   Y C C  GY   ED+K C    +  D C         RG  C +   ++ C+C    +   +G+ C+   +  T+P             +C+ G CV+T  +Y C C  G+ +T +G +C         S + + + +   +S   + +    C GGR  G++        T  +K +C  G    +DG+      +D+C    N+C  G+C  +  S +RC C    +    G +C ++      + K C+ +      +       +C C  GY   EDGK C  +++  +     Q  C            + C+C  G+  +++  +CI +     + ++C L       G+C       + C C  GY   +   +C  +D  +C  N +RC+ G C +IV GY C C   Y        C         VD +E + QN               C    C      Y+C CP  F  N +   C  D ++C      C YGC +      C C   Y
Sbjct: 1867 LCYPGFEITHNNDCLDIDECSSLYGQVCRNGHCFNEIGSFICLCNEGYELTPDGKNC-IDINECVAFPGSCSP-GTCQ-NLEGSFRCICPPGYEVER--ENCI---DIDECIEEPNICL-FGACSNTPGSFQCICPPGFVLSENGRRCFDTRQSFCFTRFENGKCSVPKAYNSTKAKCCCSKMPGEGWGDPCELCPKEGEVAFQDLCPYGHGTIPGIGDTREDVNECLENPGICANGHCINTDGSFRCECPMGYNLDYTGVNCVD----TDECSIGN-PCGNGTCTNAIGT-FECLCDEGF---EPGPMMVCEDINE-----CILNPLLCAF-RCINTY-GAYECTCPAGYILREDQKMC----KDLDECIEGFHDCESRGMVCKNLIGTFMCICPPGMVRRPDGEGCMDENECRTKP------------GICENGRCVNTIGSYRCDCNEGFQSTPSGTECLDTRQGFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPLPGTAQYKKMCPHGPGYTTDGKD-----IDECKVMPNLCRNGQCINNIGS-YRCFCNPGYTTDIGGTAC-VDLDECSQSPKPCNFICKNTEGSY------QCSCPRGYILQEDGKSCKDLDECQTKQHNCQFLCVNTI------GGFTCKCPPGF--TQHHTACIDNNECGTQSNVCGLK------GVCQN-SPGSFTCECQRGYSLDSTGMNCEDVD--ECGGN-HRCQHG-CQNIVGGYRCSCPQGYIQHYQWNQC---------VDENECASQN--------------TCGSASCFNTLGSYKCACPTGFTFNQFSSAC-HDVDECTSSKNPCNYGCSNTEGGYLCGCPPGY 2634          

HSP 8 Score: 101.679 bits (252), Expect = 5.638e-21
Identity = 161/628 (25.64%), Postives = 240/628 (38.22%), Query Frame = 1
Query:  346 KCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECC--SIFQVAWGNPCVFCDR-------NYCPKGFTQKENRCD---DIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERC--RGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRY---KQTEPPAVRLCSKWE--YYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENIC-TPGRCERSGNSNFRCVCPYYASLSKDGHSC 2154
            +CIC  G+     G  C     S C+ + + G C S P+    +K +CC   +    WG+PC  C +       + CP G        D   D++EC +   IC NG CIN  GSFRC+CP  + LD   ++C    D+C + G+ CG  G C   + G + C+C +     F     +   + N C     LC  +     YG +Y C+CP+G+   ED+K C      D+ +  E    C  RG  C +    + C+C             VR    E  +     +++   +CE G CV+    Y C C+EGF +T +   C+          + Q  CQ            EC C  G                 N   IC L G              +Y   C  G   + D          KD  + + +   CR GQC++N  SYRC C+  Y +   G  CV      Q+  P   +C   E  Y   C  G  +                 E+G+ C  +++  T++ +  +  +              +   GF C C PGFT      +C     ++C    N+C   G C+ S  S F C C    SL   G +C
Sbjct: 1989 QCICPPGFVLSENGRRCFDTRQSFCFTRFENGKC-SVPKAYNSTKAKCCCSKMPGEGWGDPCELCPKEGEVAFQDLCPYGHGTIPGIGDTREDVNECLENPGICANGHCINTDGSFRCECPMGYNLDYTGVNC-VDTDECSI-GNPCG-NGTCT-NAIGTFECLCDE----GFEPGPMMVCEDINECILNPLLCA-FRCINTYG-AYECTCPAGYILREDQKMC-----KDLDECIEGFHDCESRGMVCKNLIGTFMCICPPGM---------VRRPDGEGCMDENECRTK-PGICENGRCVNTIGSYRCDCNEGFQSTPSGTECLDTRQGFCFSEVLQTMCQMSSSSRNHVTKSECCCNGG-------------RGWGNQCEICPLPGTA------------QYKKMCPHGPGYTTDG---------KDIDECKVMPNLCRNGQCINNIGSYRCFCNPGYTTDIGGTACVDLDECSQSPKPCNFICKNTEGSYQCSCPRGYILQ----------------EDGKSCKDLDECQTKQHNCQFLCV--------------NTIGGFTCKCPPGFTQHH--TACIDN--NECGTQSNVCGLKGVCQNSPGS-FTCECQRGYSLDSTGMNC 2521          

HSP 9 Score: 92.8189 bits (229), Expect = 2.963e-18
Identity = 211/974 (21.66%), Postives = 342/974 (35.11%), Query Frame = 1
Query:  535 CPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI------------VNSNSDICQSPEIAERC-RGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAE-----RTRNSTS-------------------ICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYIS-----------------SNNGQECVRYKQ-TEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXA---TENGRKCSRIEKQVTEEPDNSYCLLQEYLSR--CMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNN-ENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSE----DGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICDLHREKCKTG------------------ICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKC------QPG--------------------KCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFDENSISTCSCSENYENLFDTGLCI-----IKSDEISYSLGDSTCRTK 3084
            C +G+T     C D+DEC +  ++C NG+C+N  GS+RC+C        ++ SCQ   D+C        +FG C     G + CIC + Y +   G +C   T+ + C     +    G C      Y C+CP  F  +     C+               +  I  S EI     R   C S GK +   C    +       C ++     L +      E   LC+GG+C++    + C+C +G+Y +E  R C  I+    +C  +   C  G C      NY C C   +++   G +C+        RT N T+                   I + +   C+          +++C  + G++      + I   +  D  + +EI   C  G C++   S+RC C   + +                 S+    C R       P    C     + L   G C+D N          +     TE    C          PD + C+  +   R  C  G C  +    + CLC PGF    +    D   +D+C +    +C  G C     S F C+C     L+ DG +C+ IN     P +           C+ G C N     RCIC PGY+       D  EC +   +    + +               +++C C  G++ SENGR C  +  +      +   C + +    T                   +C   G+  +   C  G+            D  +C  N   C  G+C +    + C C   Y +   G +C         VD  E S  NP     CT      +C      +PG                    +C+     Y+C CP  +     D +  +D ++C   F+ C     +         +NL  T +CI     ++  +    + ++ CRTK
Sbjct: 1355 CAEGYTGDGFTCSDVDECTENINLCENGQCLNIPGSYRCECDMGFTPASDSRSCQ-DIDECAFQNIC--VFGTCS-NLPGMFRCICNEGYELDRTGGNC---TDVDEC--ADPINCVNGFCVNTPGRYECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSRSSCCCSLGKAWGNPC----EICPPVNSCKKHFL---LSADIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDID----ECFTHPGVCGPGTCYNTL-GNYTCICPSEYMQVNGGHNCMDMRKSFCYRTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCEPCPTPGTANFKHLCGSIPGFT------FDIHTGKAVDIDECKEIPGICTNGVCINQIGSFRCECPTGFKTITQITIYFILLLYIDECSSGDYFCQRNADCINSPGTYRCECSTGFKLLPNGACIDRNECLEIPNVCSHGTCVDTEGSYHCV-CNNGFKVSPDQTMCMDIDECERQPCGNGTC-KNTVGSYNCLCYPGFEITHNNDCLD---IDECSSLYGQVCRNGHCFNEIGS-FICLCNEGYELTPDGKNCIDINECVAFPGS-----------CSPGTCQNLEGSFRCICPPGYEVERENCIDIDECIEEPNICLFGACSNT-----------PGSFQCICPPGFVLSENGRRCFDTRQSFCFTRFENGKCSVPKAYNSTKAKCCCSKMPGEGWGDPCELCPKEGEVAFQDLCPYGHGTIPGIGD-TREDVNECLENPGICANGHCINTDGSFRCECPMGYNLDYTGVNC---------VDTDECSIGNPCGNGTCTNAIGTFECLCDEGFEPGPMMVCEDINECILNPLLCAFRCINTYGAYECTCPAGYILR-EDQKMCKDLDECIEGFHDCESRGMVC--------KNLIGTFMCICPPGMVRRPDGEGCMDENECRTK 2254          

HSP 10 Score: 66.2402 bits (160), Expect = 3.931e-10
Identity = 109/429 (25.41%), Postives = 153/429 (35.66%), Query Frame = 1
Query:  229 VGLNVCECYDKTIRTETCPQNNQKLCTNNCSNK-GQCQNGKCICESGYFGEDCNTAIIST-------------CYVKIDRGLCK-STPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIK----KTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSE----DKKSCIVNSN----SDICQSPEIAERC---RGGSCVSEGK-----------------------GYRCLC-NGEYQGYNNDQ-----ECVRYGTSEPLVSRYCSKSEYYSLCEGG-------------------------SCVDLNNDYYCQCSEGFY 1239
            +G  +C C    +R    P     +  N C  K G C+NG+C+   G +  DCN    ST             C+ ++ + +C+ S+     ++K ECC      WGN C  C        +  CP G     +   DIDEC+   ++C NG+CIN  GS+RC C P +  D    +C    D+C      C    K    ++G Y C C + Y +  +GKSC      +T  + C +          C      + C CP GF Q      D   C   SN      +CQ+   +  C   RG S  S G                        GYRC C  G  Q Y  +Q     EC    T     S + +   Y   C  G                          C +    Y C C  G+Y
Sbjct: 2225 IGTFMCICPPGMVRR---PDGEGCMDENECRTKPGICENGRCVNTIGSYRCDCNEGFQSTPSGTECLDTRQGFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPLPGTAQYKKMCPHGPGYTTDG-KDIDECKVMPNLCRNGQCINNIGSYRCFCNPGYTTDIGGTAC-VDLDECSQSPKPCNFICK---NTEGSYQCSCPRGYILQEDGKSCKDLDECQTKQHNCQFL---------CVNTIGGFTCKCPPGFTQHHTACIDNNECGTQSNVCGLKGVCQNSPGSFTCECQRGYSLDSTGMNCEDVDECGGNHRCQHGCQNIVGGYRCSCPQGYIQHYQWNQCVDENECASQNTCGS-ASCFNTLGSYKCACPTGFTFNQFSSACHDVDECTSSKNPCNYGCSNTEGGYLCGCPPGYY 2635          
BLAST of Fibrillin-2 vs. Ensembl Mouse
Match: Fbn2 (fibrillin 2 [Source:MGI Symbol;Acc:MGI:95490])

HSP 1 Score: 155.221 bits (391), Expect = 1.656e-37
Identity = 242/1008 (24.01%), Postives = 362/1008 (35.91%), Query Frame = 1
Query:  253 YDKTIRTETCPQNNQKLCTNNCSNKGQCQNG----KCICESGY----FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY-CPKGFTQ-KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-----------------------QYRRDQC-----QLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNY---NVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI-----------------VNSNSDI-----------------CQSPEIAER----CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTE--------------PPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLS-----------------RCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSIC-----DLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            Y     TETC   N+  C +N    G C+N      C C  G      G  C  ++  TC++ I    C+       L K ECC+    AWG+PC  C+ +  CP+GF + K   C+D++EC+ F  +C NG C+N KGSF C+CP    LD     C                       ++R D C       +G+ C    +C      +Y  +C +    +  G     +  Y   N C  F  +C  YG+C+    S+ C C +GF    ++++C                  VN+                     C   +  ER    CRGG+CV+    ++C C   ++   + ++CV            CS S+  +LC  G CV++   Y C C+ G+ AT +R+ C  I+           QC           +YEC C  G+    +GRSC   +   N+  IC+  G +C         P EY C C +G+  S D K CI   +      N  I   C  G+C +   S+ C C   Y        C    + E               P    CS  E + +  G +C+D                 NG     I  Q    P +  C   E  +                  C  G+C+ +    ++C C  GFT ASD RSC  + +D+C + +NIC  G C       F C+C     L + G +C              D   + + C +G CVN      C C P ++ +  G  C                          DN      L    + +   SC       + +S C           C+T  C P+   +Y   C  G     +  + I+ D  +C      C+GG C +    + C C   Y ++E  R C          DI E  + +P              C PG C     +Y C CP  +      H C+
Sbjct:  834 YVFRTETETCEDVNE--CESNPCVNGACRNNLGSFHCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATL-KSECCATLGAAWGSPCERCELDAACPRGFARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEHCFLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECE---ECPKPGTKEYETLCPRGPGFANRGDILTGRPFYKDINECKAFPGMCT-YGKCRNTIGSFKCRCNNGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDI--------NECSLSD--NLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSE------GSYECSCSEGYALMPDGRSCADIDECENNPDICD--GGQCTN------IPGEYRCLCYDGFMASMDMKTCIDVNECD---LNPNI---CMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGW-VGNGIKCIDL------------DECANGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENTNLCENGQCL-NVPGAYRCECEMGFTPASDSRSC--QDIDEC-SFQNICVFGTCNNLPGM-FHCICDDGYELDRTGGNC-----------TDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCV-------------------------DNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCET--CPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRIC---------EDIDEC-FAHPGV------------CGPGTCYNTLGNYTCICPPEYMQVNGGHNCM 1726          

HSP 2 Score: 126.331 bits (316), Expect = 1.451e-28
Identity = 230/1007 (22.84%), Postives = 339/1007 (33.66%), Query Frame = 1
Query:  148 CCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNY-------------------------------------CPKGFTQKEN--RCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKP---YSVSFNGKSCIKKTNYNVCNYFKKLC---LPYGECQPYGLS-----------------YYCSCP--SGFHQSEDKKS-------------CIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEY-QGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLP----------GFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICD-----------LHREKCKT-GICY--PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CC GW     G+ C+   C   CG G C   N+C C    I + TC   + + C+  C N G C +  C C+ GY G  C   +                                    C+ +++  +C+     +  +K  CC+    AWG+PC  C        R +                                     CP G  Q E   +C+DIDEC     +C  G+C N  GS+ C CP       +   C  +R      G   G   + +P    +  C C +P   +S+    ++C  + +      +++LC   LP G      +S                  +   P  +GF                      I+N   DIC+    A  C  G C+     YRC CN  Y Q  N D   V   TS P              C  G CV+    YYC+C  GF  T  ++ CI I+    +C  N   C+ GRC   D  +++C C  GF  + +G++C+  +    +        + C  G+C       + C C  G+  + + +YC       D CQ   I   C  G C++N  S+RC C        +G              R+C      S C G                             I+K V   P        E         C  +  YGF   C P          G  S+  G + D   +++C  + +IC  G CE    S +RC C         G +C+             + LVNRL C +G C N      C C PGY    + + C  + +  S            G    +  ++ C+C  G   S  G  CI S       +I D           L  E C T G  +  P  + +   AC  G+ +    K     D  +C V    C  G C +    + C C    T+   GR C+
Sbjct:   97 CCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSSGQI-SPTCGAKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSVIPGVCETGDCSNTVGSYFCLCPRGFVTSTDGSRCIDQRAGTCFSGLVNGRCAQELPGRMAKAQC-CCEPGRCWSIGTIPEACPVRGS----EEYRRLCLDGLPMGGIPGSSVSRPGGTGSTGNGYGPGGTGFLPIPGDNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDICK--HHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNP--------------CSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDID----ECIQNGVLCKNGRCVNTD-GSFQCICNAGFELTTDGKNCVDHDECTTT--------NMCLNGMCI-NEDGSFKCVCKPGFILAPNGRYCTD----VDECQTPGI---CMNGHCINNEGSFRCDCPPGLAVGVDG--------------RVCVDTHMRSTCYG----------------------------EIKKGVCVRPFPGAVTKSEC--------CCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICANGICENLRGS-YRCNCNSGYEPDASGRNCI----------DIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDVNECES-------NPCVNGACRNNLGSFHCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFARI---KGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCL 989          

HSP 3 Score: 122.479 bits (306), Expect = 1.940e-27
Identity = 252/1078 (23.38%), Postives = 386/1078 (35.81%), Query Frame = 1
Query:  325 KGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR-------NYCPKGFTQKENRCD---------DIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNG-KSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGT------------SEPLVSRYCSKSEYYSL-------------------CEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNEN------ICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLIN-----YVTTEPT-------TKYCDILVNRLRC--ASGNCVNDRCICGPGYKSSE-----DGKECYKIEKVSSIXXXXXXXXXXXXXXXXDD-----NNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKC--AVNEYRCKGGYCYDIVDGYLCICVGNY--------------------TVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYY-------------DHECVR----------------------------DSNKCP----YCFYG-CFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTCR 3078
             G C NG+C+   G F             G  C    +  C++K D   C   P   +   + CC     AWG  C  C +         CP+G     NR D         DI+EC+ F  +C  G+C N  GSF+C+C     LD    +C    D+C++    CG  G CV T  G + C C + Y   F   K+C+   + + C     LC   G C     S+ C CP G   S  ++ C+     DI +       CR G CV+    Y+C CN  YQ   + Q C                 +    S  CS SE Y+L                   C+GG C ++  +Y C C +GF A+ + + CI +    ++C LN   C  G C+     ++ C C  G+   +    C   +        CE+  H C         P  + C+C EG+  +  +  CI  ++  +      I+      QCV+   SYRC C   +  + +G  C    +            E  +LC+ G+C++    Y C+C  G+    + R C  I++          C  Q     C+ G C  +    F C+C  G+     G +C    +D+C +  N      + TPGR        + C CP    L+  G  C+ N     Y+   P             + V+R  C  + G    + C   P   S+E      G E ++   ++ I        +  G  +  +      +++C+C  GY  SE  R C   +        C  H   C  G CY    N Y C C   Y Q     +C+ M    C  + N   C+    +++    +C C  N                     T+  N       I   K+VDI E              KEI   C  G C+ +   ++C+CP  F  N               D+ C R                            D N+C      C +G C D      C C+  ++   D  +C+   +   +  G+ TC+
Sbjct:  956 PGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEHCFLKWDEDECIH-PVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRG-PGFANRGDILTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNNGFALDMEERNCT-DIDECRISPDLCGS-GICVNTP-GSFECECFEGYESGFMMMKNCM---DIDECERNPLLCR-GGTCVNTEGSFQCDCPLGHELSPSREDCV-----DINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDV----NECDLNPNICMFGECENT-KGSFICHCQLGYSVKKGTTGCTDVDE-------CEIGAHNCDMHASCLNVPGSFKCSCREGWVGNGIK--CIDLDECANGTHQCSINA-----QCVNTPGSYRCACSEGF--TGDGFTCSDVDECA----------ENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDE----------CSFQNI---CVFGTC-NNLPGMFHCICDDGYELDRTGGNC--TDIDECADPINCVNGLCVNTPGR--------YECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDE-------CFAHPGVCGPGTCYNTLGN-YTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTK-RMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDEC-------------KEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCMDVDECERHPCGNGTCK 1942          

HSP 4 Score: 120.553 bits (301), Expect = 8.547e-27
Identity = 230/962 (23.91%), Postives = 357/962 (37.11%), Query Frame = 1
Query:  340 NGKCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQV--AWGNPCVFCDR-----------NYCPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQ-GYNND----QECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGF-IRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC--------VRYKQTEP------PAVRLCSK-----WEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLS------KDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICDLHREK----------CKTG--------ICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY----CFYGCFDENSISTCSCSENY 3000
            N  CIC   Y     G +C     S CY   +   C++      ++K  CC  + V  AW  PC  C             N     F     +  DIDEC +   IC NG CIN+ GSFRC+CP     ++  + C+   D+C    + C     C+  S G Y C C   + +S NG +C+ +   N C     +C  +G C     SY C C +GF  S+D+  C+   + D C+       C  G+C +    Y CLC   ++  +NND     EC  +               +  +C  G C +    + C C+EG+  T + + CI     T++C      C  G CQ L+  ++ C C  G+ +RSEN   CI         +IC L+G    T       P  + C C  G+  S++ + C    Q   +C     + +C   +   N    +C C  K      G  C        V ++   P      P++    +      E   +C  G+C++T+ ++ C+C  GY     G +C   ++     P             C  G C  +    F+C C  GF     G   + E +++C  N  +C   RC  +  S + C CP   +L       KD   C       E     C  L+              CIC PG     DG+ C    +  +   + +              +Y C+C  G+  S +G  C+ +   L    + +++C +              C  G        +C   G   Y   C  G   ATD +     D  +C V    C  G C + +  + C C   YT   +G  C         VD+ E S Q+P+  +F              C   +  YQC CP  +     D +  +D ++C      C + C +     TC C   +
Sbjct: 1707 NYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELP-FNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCE-DIDECSNGDNLCQRNADCI-NSPGSYRCECAAGFKLSPNG-ACVDR---NECLEIPNVC-SHGLCVDLQGSYQCICNNGFKASQDQTMCM---DVDECER----HPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSF---------------FGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCID----TNECVALPGSCSPGTCQNLE-GSFRCICPPGYEVRSEN---CIDINECDEDPNIC-LFGSCTNT-------PGGFQCICPPGFVLSDNGRRCFDTRQ--SFCFTNFENGKCSVPK-AFNTTKAKCCCS-KMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNP-------------CGNGTCT-NVIGSFECTCNEGFEP---GPMMNCEDINECAQNPLLCA-FRCMNTFGS-YECTCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTF----------MCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNII-----GSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYATDGR-----DIDECKVMPSLCTNGQCVNTMGSFRCFCKVGYTTDISGTAC---------VDLDECS-QSPKPCNF-------------ICKNTKGSYQCSCPRGYVLQ-EDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGF 2555          

HSP 5 Score: 119.013 bits (297), Expect = 2.098e-26
Identity = 240/956 (25.10%), Postives = 357/956 (37.34%), Query Frame = 1
Query:  205 YDCGYGRC---VGLNVCECYDKTIRTETCPQNNQKLCTNNCSNK-GQ-CQNGKCICESGYFGEDCNTAIISTCYVK--IDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKC-VPTS--DGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVR-YGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDK--------TYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY----CFYGCFDENSISTCSCSENY 3000
            + CG G C   VG   C CY     T     NN  L  + CS+  GQ C+NG+C  E G F   CN     T   K  ID   C + P +        C   + ++        R  CP G+  +   C DI+EC +  +ICL G C N  G F+C CPP   L +N   C   R   Q +  +    GKC VP +    +  C C K     +     +   +  V   F+ LC       PYG   + + PS     ED   C+        +SP I   C  G C++    +RC C     GYN D   VR   T E  +   C           G+C ++   + C C+EGF         +  E I ++CA N   C   RC      +YEC C  G+   E+ + C   +        CE  G  C+  +        ++C C  G ++  D + C+   + +           C  G+CV+   SYRC C+  + SS++G EC+  +Q       LC      ++CQ                                        +S  L+ +    C GGR  G +        T  +K +C  G   A+DGR      +D+C    ++CT G+C  +  S FRC C    +    G +C ++      + K C+ +    + +       +C C  GY   EDGK C  +++  +     Q  C            + C+C  G+ +     +CI +     + S+C         GIC       + C C  G+       +C  +D  +C  N +RC+ G C +I+ GY C C   Y        C         VD +E S  NP +            C    C      Y+C CP  F  + +   C  D N+C      C YGC +      C C   Y
Sbjct: 1934 HPCGNGTCKNTVGSYNCLCYPGFELT----HNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGT---CQNLEGSF--------RCICPPGYEVRSENCIDINECDEDPNICLFGSCTNTPGGFQCICPPGFVLSDNGRRCFDTR---QSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEV--AFQDLC-------PYG---HGTVPSLHDTREDVNECL--------ESPGI---CSNGQCINTDGSFRCECP---MGYNLDYTGVRCVDTDECSIGNPCGN---------GTCTNVIGSFECTCNEGFEPGPM----MNCEDI-NECAQNPLLC-AFRCMNT-FGSYECTCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLI------GTFMCICPPGMARRPDGEGCVDENECRTK------PGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQG------LCFAEVLQTMCQ-------------------------------------MASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYATDGRD-----IDECKVMPSLCTNGQCVNTMGS-FRCFCKVGYTTDISGTAC-VDLDECSQSPKPCNFICKNTKGSY------QCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTL------GGFTCKCPPGFTQHHT--ACIDNNECGSQPSLCGAK------GICQNT-PGSFSCECQRGFSLDASGLNCEDVD--ECDGN-HRCQHG-CQNILGGYRCGCPQGYVQHYQWNQC---------VDENECS--NPGA------------CGSASCYNTLGSYKCACPSGFSFDQFSSAC-HDVNECSSSKNPCSYGCSNTEGGYLCGCPPGY 2718          

HSP 6 Score: 105.145 bits (261), Expect = 4.302e-22
Identity = 215/882 (24.38%), Postives = 318/882 (36.05%), Query Frame = 1
Query:  508 PCVFCDRNYCPKGFTQKEN-RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQ------------------GYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNN--DYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGEC-VDTXXXXXXXXXXXXXATENGRKCSRIE------------KQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFR---CVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSED---GKECYK-IEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQA-TDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFDENSIST----CSCSENYENLFD 3015
            P V   R  C  G+ Q  N  C D+DEC   + C NG+C+N  GS+ C+C           +C    D+C   G  C   G+CV T DG + CIC   + ++ +GK+C+        N    +CL  G C     S+ C C  GF  + + + C   ++ D CQ+P I   C  G C++    +RC C                       G      CVR        S  C  +  Y   E        N  +++  CS G   T + R         ++CAL+   C  G C+ L   +Y C C  G+    +GR+CI  +        C +    C  G+C    P  Y C C  GY    + + C           N+  S  C  G C +N  S+ C C      S+ G  C+              K   +   Q   C V+ N                G  C R E            K VT E  N     + +   C  GRC+  K   F C C  G T    GR C    ++ C    +      C       FR   C C   A+   +   C       +P TK  + L  R               GPG+ +  D   G+  YK I +  +   +                +++C+C NG+      R+C   +        C +  + C +GIC       + C C  GY+      K+C+ +D  +C  N   C+GG C +    + C C   + ++ +  DC         VDI+E S  +               C+ GKCV     YQC C   ++    D +   D ++C     GC  + + S     CSCSE Y  + D
Sbjct:  505 PTVSSYRCECNMGYKQDANGDCIDVDECT-SNPCSNGDCVNTPGSYYCKCHAGFQRTPTKQAC-IDIDECIQNGVLC-KNGRCVNT-DGSFQCICNAGFELTTDGKNCVDHDECTTTN----MCL-NGMCINEDGSFKCVCKPGFILAPNGRYC---TDVDECQTPGI---CMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDGRD-------INECALDPDICANGICENL-RGSYRCNCNSGYEPDASGRNCIDIDE-------CLVNRLLCDNGLCRNT-PGSYSCTCPPGYVFRTETETCED--------VNECESNPCVNGACRNNLGSFHCECSPGSKLSSTGLICIDSL-----------KGTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFARIKGVTCEDVNE---CEVFPGVCPNGRCVNSKG-SFHCECPEGLTLDGTGRVCLDIRMEHCFLKWD---EDECIHPVPGKFRMDACCCAVGAAWGTECEEC------PKPGTKEYETLCPR---------------GPGFANRGDILTGRPFYKDINECKAFPGMCTYGKCRNTI-----GSFKCRCNNGFALDMEERNCTDIDE-------CRISPDLCGSGICVNT-PGSFECECFEGYESGFMMMKNCMDID--ECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDC---------VDINECSLSD-------------NLCRNGKCVNMIGTYQCSCNPGYQATP-DRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPD 1270          

HSP 7 Score: 103.219 bits (256), Expect = 1.543e-21
Identity = 206/914 (22.54%), Postives = 328/914 (35.89%), Query Frame = 1
Query:  148 CCSGWIKNVYGDCVK-SECDYD-CGYGRCV---GLNVCECYDKTIRTETCPQNNQKLCTNNCSNKG-QCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFN-GKSCIKKTNYNVCNYFKKLCLPYGE-CQP----YGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGV-----------------CYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTE--------------PPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEP---DNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            C  G+ ++  GDC+   EC  + C  G CV   G   C+C+    RT   P     +  + C   G  C+NG+C+   G F   CN                + T +       + C+   +     C+  D ++   C  GF    N   C D+DECQ   IC+NG CIN +GSFRC CPP   +  +   C     +   YG              G    +C++P+  +    + C    +Y            +GE CQP        ++  C SG   + D +        DI +     + C  G C +    YRC CN  Y+   + + C+     E LV+R         LC+ G C +    Y C C  G+        C  +    S        C  G C+  +  ++ C+C  G   S  G  CI + +    T    +  +RC+  +                   P    E   AC  G+++       IK    +D  + +     C  G+CV++  S+ C C         G+ C+  +                 P   R+ +         G EC +                  G   +     +T  P   D + C  + +   C  G+C  +    FKC C  GF    + R+C    +D+C  + ++C  G C  +  S F C C       + G   + N +  +   +      N L C  G CVN     +C C  G++ S   ++C  I + S   +L +               Y+C C  GY  + + + C   +  +I    CD               +  Y C+C  GY    D +SC  +D  +C  N   C GG C +I   Y C+C   +  + + + CI
Sbjct:  514 CNMGYKQDANGDCIDVDECTSNPCSNGDCVNTPGSYYCKCHAGFQRT---PTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGF-------------ELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCVCKPGFILAPNGRYCTDVDECQTPGICMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGE----------IKKG----VCVRPFPGAVTKSECCCANPDYG-----------FGEPCQPCPAKNSAEFHGLCSSGIGITVDGR--------DINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDI--DECLVNRL--------LCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDVNECESN------PCVNGACRN-NLGSFHCECSPGSKLSSTGLICIDSLK---GTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFAR-------IKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEHCFLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEEC---PKPGTKEYETLCPRGPGFANRGDILTGRPFYKDINEC--KAFPGMCTYGKCR-NTIGSFKCRCNNGFALDMEERNC--TDIDECRISPDLCGSGICVNTPGS-FECEC---FEGYESGFMMMKNCMDIDECER------NPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMI-----GTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTN---------SEGSYECSCSEGYALMPDGRSCADID--ECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCI 1317          

HSP 8 Score: 102.064 bits (253), Expect = 3.193e-21
Identity = 234/1043 (22.44%), Postives = 372/1043 (35.67%), Query Frame = 1
Query:  328 GQCQNG----KCICESGYF--GEDCNTAIISTCYVKID---RGLCKSTPENLQ-----------------LSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDECQFK-SICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIK----KTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLV--------------SRYCSKSEYYSLCEGGSCVDLN-------------------NDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVR------YKQTEPPA--------------------VRLCSKW-------------EYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLI----------------NYVTTEPTTKYCDILVNRLR--------CASGNCVNDRCICG--PGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYG-------CFDENSISTCSCSENYENLFDTGLCI 3030
            G+C+N     KC C +G+    E+ N   I  C +  D    G+C +TP + +                 +  +EC     +  G  CV  + ++   CP G     +R  C DI+EC    ++C NG+C+N  G+++C C P +    +   C    D+C +    C    +C   S+G Y C C + Y++  +G+SC      + N ++C+         G+C      Y C C  GF  S D K+CI  +  D+  +P I   C  G C +    + C C   Y        C      E                 S  CS  E + +  G  C+DL+                     Y C CSEGF  T +   C  ++    +CA N   C+ G+C  +    Y C+C  GF  + + RSC   +           + + C  G C  + P  + C C +GY        C   ++  D          C  G CV+    Y C C   +  +  G  CV       Y +  P                        L   W             EYY+LC GGE                     G + + I   + E+ D      QE    C GG CI   T+G F+C C  G+  + + R C  E +D+C  +  +C PG C  +   N+ C+CP        GH+C+                 N +    T + C    N  +        C +    + + ICG  PG+       +   I++   I  +                ++ C+C  G+  ++    C   +      ++C  + +   +          Y C C  G+K + +      +D  +C      C  G C D+   Y CIC   +  +++   C+         D+ E           C R      C  G C      Y C C   F+  + +++C+ D ++C   F+G       CF+E     C C+E YE   D   CI
Sbjct: 1080 GKCRNTIGSFKCRCNNGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCT-DIDECMIMNGGCDT--QCT-NSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDG--------GQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDL--NPNI---CMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGW-VGNGIKCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGF--TGDGFTCSDVD----ECAENTNLCENGQCLNVPGA-YRCECEMGFTPASDSRSCQDIDECS--------FQNICVFGTCNNL-PGMFHCICDDGYELDRTGGNCTDIDECAD-------PINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGE---------------------GFRPNPI-TIILEDIDE----CQELPGLCQGGNCI--NTFGSFQCECPQGYYLSEETRIC--EDIDECFAHPGVCGPGTCYNT-LGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQI-----GSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINS-------PGSYRCECAAGFKLSPNGA---CVDRNECLEIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCM---------DVDE-----------CER----HPCGNGTCKNTVGSYNCLCYPGFELTH-NNDCL-DIDECSS-FFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCI 2008          

HSP 9 Score: 94.3597 bits (233), Expect = 7.975e-19
Identity = 176/760 (23.16%), Postives = 273/760 (35.92%), Query Frame = 1
Query:  307 TNNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKI---DRGLCKSTPENLQLSKE----------ECCSIFQVAWGNPCVFCDRNYCPKGF----------TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-QYRRDQCQL-YG--------------------SSCGIFGK--------CVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENR-------RRCIKIETITSQCALNQFQCQGGRCQELDN-----------------NNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENG-----RKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEK 2313
            T+ CS   QC N     +C C  G+ G+    + +  C       + G C + P   +   E           C  I + ++ N CVF   N  P  F           +    C DIDEC     C+NG C+N  G + C CPPD  L+   + C   R   C L +G                    S C   GK        C P +  +Y  +C        N  + I + + + C     LC   G C     S+ C CP G++ SE+ + C      DI +       C  G+C +    Y C+C  EY   N    C+       +   +C +S   + CE     ++     C C+       N+             +TI        F    G+  ++D                   ++ C+C  GF  ++    C   +   N  ++C+       +       P  Y C C  G+  S +     +NE         EI   C  G CV    SY+C+C+  + +S +   C+   + E               C  G C +T  +Y C C  G+  T N       +CS    QV                 C  GRC  ++   FKCLC  G+    DG++C     ++C+     C+PG C+    S FRC+CP    +  +  +C+ IN    +P             C  G+C N     +CIC PG+  S++G+ C+   +
Sbjct: 1409 THQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILE-DIDECQELPGLCQ-GGNCINTFGSFQCECPQGYYLSEETRIC-----EDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMD------MRKSFCYRSYNGTTCENELPFNVTKRMCC-CTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINS-------PGSYRCECAAGFKLSPNGACVDRNECL-------EIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCMDVDECE------------RHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQV-----------------CRNGRCF-NEIGSFKCLCNEGYELTPDGKNCID--TNECVALPGSCSPGTCQNLEGS-FRCICPPGYEVRSE--NCIDINECDEDPNI-----------CLFGSCTNTPGGFQCICPPGFVLSDNGRRCFDTRQ 2094          
BLAST of Fibrillin-2 vs. Ensembl Mouse
Match: Fbn1 (fibrillin 1 [Source:MGI Symbol;Acc:MGI:95489])

HSP 1 Score: 145.976 bits (367), Expect = 1.166e-34
Identity = 233/957 (24.35%), Postives = 373/957 (38.98%), Query Frame = 1
Query:  382 CNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-YCPKGFTQ-KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC----------QYRRDQCQL--------------YGSSCGIFG--KCVPTSDGQYTCICIKPYSVSF----NGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQ-SPEIAERCRGGSCVSEGKGYRCLCNGEYQ-GYNNDQECVRYG--TSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVN--------EYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTR------------KEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCP---YCFYG-CFDENSISTCSCSENYENLFDTGLCIIKSDEISY 3054
            C   I  TC+  +  G C+       L K ECCS    AWG+PC  C  +  C KGF++ K  +C+DI+EC+ F  +C NG C+N +GSF+C+CP    LD     C          +Y  ++C L               G++ G     +C   +  +Y  +C +    +     NGK   K  + N C     LC  +G+C+    S+ C C SGF    ++++C   ++ D C+ SP++  R   G CV+    + C C+  Y+ G+   + C+       +PL            LC GG C +    Y C+C  G   + N   CI I    ++C L+   C  GRC  L    Y+C C  G+  + +   C+  +        CE +                Y C+C  G++   D++ C   ++ +D   N  I   C GGQC +    YRC+C+  +++S + + CV   + +             ++C  G C +T  ++ C C  GY   +    C+ I +              E  +   G   +   T G FKC C PG+    DG  C    +D+C N  ++C+     ++   ++RC+C      + DG +C          T   +   N   C +G C+N     RC C  G+  S DGK C  I++ S         C            + C+C  GY    +G +C      L   +        C +G C       Y C C   ++    +  C+   +  C ++        +  C       +     C  +G       G  C L      SV+ SE     P  + F               +E+   CQ GKC+     +QC+CP  +  N  D     D N+C     C  G C++     TC C  +Y  +     C+     + Y
Sbjct:  847 CIETIKGTCWQTVIDGRCEININGATL-KSECCSSLGAAWGSPCTICQLDPICGKGFSRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICLDIRLETCFLKYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFK--DINECKMIPSLCT-HGKCRNTIGSFKCRCDSGFALDSEERNC---TDIDECRISPDLCGR---GQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPL------------LCRGGICHNTEGSYRCECPPGHQLSPNISACIDI----NECELSANLCPHGRCVNLIGK-YQCACNPGYHPTHDRLFCVDIDECSIMNGGCETFCTNSD---------GSYECSCQPGFALMPDQRSCTDIDECED---NPNI---CDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNP----------NICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINEC-------------EIGAHNCGRHAVCTNTAGSFKCSCSPGWIG--DGIKCTD--LDECSNGTHMCSQHADCKNTMGSYRCLC--KDGYTGDGFTC----------TDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGL------FRCECEIGYELDRSGGNCTDVNECLDPTT--------CISGNCVNT-PGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAW----GTPCEL----CPSVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLN-EDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCY 1698          

HSP 2 Score: 116.701 bits (291), Expect = 1.293e-25
Identity = 225/934 (24.09%), Postives = 344/934 (36.83%), Query Frame = 1
Query:  574 DIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCN-GEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNN---------------------------------------NYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCI--KNEQYK--------------------DYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNN------------------------GQECVRYKQTEPPAVRLC---SKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSR-----------IEKQV-----------------TEEPDNSYCL----LQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNN--ENICTPGRCERSGNSNFRC-------------VCPY-----YASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKG-GYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            DIDEC +   +C NG CIN  GSFRC+CP   + ++  + C+   D+CQ  G  C    +C+ T+ G Y C C   Y ++  G+      + N C     +C  +G+C     S+YC C +GF  + D+  C+     DI +    A  C  G+C +    + C CN G    +NND  C+               +   +LC  G CV+    + C+C+EG+    + R C+ I    ++C L+  +C  G CQ LD +                                       +++C C  GF  S  GR C   +  R S    +  G +C +         E  CA L+G    +  + C    +E ++                    D C+  ++   CR GQC++   SYRC C   YI   N                        G EC   +  EP  +  C   ++     L     CV+T  +Y CKC  GY   E+ R C              EKQ+                    PD   C+     Q     C  GRC+ +    + C C  GFT++     C       C +   +N+C  G   R+  +   C             +CP+     Y  L   G   + N    +      D+      C +G CVNDR    CIC  GY     G  C  + + +         C+        + +Y+C C  GYI  E+GRSC   +    K+  C      C   I        + C C  G+ Q     +CI  DN +C  +   C   G C +    + C C   +++ ++G  C       + VD  E ++                +CQ G C      Y+C CP  +  +Y  ++CV D N+C
Sbjct: 1768 DIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCE-DIDECQ-NGPVCQRNAECINTA-GSYRCDCKPGYRLTSTGQC----NDRNECQEIPNIC-SHGQCIDTVGSFYCLCHTGFKTNVDQTMCL-----DINECERDA--CGNGTCRNTIGSFNCRCNHGFILSHNND--CIDVDEC---------ATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDI----NECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRC---QDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCA-LKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDV---CRHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPGICENGRCL-NTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFEGTVAYKKLCPHGRGFMTNGADIDECKVIHDV------CRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNT------EGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQF---LCVNTI------GGFTCKCPPGFTQ--HHTACI--DNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASC-------EDVDECEGNH----------------RCQHG-CQNIIGGYRCSCPQGYLQHYQWNQCV-DENEC 2613          

HSP 3 Score: 109.383 bits (272), Expect = 2.076e-23
Identity = 219/950 (23.05%), Postives = 348/950 (36.63%), Query Frame = 1
Query:  325 KGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVC--NYFKKLCL-------------------PYGE-CQP----YGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALN--------QFQCQGGRCQELDNNNYEC-QCLRG--FIRSENGRSCIKAE----RTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ------------TEPPAVRL------CSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQE------YLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENIC-------TPG----RCERSGNSNF-------------------------------RCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKC 2826
            K  C  G+CI   G +   C     ST    + R  C+   E LQ  +        +     C+  D ++   C  GF  T+    C+D+DEC  +++CLNG CINE GSF+C C P   L  +   C+   ++C+  G    + G+CV T DG Y C C    +V  +G+ C+     + C   Y +  C+                    +GE CQP        Y   C SG          + ++ +DI +     + C  G C +    Y+C+CN  Y+     + CV    +E +++          LC+ G C +    + C C +GF    + + C  I+   S   +N         F C+      LD     C + ++G  +    +GR  I       ++   +S+   +G  C      PI        C +G+S+       IK  Q +D  + +     C+ G CV++  S++C C         G+ C+  +             T P A R       CS    +   +  EC                + E    C R     T++  N     ++        S C  G+C  +    FKC C  GF   S+ R+C    +D+C  + ++C       TPG    +C+    S F                               RC CP    LS +  +C+            C++  N   C  G CVN     +C C PGY  + D   C  I++ S +    +  C         D +YEC C  G+    + RSC   +      +ICD        G C  I   +Y C C  G+  + D K+C+  D  +C +N   C  G C +    ++C C   Y+  +    C         ++  E+   N    + CT      KC
Sbjct:  498 KNPCTGGECINNQGSYTCHCRAGYQST----LTRTECRDIDECLQNGR--------ICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCK-DINECETPGIC--MNGRCVNT-DGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPG--------MTSAGTDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDI--NECVLNSL--------LCDNGQCRNTPGSFVCTCPKGFVYKPDLKTCEDIDECESSPCINGVCKNSPGSFICECSPESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQLDPI--------CGKGFSR-------IKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICLDIRLETCFLKYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEEC------------PLRNSREYEELCPRGPGFATKDITNGKPFFKDINECKMIPSLCTHGKCR-NTIGSFKCRCDSGFALDSEERNCTD--IDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGICHNTEGSYRCECPPGHQLSPNISACI--------DINECELSAN--LCPHGRCVNLIGKYQCACNPGYHPTHDRLFCVDIDECSIMNGGCETFCTNS------DGSYECSCQPGFALMPDQRSCTDIDECEDNPNICD-------GGQCTNI-PGEYRCLCYDGFMASEDMKTCV--DVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCT-------DINECEIGAHNCGRHAVCTNTAGSFKC 1350          

HSP 4 Score: 107.457 bits (267), Expect = 7.326e-23
Identity = 125/478 (26.15%), Postives = 195/478 (40.79%), Query Frame = 1
Query:  328 GQCQNG----KCICESGYF--GEDCNTAIISTCYVKID---RGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSI-CLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAV 1731
            G+C+N     KC C+SG+    E+ N   I  C +  D   RG C +TP + +                    CD  Y   GF   +N C DIDECQ   + C  G C N +GS+RC+CPP H L  N  +C    ++C+L  + C   G+CV    G+Y C C   Y  + +   C+   + + C+     C  +  C     SY CSC  GF    D++SC     +DI +  +    C GG C +    YRCLC   +    + + CV     +             ++C  G+C +    + C C  G+   + +  C  I    ++C +    C           +++C C  G+I   +G  C   +   N T +C  +   C+  +        Y C C +GY+   D   C       D  +  E    C  GQC++    YRC C   ++ S +G+ C    +   P +
Sbjct: 1044 GKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECK------------------CDEGY-ESGFMMMKN-CMDIDECQRDPLLCRGGICHNTEGSYRCECPPGHQLSPNISAC-IDINECELSANLC-PHGRCV-NLIGKYQCACNPGYHPTHDRLFCV---DIDECSIMNGGCETF--CTNSDGSYECSCQPGFALMPDQRSC-----TDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECD----------LNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDI----NECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIG--DGIKCTDLDECSNGTHMCSQHAD-CKNTM------GSYRCLCKDGYTG--DGFTCT------DLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNI 1457          

HSP 5 Score: 107.071 bits (266), Expect = 1.100e-22
Identity = 158/624 (25.32%), Postives = 242/624 (38.78%), Query Frame = 1
Query:  346 KCICESGY----FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQ-VAWGNPCVFCD-------RNYCPKG---FTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRY---KQTEPPAVRLCSKWE--YYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENIC-TPGRCERSGNSNFRCVCPYYASLSKDGHSC 2154
            KC+C  G+     G  C    +S CY K + G C S+P++   SK+ECC   +   WG+PC  C        R  CP G       ++   D+DEC+   +C +G+CIN  GS+RC+CP  + L+ N        D+C + G+ CG  G C     G + C C +     F     +   + N C     LC  +     YG SY C CP G+   ED++ C    + D C   +     +   C +    Y C+C   YQ   + + C+     +              +CE G C++    Y C+C++GF A+  +  C+          + Q  CQ G          EC C       + GR                 +G  C+          + +C    G+         + N    D C+   I   CR G+CV++  SY C+C   Y     G  CV      Q   P   +C   E  Y   C  G  +                 E+GR C  +++  T++ +  +  +            IG    GF C C PGFT      +C     ++C ++ N+C + G C+ +  S F C C    SL + G SC
Sbjct: 2039 KCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKC-SSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGYILEGNEC---VDTDECSV-GNPCG-NGTCKNVIGG-FECTCEE----GFEPGPMMTCEDINECAQNPLLCA-FRCVNTYG-SYECKCPVGYVLREDRRMC---KDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQ----------TKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCC-------DGGRG----------------WGPHCEICPFEGTVAYKKLCPHGRGF---------MTNGADIDECK--VIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQ----------------EDGRSCKDLDECATKQHNCQFLCVNT----------IG----GFTCKCPPGFTQHH--TACIDN--NECTSDINLCGSKGVCQNTPGS-FTCECQRGFSLDQSGASC 2567          

HSP 6 Score: 103.219 bits (256), Expect = 1.676e-21
Identity = 189/773 (24.45%), Postives = 295/773 (38.16%), Query Frame = 1
Query:  535 CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQ-YRRDQC--QLYGSSCGIFGKCVPTSDGQYTCI--------------CIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPY-GL-----------SYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQ----GYNNDQ-ECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK-NEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPP--AVRLCSKWE--YYSLC-QGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQE-YLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CP G+   E+   CDD++EC+   IC  G C N  G++ C CPPD+       +C   RR  C    Y  +    G+ +     +  C               C  P +  F    C  +    V + +  L +   EC+   G+           S+ C CP GF  ++     +V  + D CQ+  + +  R   C++    YRC C   Y+    G  ND+ EC                 E  ++C  G C+D    +YC C  GF    ++  C+ I    ++C  +   C  G C+     ++ C+C  GFI S N   CI  +            G+ C+ G C       + C C EGY  + D + C+  NE   D         +C  G C +   SYRC+C   Y   N+  E +     EP   A+  CS  E  +  LC +G     T         +  YA   G KCS  + +   + +    L  E +   C       D+ +   C    G     D  + D   +D+C    ++C  G+C  +  S +RC CP+   L  +G+ C+         T  C +      C +G C N   + G    + E+G E   +     I    Q              +YEC+C  GY+  E+ R C   +     K  C   + +CK  I        Y+C C  GY++  D + CI  D  +C      C+ G C + +  Y C C   +T +    +C+
Sbjct: 1635 CPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEF-ATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKL---LVCEDIDECQNGPVCQ--RNAECINTAGSYRCDCKPGYRLTSTGQCNDRNEC----------------QEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDI----NECERD--ACGNGTCRNTI-GSFNCRCNHGFILSHN-NDCIDVDECATGN------GNLCRNGQCVNTV-GSFQCRCNEGYEVAPDGRTCVDINECVLD-------PGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVD---MDEC-KEPDVCRHGQCINTDGS-YRCECPFGYIL--EGNECV--------DTDECSV---GNPCGNGTCKN---VIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLI------GTYMCICGPGYQRRPDGEGCI--DENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECL 2334          

HSP 7 Score: 98.5969 bits (244), Expect = 3.828e-20
Identity = 219/927 (23.62%), Postives = 328/927 (35.38%), Query Frame = 1
Query:  454 LQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVC--NYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGG----RCQELDNN--NYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK-NEQYKDYCQNQEI---------------------------------SKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ--TEP----PAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNF---RCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKS---------------ICDLHREKCKTGICYPI---GQNDYICA-------------CVLGYKQATDKKSCIIMDNPKCAVNEYRC--KGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCF 2946
            + +SK  CC     AWG PC  C        +  CP G   + N      +DIDECQ    +C  G+CIN  GSF+C+CP  +YL+E+T  C    ++C+  G  CG  G C  T  G YTCIC   Y     G +C+     ++C  NY+       GE         C C     ++ +K         + C  P   E             +  LC  +  G+      +   T  P+    C   E   +CE G C+++   + C+C  GF+  +    C  I+           +CQ G    R  E  N   +Y C C  G+  +  G+         N  + C+   + C  G C       + C C  G+  + D+  C+  NE  +D C N                                       CR GQCV+   S++C C+  Y  + +G+ CV   +   +P    P         Y  +C  G  +  +                  KC  I++ V EEP+            C  G C  +    FKCLC  GF+ +S GR C    +  C         G+C    + N     C C    +L  +G         TEP   +      R  C  G+ +    I GP   S+ D  EC + +                G     D +Y C+C  GYI    G  C+ ++   +                   C+   E      C  I    QN  +CA             C +GY    D++ C   D  +CA  ++ C  K   C +++  Y+CIC   Y    +G  CI                     ++ C  K  I  C+ G+C+     Y C+C   F  +    EC+   N+  YCF
Sbjct: 1557 VGVSKASCCCSLGKAWGTPCELCPSVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCD-DVNECETPGI-CGP-GTCYNTV-GNYTCICPPDYMQVNGGNNCMD-MRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPC-------EQCPIPSTDE-------------FATLCGSQRPGF-----VIDIYTGLPVDIDECR--EIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDID-----------ECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTGQC--------NDRNECQEIPNICSHGQCIDTV-GSFYCLCHTGFKTNVDQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDINECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQND------------------KCEDIDECV-EEPE-----------ICALGTC-SNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFE---GGKCSSPKSRNHSKQECCC----ALKGEGWGDPCELCPTEPDEAF------RQICPFGSGI----IVGPD-DSAVDMDECKEPDVCRH------------GQCINTDGSYRCECPFGYILE--GNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMC--KDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCI--------------------DENECQTKPGI--CENGRCLNTLGSYTCECNDGFTASPTQDECL--DNREGYCF 2342          

HSP 8 Score: 92.8189 bits (229), Expect = 2.309e-18
Identity = 226/1018 (22.20%), Postives = 372/1018 (36.54%), Query Frame = 1
Query:  307 TNNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKID---RGLCKSTPENLQ----------LSKEECCSIFQVAWGNPCVFCDRNYCPKGF----------TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-QYRRDQCQL----------------------YGSSCGIFGK--------CVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRY-----CSKSEYYSLCEGGSCVDLN-----NDYYCQC---SEGFYAT--ENRRRCIKIETITS------QCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIE-----------KVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQ-----NDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFD-----ENSIST--CSCSENYENLFDTGLCIIKSD 3042
            T+ CS    C+N     +C+C+ GY G+      +  C   ++    G C + P   +             + C  I + +  N CVF   +  P  F           +    C D++EC   + C++G C+N  GS+ C CPPD  L+   + C   R   C L                        S C   GK        C   +  +Y  +C        N  + I + + + C     LC   G+C     S+ C CP+G++ +ED + C    + + C++P I   C  G+C +    Y C+C  +Y   N    C+    S    + Y     C     +++ +   C   N     N    QC   S   +AT   ++R    I+  T       +C      C+ G C  +   ++ C+C  GF  ++    C   +  +N        G  CQ           Y C C  GY  +          Q  D  + QEI   C  GQC+    S+ C+CH  + ++ +   C+   + E  A            C  G C +T  ++ C+C +G+  + N   C  +++  T   +            C  G+C+ +    F+C C  G+  A DGR+C    +++C+ +   C PG C+    S +RC+CP   SL  D     I+    EP             CA G C N     +C+C  G+  S  G+ C  +            K SS  S N  + +     + +     C+           + C      ++      +  ++CK       GQ       Y C C  GY    +   C+  D  +C+V    C  G C +++ G+ C C   +               +   DI+E + QNP   +F             +CV     Y+CKCP  +     D    +D ++C    + C +     +N I T  C C   Y+   D   CI +++
Sbjct: 1373 THMCSQHADCKNTMGSYRCLCKDGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPSVNTSEYKILCPGGEGFRPNPITVILE-DIDECQELPGLCQ-GGKCINTFGSFQCRCPTGYYLNEDTRVC---DDVNECETPGI---CGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINM-VGSFRCECPVGFFYNDKLLVCEDIDECQN--------GPVCQRNAECINTAGSYRCDCKPGYRLT-------STGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINECERDA------------CGNGTCRNTIGSFNCRCNHGFILSHN-NDCIDVDECATGNGN-----------LCRNGQCV-NTVGSFQCRCNEGYEVAPDGRTC--VDINECVLDPGKCAPGTCQNLDGS-YRCICPPGYSLQNDKCE-DIDECVEEPEI-----------CALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGY--ILEGNECV--DTDECSVGN-PCGNGTCKNVIGGFECTCEEGFEPGP----------MMTCEDINECA-QNPLLCAF-------------RCVNTYGSYECKCPVGYVLR-EDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENE 2296          

HSP 9 Score: 92.4337 bits (228), Expect = 2.876e-18
Identity = 73/267 (27.34%), Postives = 108/267 (40.45%), Query Frame = 1
Query:  148 CCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCI 831
            CC GW     G+ C+   C + CG G C   N+C C    I + +C   + + C+  C N G C +  C+C+ GY G  C   +                                    C+  +   +C+     +  +K  CC+    AWG+PC  C    + C +GF    +   C D+DECQ    +C  G CIN  GSF C+CP  H  +E +  C+   D+C      C   G+C  T    Y C C   +  S +G  C+
Sbjct:   67 CCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQI-SPSCGSRSIQHCSIRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERDYRTGPCFTVVSNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGMCQGGNCINTVGSFECKCPAGHKFNEVSQKCE-DIDECSTIPGVCD-GGECTNTVS-SYFCKCPPGFYTSPDGTRCV 329          

HSP 10 Score: 88.1965 bits (217), Expect = 6.445e-17
Identity = 191/879 (21.73%), Postives = 315/879 (35.84%), Query Frame = 1
Query:  526 RNYCPKGFTQKENR--CDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAE----------RTRNSTSIC------------------ELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAV-------------RLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLC---LPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCP----YYASLS--------KDGHSCLINYVTTEPTTKY-CDILVNRLRCASGNCVNDR-----------------------CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHEC 2913
            R  C  GF   E+   C D++EC    +ICL+G C N KGSF C C   +   +    C    ++C++   +CG    C  T+ G + C C    S  + G   IK T+ + C+    +C  + +C+    SY C C  G+  + D  +C     +D+ +  E    C  G C++   GYRC C+  +    + + C               +    ++C  G+C +L   + C+C  G+    +   C  +        L+   C  G C     + Y C C   F  +     C+             R  N  + C                  + +G  C+  +C  +  +EY   C  G     +    I     +D  + QE+   C+GG+C++   S++C C   Y  + + + C    + E P +                   +Y  +  G  C+D   +   +       T +G     + K++      SY + + +   C   +C    T  F  LC    PGF    D  +  P  +D+C     +C  G C     S FRC CP    Y   L         ++G  C  N         Y CD        ++G C NDR                       C+C  G+K++ D   C  I +       N               ++ C+C +G+I S N       E A    ++C       + G C       + C C  GY+ A D ++C+ ++  +C ++  +C  G C ++   Y CIC   Y++  +           K  DI E               E  E C  G C   +  ++C CP  F  +     C
Sbjct: 1264 RCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCT-DINECEIGAHNCGRHAVCTNTA-GSFKCSC----SPGWIGDG-IKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKDGY--TGDGFTC-----TDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDI-----------DECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNE-----CLDPTTCISGNCVNTPGS-YTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCE--LCPSVNTSEYKILCPGGEGFRPNPITVI----LEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCC---CSYNIGRAWNKPCE--QCPIPSTDEFATLCGSQRPGF--VIDIYTGLPVDIDECREIPGVCENGVCINMVGS-FRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTGQC-NDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINECERDACGNGTCRNTI-------GSFNCRCNHGFILSHNNDCIDVDECATGNGNLC-------RNGQCVNT-VGSFQCRCNEGYEVAPDGRTCVDIN--ECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQND-----------KCEDIDECV-------------EEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRC 2055          

HSP 11 Score: 78.5666 bits (192), Expect = 5.539e-14
Identity = 109/435 (25.06%), Postives = 178/435 (40.92%), Query Frame = 1
Query: 1426 NSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCAS---GNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDC 2721
            N T  C+L  + CQ G C P  P  Y C C +G+ Q + R  CI      D C+       C GG+C++N  SY C C   Y S+    EC    +            +   +C  G C++T+ +++C C  G++ T +G+ C  +++          C ++   + C+ G CI ++   FKC+C PGF  ASDGR C  + +++C     IC  GRC  +  S +RC C    ++  DG  C+  ++ +     Y      R +C     G      C C     +   G+ C      +S                     Y+  C +G   +          SA    + C L  + C  GIC  + +  Y C C  GY+     K+C+ ++  +C +N   C  G C +    ++C C   +    + + C
Sbjct:  450 NVTDYCQLVRYLCQNGRCIPT-PGSYRCECNKGF-QLDIRGECID----VDECEKNP----CTGGECINNQGSYTCHCRAGYQSTLTRTECRDIDEC----------LQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDE----------CSIR---NMCLNGMCI-NEDGSFKCICKPGFQLASDGRYC--KDINEC-ETPGICMNGRCVNTDGS-YRCECFPGLAVGLDGRVCVDTHMRSTCYGGY-----RRGQCVKPLFGAVTKSECCCASTEYAF--GEPCQPCPAQNSA-------------------EYQALCSSGPGMT----------SAGTDINECALDPDICPNGICENL-RGTYKCICNSGYEVDITGKNCVDIN--ECVLNSLLCDNGQCRNTPGSFVCTCPKGFVYKPDLKTC 807          

HSP 12 Score: 75.0998 bits (183), Expect = 5.101e-13
Identity = 110/422 (26.07%), Postives = 159/422 (37.68%), Query Frame = 1
Query:  310 NNCSNK-GQCQNGKCICESGYFGEDCNTAIIST-------------CYVKIDRGLCKSTPENLQ-LSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSC-------IKKTN-----------------------------YNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGR 1398
            N C  K G C+NG+C+   G +  +CN    ++             C+ ++ + +C+    N   ++K ECC      WG  C  C        +  CP G     N   DIDEC+    +C NGEC+N++GS+ C C   +  D    +C    ++C      C    K    ++G Y C C K Y +  +G+SC        K+ N                              N C     LC   G CQ    S+ C C  GF   +   SC    + D C   E   RC+ G C +   GYRC C   Y  +    +CV    +E L +          +C G SC +    Y C C  GF   +    C  I    ++C  +Q  C  G C   +   Y C C  G+ R   G 
Sbjct: 2295 NECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFEGTVAYKKLCPHGRGFMTNG-ADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTAC-VDLNECNQAPKPCNFICK---NTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASC---EDVDEC---EGNHRCQHG-CQNIIGGYRCSCPQGYLQHYQWNQCVD--ENECLSAH---------VCGGASCHNTLGSYKCMCPTGFQYEQFSGGCQDI----NECGSSQAPCSYG-CSNTE-GGYLCGCPPGYFRIGQGH 2687          

HSP 13 Score: 69.3218 bits (168), Expect = 3.031e-11
Identity = 89/346 (25.72%), Postives = 131/346 (37.86%), Query Frame = 1
Query: 1927 CMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSE-------------------SALIKKSICDLHREKCKTGICYP-IGQN--DYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            C GG CI ++   + C C  G+ S      C    +D+CL N  IC  GRC  +  S F CVC     +++DG +C             C I   R  C +G C+N+    +CIC PG++ + DG+ C  I +  +       +C         D +Y C+C  G     +GR C+ +                     A+ K   C    E      C P   QN  +Y   C  G    +        D  +CA++   C  G C ++   Y CIC   Y V   G++C         VDI+E           C    ++  C  G+C      + C CP  F
Sbjct:  501 CTGGECINNQG-SYTCHCRAGYQSTLTRTEC--RDIDECLQNGRICNNGRCINTDGS-FHCVCNAGFHVTRDGKNC--------EDMDECSI---RNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNT------DGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAG-----TDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNC---------VDINE-----------CVLNSLL--CDNGQCRNTPGSFVCTCPKGF 798          

HSP 14 Score: 63.1586 bits (152), Expect = 2.148e-9
Identity = 126/563 (22.38%), Postives = 205/563 (36.41%), Query Frame = 1
Query: 1135 VSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVT--EEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLP----------GFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICD------LHREKCKTGICYPIG----------QNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            V+ YC    Y  LC+ G C+     Y C+C++GF   + R  CI ++    +C  N   C GG C   +  +Y C C  G+  +     C   +        C   G  C  G C       + C C  G+  + D K C    +  D C    I   C  G C++   S++C+C   +  +++G+ C    + E P +           C  G CV+T+ +Y C+C  G     +GR C     + T         C+   + +      C     Y F   C P             S+  G +     +++C  + +IC  G CE      ++C+C     +   G +C+ IN           + ++N L C +G C N      C C  G+    D K C  I++  S            G  +    ++ C+C            CI++      +++ D      ++    K+  C  +G          Q D IC      K  +  K     D  +C V    CK G C +    + C C    T+   GR C+
Sbjct:  451 VTDYCQLVRY--LCQNGRCIPTPGSYRCECNKGF-QLDIRGECIDVD----ECEKNP--CTGGECIN-NQGSYTCHCRAGYQSTLTRTECRDIDE-------CLQNGRICNNGRCINT-DGSFHCVCNAGFHVTRDGKNC----EDMDECS---IRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGI-----------CMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGTDINECALDPDICPNGICENL-RGTYKCICNSGYEVDITGKNCVDIN-----------ECVLNSLLCDNGQCRNTPGSFVCTCPKGFVYKPDLKTCEDIDECES-------SPCINGVCKNSPGSFICECSPESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQLDPICG-----KGFSRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICL 953          
BLAST of Fibrillin-2 vs. Ensembl Mouse
Match: Fbn1 (fibrillin 1 [Source:MGI Symbol;Acc:MGI:95489])

HSP 1 Score: 145.976 bits (367), Expect = 1.166e-34
Identity = 233/957 (24.35%), Postives = 373/957 (38.98%), Query Frame = 1
Query:  382 CNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-YCPKGFTQ-KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC----------QYRRDQCQL--------------YGSSCGIFG--KCVPTSDGQYTCICIKPYSVSF----NGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQ-SPEIAERCRGGSCVSEGKGYRCLCNGEYQ-GYNNDQECVRYG--TSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVN--------EYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTR------------KEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCP---YCFYG-CFDENSISTCSCSENYENLFDTGLCIIKSDEISY 3054
            C   I  TC+  +  G C+       L K ECCS    AWG+PC  C  +  C KGF++ K  +C+DI+EC+ F  +C NG C+N +GSF+C+CP    LD     C          +Y  ++C L               G++ G     +C   +  +Y  +C +    +     NGK   K  + N C     LC  +G+C+    S+ C C SGF    ++++C   ++ D C+ SP++  R   G CV+    + C C+  Y+ G+   + C+       +PL            LC GG C +    Y C+C  G   + N   CI I    ++C L+   C  GRC  L    Y+C C  G+  + +   C+  +        CE +                Y C+C  G++   D++ C   ++ +D   N  I   C GGQC +    YRC+C+  +++S + + CV   + +             ++C  G C +T  ++ C C  GY   +    C+ I +              E  +   G   +   T G FKC C PG+    DG  C    +D+C N  ++C+     ++   ++RC+C      + DG +C          T   +   N   C +G C+N     RC C  G+  S DGK C  I++ S         C            + C+C  GY    +G +C      L   +        C +G C       Y C C   ++    +  C+   +  C ++        +  C       +     C  +G       G  C L      SV+ SE     P  + F               +E+   CQ GKC+     +QC+CP  +  N  D     D N+C     C  G C++     TC C  +Y  +     C+     + Y
Sbjct:  847 CIETIKGTCWQTVIDGRCEININGATL-KSECCSSLGAAWGSPCTICQLDPICGKGFSRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICLDIRLETCFLKYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFK--DINECKMIPSLCT-HGKCRNTIGSFKCRCDSGFALDSEERNC---TDIDECRISPDLCGR---GQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPL------------LCRGGICHNTEGSYRCECPPGHQLSPNISACIDI----NECELSANLCPHGRCVNLIGK-YQCACNPGYHPTHDRLFCVDIDECSIMNGGCETFCTNSD---------GSYECSCQPGFALMPDQRSCTDIDECED---NPNI---CDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNP----------NICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINEC-------------EIGAHNCGRHAVCTNTAGSFKCSCSPGWIG--DGIKCTD--LDECSNGTHMCSQHADCKNTMGSYRCLC--KDGYTGDGFTC----------TDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGL------FRCECEIGYELDRSGGNCTDVNECLDPTT--------CISGNCVNT-PGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAW----GTPCEL----CPSVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLN-EDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCY 1698          

HSP 2 Score: 116.701 bits (291), Expect = 1.293e-25
Identity = 225/934 (24.09%), Postives = 344/934 (36.83%), Query Frame = 1
Query:  574 DIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCN-GEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNN---------------------------------------NYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCI--KNEQYK--------------------DYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNN------------------------GQECVRYKQTEPPAVRLC---SKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSR-----------IEKQV-----------------TEEPDNSYCL----LQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNN--ENICTPGRCERSGNSNFRC-------------VCPY-----YASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKG-GYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            DIDEC +   +C NG CIN  GSFRC+CP   + ++  + C+   D+CQ  G  C    +C+ T+ G Y C C   Y ++  G+      + N C     +C  +G+C     S+YC C +GF  + D+  C+     DI +    A  C  G+C +    + C CN G    +NND  C+               +   +LC  G CV+    + C+C+EG+    + R C+ I    ++C L+  +C  G CQ LD +                                       +++C C  GF  S  GR C   +  R S    +  G +C +         E  CA L+G    +  + C    +E ++                    D C+  ++   CR GQC++   SYRC C   YI   N                        G EC   +  EP  +  C   ++     L     CV+T  +Y CKC  GY   E+ R C              EKQ+                    PD   C+     Q     C  GRC+ +    + C C  GFT++     C       C +   +N+C  G   R+  +   C             +CP+     Y  L   G   + N    +      D+      C +G CVNDR    CIC  GY     G  C  + + +         C+        + +Y+C C  GYI  E+GRSC   +    K+  C      C   I        + C C  G+ Q     +CI  DN +C  +   C   G C +    + C C   +++ ++G  C       + VD  E ++                +CQ G C      Y+C CP  +  +Y  ++CV D N+C
Sbjct: 1768 DIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCE-DIDECQ-NGPVCQRNAECINTA-GSYRCDCKPGYRLTSTGQC----NDRNECQEIPNIC-SHGQCIDTVGSFYCLCHTGFKTNVDQTMCL-----DINECERDA--CGNGTCRNTIGSFNCRCNHGFILSHNND--CIDVDEC---------ATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDI----NECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRC---QDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCA-LKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDV---CRHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPGICENGRCL-NTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFEGTVAYKKLCPHGRGFMTNGADIDECKVIHDV------CRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNT------EGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQF---LCVNTI------GGFTCKCPPGFTQ--HHTACI--DNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASC-------EDVDECEGNH----------------RCQHG-CQNIIGGYRCSCPQGYLQHYQWNQCV-DENEC 2613          

HSP 3 Score: 109.383 bits (272), Expect = 2.076e-23
Identity = 219/950 (23.05%), Postives = 348/950 (36.63%), Query Frame = 1
Query:  325 KGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVC--NYFKKLCL-------------------PYGE-CQP----YGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALN--------QFQCQGGRCQELDNNNYEC-QCLRG--FIRSENGRSCIKAE----RTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ------------TEPPAVRL------CSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQE------YLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENIC-------TPG----RCERSGNSNF-------------------------------RCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKC 2826
            K  C  G+CI   G +   C     ST    + R  C+   E LQ  +        +     C+  D ++   C  GF  T+    C+D+DEC  +++CLNG CINE GSF+C C P   L  +   C+   ++C+  G    + G+CV T DG Y C C    +V  +G+ C+     + C   Y +  C+                    +GE CQP        Y   C SG          + ++ +DI +     + C  G C +    Y+C+CN  Y+     + CV    +E +++          LC+ G C +    + C C +GF    + + C  I+   S   +N         F C+      LD     C + ++G  +    +GR  I       ++   +S+   +G  C      PI        C +G+S+       IK  Q +D  + +     C+ G CV++  S++C C         G+ C+  +             T P A R       CS    +   +  EC                + E    C R     T++  N     ++        S C  G+C  +    FKC C  GF   S+ R+C    +D+C  + ++C       TPG    +C+    S F                               RC CP    LS +  +C+            C++  N   C  G CVN     +C C PGY  + D   C  I++ S +    +  C         D +YEC C  G+    + RSC   +      +ICD        G C  I   +Y C C  G+  + D K+C+  D  +C +N   C  G C +    ++C C   Y+  +    C         ++  E+   N    + CT      KC
Sbjct:  498 KNPCTGGECINNQGSYTCHCRAGYQST----LTRTECRDIDECLQNGR--------ICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCK-DINECETPGIC--MNGRCVNT-DGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPG--------MTSAGTDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDI--NECVLNSL--------LCDNGQCRNTPGSFVCTCPKGFVYKPDLKTCEDIDECESSPCINGVCKNSPGSFICECSPESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQLDPI--------CGKGFSR-------IKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICLDIRLETCFLKYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEEC------------PLRNSREYEELCPRGPGFATKDITNGKPFFKDINECKMIPSLCTHGKCR-NTIGSFKCRCDSGFALDSEERNCTD--IDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGICHNTEGSYRCECPPGHQLSPNISACI--------DINECELSAN--LCPHGRCVNLIGKYQCACNPGYHPTHDRLFCVDIDECSIMNGGCETFCTNS------DGSYECSCQPGFALMPDQRSCTDIDECEDNPNICD-------GGQCTNI-PGEYRCLCYDGFMASEDMKTCV--DVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCT-------DINECEIGAHNCGRHAVCTNTAGSFKC 1350          

HSP 4 Score: 107.457 bits (267), Expect = 7.326e-23
Identity = 125/478 (26.15%), Postives = 195/478 (40.79%), Query Frame = 1
Query:  328 GQCQNG----KCICESGYF--GEDCNTAIISTCYVKID---RGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSI-CLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAV 1731
            G+C+N     KC C+SG+    E+ N   I  C +  D   RG C +TP + +                    CD  Y   GF   +N C DIDECQ   + C  G C N +GS+RC+CPP H L  N  +C    ++C+L  + C   G+CV    G+Y C C   Y  + +   C+   + + C+     C  +  C     SY CSC  GF    D++SC     +DI +  +    C GG C +    YRCLC   +    + + CV     +             ++C  G+C +    + C C  G+   + +  C  I    ++C +    C           +++C C  G+I   +G  C   +   N T +C  +   C+  +        Y C C +GY+   D   C       D  +  E    C  GQC++    YRC C   ++ S +G+ C    +   P +
Sbjct: 1044 GKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECK------------------CDEGY-ESGFMMMKN-CMDIDECQRDPLLCRGGICHNTEGSYRCECPPGHQLSPNISAC-IDINECELSANLC-PHGRCV-NLIGKYQCACNPGYHPTHDRLFCV---DIDECSIMNGGCETF--CTNSDGSYECSCQPGFALMPDQRSC-----TDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECD----------LNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDI----NECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIG--DGIKCTDLDECSNGTHMCSQHAD-CKNTM------GSYRCLCKDGYTG--DGFTCT------DLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNI 1457          

HSP 5 Score: 107.071 bits (266), Expect = 1.100e-22
Identity = 158/624 (25.32%), Postives = 242/624 (38.78%), Query Frame = 1
Query:  346 KCICESGY----FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQ-VAWGNPCVFCD-------RNYCPKG---FTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRY---KQTEPPAVRLCSKWE--YYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENIC-TPGRCERSGNSNFRCVCPYYASLSKDGHSC 2154
            KC+C  G+     G  C    +S CY K + G C S+P++   SK+ECC   +   WG+PC  C        R  CP G       ++   D+DEC+   +C +G+CIN  GS+RC+CP  + L+ N        D+C + G+ CG  G C     G + C C +     F     +   + N C     LC  +     YG SY C CP G+   ED++ C    + D C   +     +   C +    Y C+C   YQ   + + C+     +              +CE G C++    Y C+C++GF A+  +  C+          + Q  CQ G          EC C       + GR                 +G  C+          + +C    G+         + N    D C+   I   CR G+CV++  SY C+C   Y     G  CV      Q   P   +C   E  Y   C  G  +                 E+GR C  +++  T++ +  +  +            IG    GF C C PGFT      +C     ++C ++ N+C + G C+ +  S F C C    SL + G SC
Sbjct: 2039 KCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKC-SSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGYILEGNEC---VDTDECSV-GNPCG-NGTCKNVIGG-FECTCEE----GFEPGPMMTCEDINECAQNPLLCA-FRCVNTYG-SYECKCPVGYVLREDRRMC---KDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQ----------TKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCC-------DGGRG----------------WGPHCEICPFEGTVAYKKLCPHGRGF---------MTNGADIDECK--VIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQ----------------EDGRSCKDLDECATKQHNCQFLCVNT----------IG----GFTCKCPPGFTQHH--TACIDN--NECTSDINLCGSKGVCQNTPGS-FTCECQRGFSLDQSGASC 2567          

HSP 6 Score: 103.219 bits (256), Expect = 1.676e-21
Identity = 189/773 (24.45%), Postives = 295/773 (38.16%), Query Frame = 1
Query:  535 CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQ-YRRDQC--QLYGSSCGIFGKCVPTSDGQYTCI--------------CIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPY-GL-----------SYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQ----GYNNDQ-ECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK-NEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPP--AVRLCSKWE--YYSLC-QGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQE-YLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CP G+   E+   CDD++EC+   IC  G C N  G++ C CPPD+       +C   RR  C    Y  +    G+ +     +  C               C  P +  F    C  +    V + +  L +   EC+   G+           S+ C CP GF  ++     +V  + D CQ+  + +  R   C++    YRC C   Y+    G  ND+ EC                 E  ++C  G C+D    +YC C  GF    ++  C+ I    ++C  +   C  G C+     ++ C+C  GFI S N   CI  +            G+ C+ G C       + C C EGY  + D + C+  NE   D         +C  G C +   SYRC+C   Y   N+  E +     EP   A+  CS  E  +  LC +G     T         +  YA   G KCS  + +   + +    L  E +   C       D+ +   C    G     D  + D   +D+C    ++C  G+C  +  S +RC CP+   L  +G+ C+         T  C +      C +G C N   + G    + E+G E   +     I    Q              +YEC+C  GY+  E+ R C   +     K  C   + +CK  I        Y+C C  GY++  D + CI  D  +C      C+ G C + +  Y C C   +T +    +C+
Sbjct: 1635 CPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEF-ATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKL---LVCEDIDECQNGPVCQ--RNAECINTAGSYRCDCKPGYRLTSTGQCNDRNEC----------------QEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDI----NECERD--ACGNGTCRNTI-GSFNCRCNHGFILSHN-NDCIDVDECATGN------GNLCRNGQCVNTV-GSFQCRCNEGYEVAPDGRTCVDINECVLD-------PGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVD---MDEC-KEPDVCRHGQCINTDGS-YRCECPFGYIL--EGNECV--------DTDECSV---GNPCGNGTCKN---VIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLI------GTYMCICGPGYQRRPDGEGCI--DENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECL 2334          

HSP 7 Score: 98.5969 bits (244), Expect = 3.828e-20
Identity = 219/927 (23.62%), Postives = 328/927 (35.38%), Query Frame = 1
Query:  454 LQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVC--NYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGG----RCQELDNN--NYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK-NEQYKDYCQNQEI---------------------------------SKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ--TEP----PAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNF---RCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKS---------------ICDLHREKCKTGICYPI---GQNDYICA-------------CVLGYKQATDKKSCIIMDNPKCAVNEYRC--KGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCF 2946
            + +SK  CC     AWG PC  C        +  CP G   + N      +DIDECQ    +C  G+CIN  GSF+C+CP  +YL+E+T  C    ++C+  G  CG  G C  T  G YTCIC   Y     G +C+     ++C  NY+       GE         C C     ++ +K         + C  P   E             +  LC  +  G+      +   T  P+    C   E   +CE G C+++   + C+C  GF+  +    C  I+           +CQ G    R  E  N   +Y C C  G+  +  G+         N  + C+   + C  G C       + C C  G+  + D+  C+  NE  +D C N                                       CR GQCV+   S++C C+  Y  + +G+ CV   +   +P    P         Y  +C  G  +  +                  KC  I++ V EEP+            C  G C  +    FKCLC  GF+ +S GR C    +  C         G+C    + N     C C    +L  +G         TEP   +      R  C  G+ +    I GP   S+ D  EC + +                G     D +Y C+C  GYI    G  C+ ++   +                   C+   E      C  I    QN  +CA             C +GY    D++ C   D  +CA  ++ C  K   C +++  Y+CIC   Y    +G  CI                     ++ C  K  I  C+ G+C+     Y C+C   F  +    EC+   N+  YCF
Sbjct: 1557 VGVSKASCCCSLGKAWGTPCELCPSVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCD-DVNECETPGI-CGP-GTCYNTV-GNYTCICPPDYMQVNGGNNCMD-MRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPC-------EQCPIPSTDE-------------FATLCGSQRPGF-----VIDIYTGLPVDIDECR--EIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDID-----------ECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTGQC--------NDRNECQEIPNICSHGQCIDTV-GSFYCLCHTGFKTNVDQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDINECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQND------------------KCEDIDECV-EEPE-----------ICALGTC-SNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFE---GGKCSSPKSRNHSKQECCC----ALKGEGWGDPCELCPTEPDEAF------RQICPFGSGI----IVGPD-DSAVDMDECKEPDVCRH------------GQCINTDGSYRCECPFGYILE--GNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMC--KDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCI--------------------DENECQTKPGI--CENGRCLNTLGSYTCECNDGFTASPTQDECL--DNREGYCF 2342          

HSP 8 Score: 92.8189 bits (229), Expect = 2.309e-18
Identity = 226/1018 (22.20%), Postives = 372/1018 (36.54%), Query Frame = 1
Query:  307 TNNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKID---RGLCKSTPENLQ----------LSKEECCSIFQVAWGNPCVFCDRNYCPKGF----------TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-QYRRDQCQL----------------------YGSSCGIFGK--------CVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRY-----CSKSEYYSLCEGGSCVDLN-----NDYYCQC---SEGFYAT--ENRRRCIKIETITS------QCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIE-----------KVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQ-----NDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFD-----ENSIST--CSCSENYENLFDTGLCIIKSD 3042
            T+ CS    C+N     +C+C+ GY G+      +  C   ++    G C + P   +             + C  I + +  N CVF   +  P  F           +    C D++EC   + C++G C+N  GS+ C CPPD  L+   + C   R   C L                        S C   GK        C   +  +Y  +C        N  + I + + + C     LC   G+C     S+ C CP+G++ +ED + C    + + C++P I   C  G+C +    Y C+C  +Y   N    C+    S    + Y     C     +++ +   C   N     N    QC   S   +AT   ++R    I+  T       +C      C+ G C  +   ++ C+C  GF  ++    C   +  +N        G  CQ           Y C C  GY  +          Q  D  + QEI   C  GQC+    S+ C+CH  + ++ +   C+   + E  A            C  G C +T  ++ C+C +G+  + N   C  +++  T   +            C  G+C+ +    F+C C  G+  A DGR+C    +++C+ +   C PG C+    S +RC+CP   SL  D     I+    EP             CA G C N     +C+C  G+  S  G+ C  +            K SS  S N  + +     + +     C+           + C      ++      +  ++CK       GQ       Y C C  GY    +   C+  D  +C+V    C  G C +++ G+ C C   +               +   DI+E + QNP   +F             +CV     Y+CKCP  +     D    +D ++C    + C +     +N I T  C C   Y+   D   CI +++
Sbjct: 1373 THMCSQHADCKNTMGSYRCLCKDGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPSVNTSEYKILCPGGEGFRPNPITVILE-DIDECQELPGLCQ-GGKCINTFGSFQCRCPTGYYLNEDTRVC---DDVNECETPGI---CGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINM-VGSFRCECPVGFFYNDKLLVCEDIDECQN--------GPVCQRNAECINTAGSYRCDCKPGYRLT-------STGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINECERDA------------CGNGTCRNTIGSFNCRCNHGFILSHN-NDCIDVDECATGNGN-----------LCRNGQCV-NTVGSFQCRCNEGYEVAPDGRTC--VDINECVLDPGKCAPGTCQNLDGS-YRCICPPGYSLQNDKCE-DIDECVEEPEI-----------CALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGY--ILEGNECV--DTDECSVGN-PCGNGTCKNVIGGFECTCEEGFEPGP----------MMTCEDINECA-QNPLLCAF-------------RCVNTYGSYECKCPVGYVLR-EDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENE 2296          

HSP 9 Score: 92.4337 bits (228), Expect = 2.876e-18
Identity = 73/267 (27.34%), Postives = 108/267 (40.45%), Query Frame = 1
Query:  148 CCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCI 831
            CC GW     G+ C+   C + CG G C   N+C C    I + +C   + + C+  C N G C +  C+C+ GY G  C   +                                    C+  +   +C+     +  +K  CC+    AWG+PC  C    + C +GF    +   C D+DECQ    +C  G CIN  GSF C+CP  H  +E +  C+   D+C      C   G+C  T    Y C C   +  S +G  C+
Sbjct:   67 CCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQI-SPSCGSRSIQHCSIRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERDYRTGPCFTVVSNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGMCQGGNCINTVGSFECKCPAGHKFNEVSQKCE-DIDECSTIPGVCD-GGECTNTVS-SYFCKCPPGFYTSPDGTRCV 329          

HSP 10 Score: 88.1965 bits (217), Expect = 6.445e-17
Identity = 191/879 (21.73%), Postives = 315/879 (35.84%), Query Frame = 1
Query:  526 RNYCPKGFTQKENR--CDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAE----------RTRNSTSIC------------------ELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAV-------------RLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLC---LPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCP----YYASLS--------KDGHSCLINYVTTEPTTKY-CDILVNRLRCASGNCVNDR-----------------------CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHEC 2913
            R  C  GF   E+   C D++EC    +ICL+G C N KGSF C C   +   +    C    ++C++   +CG    C  T+ G + C C    S  + G   IK T+ + C+    +C  + +C+    SY C C  G+  + D  +C     +D+ +  E    C  G C++   GYRC C+  +    + + C               +    ++C  G+C +L   + C+C  G+    +   C  +        L+   C  G C     + Y C C   F  +     C+             R  N  + C                  + +G  C+  +C  +  +EY   C  G     +    I     +D  + QE+   C+GG+C++   S++C C   Y  + + + C    + E P +                   +Y  +  G  C+D   +   +       T +G     + K++      SY + + +   C   +C    T  F  LC    PGF    D  +  P  +D+C     +C  G C     S FRC CP    Y   L         ++G  C  N         Y CD        ++G C NDR                       C+C  G+K++ D   C  I +       N               ++ C+C +G+I S N       E A    ++C       + G C       + C C  GY+ A D ++C+ ++  +C ++  +C  G C ++   Y CIC   Y++  +           K  DI E               E  E C  G C   +  ++C CP  F  +     C
Sbjct: 1264 RCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCT-DINECEIGAHNCGRHAVCTNTA-GSFKCSC----SPGWIGDG-IKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKDGY--TGDGFTC-----TDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDI-----------DECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNE-----CLDPTTCISGNCVNTPGS-YTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCE--LCPSVNTSEYKILCPGGEGFRPNPITVI----LEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCC---CSYNIGRAWNKPCE--QCPIPSTDEFATLCGSQRPGF--VIDIYTGLPVDIDECREIPGVCENGVCINMVGS-FRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTGQC-NDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINECERDACGNGTCRNTI-------GSFNCRCNHGFILSHNNDCIDVDECATGNGNLC-------RNGQCVNT-VGSFQCRCNEGYEVAPDGRTCVDIN--ECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQND-----------KCEDIDECV-------------EEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRC 2055          

HSP 11 Score: 78.5666 bits (192), Expect = 5.539e-14
Identity = 109/435 (25.06%), Postives = 178/435 (40.92%), Query Frame = 1
Query: 1426 NSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCAS---GNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDC 2721
            N T  C+L  + CQ G C P  P  Y C C +G+ Q + R  CI      D C+       C GG+C++N  SY C C   Y S+    EC    +            +   +C  G C++T+ +++C C  G++ T +G+ C  +++          C ++   + C+ G CI ++   FKC+C PGF  ASDGR C  + +++C     IC  GRC  +  S +RC C    ++  DG  C+  ++ +     Y      R +C     G      C C     +   G+ C      +S                     Y+  C +G   +          SA    + C L  + C  GIC  + +  Y C C  GY+     K+C+ ++  +C +N   C  G C +    ++C C   +    + + C
Sbjct:  450 NVTDYCQLVRYLCQNGRCIPT-PGSYRCECNKGF-QLDIRGECID----VDECEKNP----CTGGECINNQGSYTCHCRAGYQSTLTRTECRDIDEC----------LQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDE----------CSIR---NMCLNGMCI-NEDGSFKCICKPGFQLASDGRYC--KDINEC-ETPGICMNGRCVNTDGS-YRCECFPGLAVGLDGRVCVDTHMRSTCYGGY-----RRGQCVKPLFGAVTKSECCCASTEYAF--GEPCQPCPAQNSA-------------------EYQALCSSGPGMT----------SAGTDINECALDPDICPNGICENL-RGTYKCICNSGYEVDITGKNCVDIN--ECVLNSLLCDNGQCRNTPGSFVCTCPKGFVYKPDLKTC 807          

HSP 12 Score: 75.0998 bits (183), Expect = 5.101e-13
Identity = 110/422 (26.07%), Postives = 159/422 (37.68%), Query Frame = 1
Query:  310 NNCSNK-GQCQNGKCICESGYFGEDCNTAIIST-------------CYVKIDRGLCKSTPENLQ-LSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSC-------IKKTN-----------------------------YNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGR 1398
            N C  K G C+NG+C+   G +  +CN    ++             C+ ++ + +C+    N   ++K ECC      WG  C  C        +  CP G     N   DIDEC+    +C NGEC+N++GS+ C C   +  D    +C    ++C      C    K    ++G Y C C K Y +  +G+SC        K+ N                              N C     LC   G CQ    S+ C C  GF   +   SC    + D C   E   RC+ G C +   GYRC C   Y  +    +CV    +E L +          +C G SC +    Y C C  GF   +    C  I    ++C  +Q  C  G C   +   Y C C  G+ R   G 
Sbjct: 2295 NECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFEGTVAYKKLCPHGRGFMTNG-ADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTAC-VDLNECNQAPKPCNFICK---NTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASC---EDVDEC---EGNHRCQHG-CQNIIGGYRCSCPQGYLQHYQWNQCVD--ENECLSAH---------VCGGASCHNTLGSYKCMCPTGFQYEQFSGGCQDI----NECGSSQAPCSYG-CSNTE-GGYLCGCPPGYFRIGQGH 2687          

HSP 13 Score: 69.3218 bits (168), Expect = 3.031e-11
Identity = 89/346 (25.72%), Postives = 131/346 (37.86%), Query Frame = 1
Query: 1927 CMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSE-------------------SALIKKSICDLHREKCKTGICYP-IGQN--DYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            C GG CI ++   + C C  G+ S      C    +D+CL N  IC  GRC  +  S F CVC     +++DG +C             C I   R  C +G C+N+    +CIC PG++ + DG+ C  I +  +       +C         D +Y C+C  G     +GR C+ +                     A+ K   C    E      C P   QN  +Y   C  G    +        D  +CA++   C  G C ++   Y CIC   Y V   G++C         VDI+E           C    ++  C  G+C      + C CP  F
Sbjct:  501 CTGGECINNQG-SYTCHCRAGYQSTLTRTEC--RDIDECLQNGRICNNGRCINTDGS-FHCVCNAGFHVTRDGKNC--------EDMDECSI---RNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNT------DGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAG-----TDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNC---------VDINE-----------CVLNSLL--CDNGQCRNTPGSFVCTCPKGF 798          

HSP 14 Score: 63.1586 bits (152), Expect = 2.148e-9
Identity = 126/563 (22.38%), Postives = 205/563 (36.41%), Query Frame = 1
Query: 1135 VSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVT--EEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLP----------GFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICD------LHREKCKTGICYPIG----------QNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            V+ YC    Y  LC+ G C+     Y C+C++GF   + R  CI ++    +C  N   C GG C   +  +Y C C  G+  +     C   +        C   G  C  G C       + C C  G+  + D K C    +  D C    I   C  G C++   S++C+C   +  +++G+ C    + E P +           C  G CV+T+ +Y C+C  G     +GR C     + T         C+   + +      C     Y F   C P             S+  G +     +++C  + +IC  G CE      ++C+C     +   G +C+ IN           + ++N L C +G C N      C C  G+    D K C  I++  S            G  +    ++ C+C            CI++      +++ D      ++    K+  C  +G          Q D IC      K  +  K     D  +C V    CK G C +    + C C    T+   GR C+
Sbjct:  451 VTDYCQLVRY--LCQNGRCIPTPGSYRCECNKGF-QLDIRGECIDVD----ECEKNP--CTGGECIN-NQGSYTCHCRAGYQSTLTRTECRDIDE-------CLQNGRICNNGRCINT-DGSFHCVCNAGFHVTRDGKNC----EDMDECS---IRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGI-----------CMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGTDINECALDPDICPNGICENL-RGTYKCICNSGYEVDITGKNCVDIN-----------ECVLNSLLCDNGQCRNTPGSFVCTCPKGFVYKPDLKTCEDIDECES-------SPCINGVCKNSPGSFICECSPESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQLDPICG-----KGFSRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICL 953          
BLAST of Fibrillin-2 vs. Ensembl Mouse
Match: Ltbp1 (latent transforming growth factor beta binding protein 1 [Source:MGI Symbol;Acc:MGI:109151])

HSP 1 Score: 102.449 bits (254), Expect = 2.171e-21
Identity = 128/469 (27.29%), Postives = 204/469 (43.50%), Query Frame = 1
Query:  772 QYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRC-LCNGEY----QGYNND-QECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYC-QCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL 2157
            +YTCIC + Y  S   + C+   + + C   + LC   G C+    S+ C CP+GF  SE+  +CI   + D C  P++   CR G C++    +RC  C+  Y    +GY  D  EC++  T                 C    CV+    Y C  C+EGF       +C+ ++       L    C  G C  L+  +Y C C RG+  + + R C   +  +         G+ C  G C       + C C +GY  S  +  C    +  D C++  +   C  GQC +   S++CVC+  Y +S  G  C    +            E  S+CQGG+C++T  +Y C C +G+   +N + C  I +        S+            G C+  +   F C+C  GF+ ++DGR+C  E +D+C+NN    + G C+ +  S FRC+C       +DG  C+
Sbjct:  516 RYTCICYEGYKFSEQLRKCV---DIDECAQVRHLC-SQGRCENTEGSFLCVCPAGFMASEEGTNCI---DVDECLRPDM---CRDGRCINTAGAFRCEYCDSGYRMSRRGYCEDIDECLKPST-----------------CPEEQCVNTPGSYQCVPCTEGFRGWNG--QCLDVDE-----CLQPKVCTNGSCTNLE-GSYMCSCHRGYSPTPDHRHCQDIDECQQ--------GNLCMNGQCRNT-DGSFRCTCGQGYQLSAAKDQC----EDIDECEHHHL---CSHGQCRNTEGSFQCVCNQGYRASVLGDHCEDINEC----------LEDSSVCQGGDCINTAGSYDCTCPDGFQLNDN-KGCQDINECAQPGLCGSH------------GECLNTQG-SFHCVCEQGFSISADGRTC--EDIDECVNNTVCDSHGFCDNTAGS-FRCLCYQGFQAPQDGQGCV 906          

HSP 2 Score: 82.8037 bits (203), Expect = 1.982e-15
Identity = 130/511 (25.44%), Postives = 208/511 (40.70%), Query Frame = 1
Query: 1171 LCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVC--PYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICV 2685
            +C  G C++L   Y C C EG+  +E  R+C+ I+    +CA  +  C  GRC+  +  ++ C C  GF+ SE G +CI  +          L    C+ G C           C  GY  S  R YC    +  D C        C   QCV+   SY+CV   +     NGQ C+   +   P V           C  G C +   +Y C C  GY  T + R C  I++              +  + CM G+C  +    F+C C  G+  ++    C  E +D+C  + ++C+ G+C R+   +F+CVC   Y AS+  D H   IN           + L +   C  G+C+N      C C  G++ + D K C  I + +                     ++ C C  G+  S +GR+C +     +  ++CD H      G C       + C C  G++   D + C+  D  +C +    C   +C ++   +LC+C 
Sbjct:  504 ICGAGHCINLPVRYTCICYEGYKFSEQLRKCVDID----ECAQVRHLCSQGRCENTE-GSFLCVCPAGFMASEEGTNCIDVDEC--------LRPDMCRDGRCINTAGAFRCEYCDSGYRMSR-RGYC----EDIDECLK---PSTCPEEQCVNTPGSYQCVPCTEGFRGWNGQ-CLDVDECLQPKV-----------CTNGSCTNLEGSYMCSCHRGYSPTPDHRHCQDIDE-------------CQQGNLCMNGQCR-NTDGSFRCTCGQGYQLSAAKDQC--EDIDEC-EHHHLCSHGQC-RNTEGSFQCVCNQGYRASVLGD-HCEDIN-----------ECLEDSSVCQGGDCINTAGSYDCTCPDGFQLN-DNKGCQDINECAQPGLCGSHGECLNT-----QGSFHCVCEQGFSISADGRTC-EDIDECVNNTVCDSH------GFCDNTA-GSFRCLCYQGFQAPQDGQGCV--DVNECELLSGVCGEAFCENVEGSFLCVCA 935          

HSP 3 Score: 80.4925 bits (197), Expect = 1.072e-14
Identity = 168/704 (23.86%), Postives = 259/704 (36.79%), Query Frame = 1
Query:  310 NNCSNKGQCQNGKCICESGY--------FGEDC-------NTAIIS----TCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDH---YLDENTMSCQYRRDQCQLYGSSCGIFGK--CVPTSDGQYTCICIKPYSVSFNGKSCIKKTNY---NVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYEC-QCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSG-----NSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCAS-GNCVND----RCICGPGYKSSEDGKECYKI 2307
            N C  +G C NG+C+   G         FG D        +  +IS     CY  +  G     P ++ L+K+ CC     AWG  C       CP   T KE   + +      S   +G    E        PP+     LD+     +  + Q     S+  +  +   V         + + P + + +    I  T     N C     +C   G C    + Y C C  G+  SE  + C+     DI +  ++   C  G C +    + C+C   +        C+            C + +   +C  G C++    + C+  +  Y    R  C  I+         + QC           +Y+C  C  GF R  NG+ C+  +          L    C  G C  +    Y+C+C  GYS + D ++C    Q  D CQ   +   C  GQC +   S+RC C   Y  S    +C    +            E++ LC  G+C +T  ++ C C  GY A+  G  C  I +          CL  E  S C GG CI +    + C C  GF   +D + C  + +++C        PG C   G       +F CVC    S+S DG +C           +  D  VN   C S G C N     RC+C  G+++ +DG+ C  +
Sbjct:  302 NECQLQGVCPNGECLNTMGSYRCSCKMGFGPDPTFSSCVPDPPVISEEKGPCYRLVSPGRHCMHPLSVHLTKQICCCSVGKAWGPHC-----EKCPLPGTAKEEPVEAL-----TSSWEHGPRGAEPEVVTA--PPEKEIPSLDQEKTRLEPGQPQLSPGVSTIHLHPQFPVVVEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICG-AGHCINLPVRYTCICYEGYKFSEQLRKCV-----DIDECAQVRHLCSQGRCENTEGSFLCVCPAGFMASEEGTNCIDVDE--------CLRPD---MCRDGRCINTAGAFRCEYCDSGYRMSRRGYCEDIDECLKPSTCPEEQCVN------TPGSYQCVPCTEGF-RGWNGQ-CLDVDEC--------LQPKVCTNGSCTNLE-GSYMCSCHRGYSPTPDHRHC----QDIDECQQGNL---CMNGQCRNTDGSFRCTCGQGYQLSAAKDQCEDIDEC-----------EHHHLCSHGQCRNTEGSFQCVCNQGYRASVLGDHCEDINE----------CL--EDSSVCQGGDCI-NTAGSYDCTCPDGF-QLNDNKGC--QDINECAQ------PGLCGSHGECLNTQGSFHCVCEQGFSISADGRTC-----------EDIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDV 908          

HSP 4 Score: 77.411 bits (189), Expect = 9.875e-14
Identity = 108/432 (25.00%), Postives = 166/432 (38.43%), Query Frame = 1
Query:  547 FTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQ-----YRRDQCQLYGSSCGIFGKCVPTSDGQYTC-ICIKPYSVSFNG----------------KSCIKKTNYNVC-------NYFKKLCLPYGEC-QP----------YGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTE 1719
            F+++  +C DIDEC Q + +C  G C N +GSF C CP      E   +C       R D C+         G+C+ T+ G + C  C   Y +S  G                + C+       C         +   CL   EC QP             SY CSC  G+  + D + C    + D CQ   +   C  G C +    +RC C   YQ      +C               + E++ LC  G C +    + C C++G+ A+     C  I    ++C  +   CQGG C      +Y+C C  GF  ++N + C           +C  +G    T          + C C +G+S S D + C    +  D C N  +      G C +   S+RC+C+  + +  +GQ CV   + E
Sbjct:  527 FSEQLRKCVDIDECAQVRHLCSQGRCENTEGSFLCVCPAGFMASEEGTNCIDVDECLRPDMCR--------DGRCINTA-GAFRCEYCDSGYRMSRRGYCEDIDECLKPSTCPEEQCVNTPGSYQCVPCTEGFRGWNGQCLDVDECLQPKVCTNGSCTNLEGSYMCSCHRGYSPTPDHRHC---QDIDECQQGNL---CMNGQCRNTDGSFRCTCGQGYQLSAAKDQCEDI-----------DECEHHHLCSHGQCRNTEGSFQCVCNQGYRASVLGDHCEDI----NECLEDSSVCQGGDCINT-AGSYDCTCPDGFQLNDN-KGCQDINECAQP-GLCGSHGECLNTQ-------GSFHCVCEQGFSISADGRTC----EDIDECVNNTVCD--SHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNECE 912          

HSP 5 Score: 67.3958 bits (163), Expect = 1.036e-10
Identity = 118/496 (23.79%), Postives = 192/496 (38.71%), Query Frame = 1
Query: 1276 TITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRC-VCHGKYISSNNG-----QECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKV---SSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            T  ++C +N   C  G C  L    Y C C  G+  SE  R C+  +        C    H C  G C       ++C C  G+  SE+   CI      D C   ++   CR G+C++   ++RC  C   Y  S  G      EC++                  S C   +CV+T  +Y C      +   NG +C  +++          CL  +    C  G C  +    + C C  G++   D R C  + +D+C    N+C  G+C R+ + +FRC C     LS     C           +  D   +   C+ G C N     +C+C  GY++S  G  C  I +    SS+C                  +Y+C C +G+  ++N      +E A  +  +C  H E   T       Q  + C C  G+  + D ++C  +D  +C  N      G+C +    + C+C   +   ++G+ C+
Sbjct:  493 TEINECTVNPDICGAGHCINLPVR-YTCICYEGYKFSEQLRKCVDIDE-------CAQVRHLCSQGRCENTE-GSFLCVCPAGFMASEEGTNCID----VDECLRPDM---CRDGRCINTAGAFRCEYCDSGYRMSRRGYCEDIDECLKP-----------------STCPEEQCVNTPGSYQCVPCTEGFRGWNG-QCLDVDE----------CLQPKV---CTNGSCT-NLEGSYMCSCHRGYSPTPDHRHC--QDIDECQQG-NLCMNGQC-RNTDGSFRCTCGQGYQLSAAKDQC-----------EDIDECEHHHLCSHGQCRNTEGSFQCVCNQGYRASVLGDHCEDINECLEDSSVCQGGDCINTA--------GSYDCTCPDGFQLNDNKGCQDINECA--QPGLCGSHGECLNT-------QGSFHCVCEQGFSISADGRTCEDID--ECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCV 906          

HSP 6 Score: 66.2402 bits (160), Expect = 2.653e-10
Identity = 164/707 (23.20%), Postives = 258/707 (36.49%), Query Frame = 1
Query:  520 CDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELD--------NNNYECQCLRGFIRSENGRSCIKAERTR----------NSTSICE------------------LYGHRCQTGVCYPIYPNEY--ICACLEGYSQSEDRKYCIKNEQYKDYCQ----NQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEK--QVTEEPDNSYCLLQEYLSR--CMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTT--EPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDL 2484
            C R Y P   T     C DIDECQ  ++C+NG+C N  GSFRC C   + L      C+   D+C+ +       G+C  T +G + C+C + Y  S  G  C    + N C     +C   G+C     SY C+CP GF Q  D K C    + + C  P +      G C++    + C+C   +    + + C      E + +  C           G C +    + C C +GF A ++ + C+ +    ++C L    C    C+ ++        + N E   + G  RS          + R          N  S+C+                   +G  C+   C      E+  +C   +G   + +  Y    E YKD  +     +EI   C+ G C++    Y C C           +C    + + P           + C  G+CV+T  +Y C C +      + ++C +  +  +  EE D    L  E+LS         +G +T   +C CL G         C  +  D      NI   GR    G          Y     D +     ++ +  E   + C IL     C +G CV  +    C C  GY        C  + + S + +   L           + +Y+C CL GYI S+    C    SAL      DL
Sbjct:  685 CHRGYSP---TPDHRHCQDIDECQQGNLCMNGQCRNTDGSFRCTCGQGYQLSAAKDQCE-DIDECEHHHLC--SHGQCRNT-EGSFQCVCNQGYRASVLGDHC---EDINECLEDSSVCQ-GGDCINTAGSYDCTCPDGF-QLNDNKGC---QDINECAQPGLCGS--HGECLNTQGSFHCVCEQGFSISADGRTC--EDIDECVNNTVCDSH--------GFCDNTAGSFRCLCYQGFQAPQDGQGCVDV----NECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRVTEDSGVDRQPREEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVQGTAEFTEMCPRGKGLVPAGESSYDTGGENYKDADECLLFGEEI---CKNGYCLNTQPGYECYCKQGTYYDPVKLQCFDMDECQDP-----------NSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCVQPTESNEQIEETDVYQDLCWEHLSEEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIPVTGRRRPYGRDALVDFSEQYGP-ETDPYFIQDRFLNSFEELQAEECGILNG---CENGRCVRVQEGYTCDCFDGYHLDMAKMTCVDVNECSELNNRMSLCKNAKCINT--EGSYKCLCLPGYIPSDKPNYCTPLNSALNLDKESDL 1340          

HSP 7 Score: 62.3882 bits (150), Expect = 3.951e-9
Identity = 142/594 (23.91%), Postives = 218/594 (36.70%), Query Frame = 1
Query:  199 CDY-DCGYGRCVGLNVCECYDKTIRTETCPQ----------------------NNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVS----RYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQC-----QGGRCQELDNNNY---ECQCLRGFIRSEN--------------------GRSCIKAERTRNSTS--------ICELYGHR-CQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRY----KQTEPPAVRLCSKWEYYS 1761
            C+Y D GY R      CE  D+ ++  TCP+                      N Q L  + C     C NG C    G +   C+            RG    TP++      + C    +     C   D ++   C +G+  +  +++C+DIDEC+   +C +G+C N +GSF+C C   +        C+   ++C L  SS    G C+ T+ G Y C C   + ++ N K C    + N C     LC  +GEC     S++C C  GF  S D ++C    + D C +  + +    G C +    +RCLC   +Q   + Q CV     E L       +C   E   LC    C D N +Y           + R R  +   +  Q    + +C         C  +   N    EC C  G    +N                    G+  + A  +   T          C L+G   C+ G C    P  Y C C +G      +  C   ++ +D          C  GQCV+   SY C C    +   + + CV+     +Q E   V     WE+ S
Sbjct:  602 CEYCDSGY-RMSRRGYCEDIDECLKPSTCPEEQCVNTPGSYQCVPCTEGFRGWNGQCLDVDECLQPKVCTNGSCTNLEGSYMCSCH------------RGY-SPTPDHRHCQDIDECQQGNLCMNGQCRNTDGSFRCTCGQGYQLSAAKDQCEDIDECEHHHLCSHGQCRNTEGSFQCVCNQGYRASVLGDHCE-DINEC-LEDSSVCQGGDCINTA-GSYDCTCPDGFQLNDN-KGC---QDINECAQ-PGLCGSHGECLNTQGSFHCVCEQGFSISADGRTC---EDIDECVNNTVCD--SHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLC---VCADENQEY------SPMTGQCRSRVTEDSGVDRQPREEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVQGTAEFTEMCPRGKGLVPAGESSYDTGGENYKDADECLLFGEEICKNGYCLNTQPG-YECYCKQGTYYDPVKLQCFDMDECQD-------PNSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCVQPTESNEQIEETDVYQDLCWEHLS 1151          

HSP 8 Score: 51.2174 bits (121), Expect = 9.111e-6
Identity = 31/88 (35.23%), Postives = 41/88 (46.59%), Query Frame = 1
Query:  466 KEECCSIFQVAWG-NPCVFCDRNYCPKGFTQ-----------KENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC 693
            +E+CC     +WG N C  C +     G+TQ               C DI+ECQ + +C NGEC+N  GS+RC C      D    SC
Sbjct:  252 QEDCCGTVGTSWGFNKCQKCPKKQSYHGYTQMMECLQGYKRVNNTFCQDINECQLQGVCPNGECLNTMGSYRCSCKMGFGPDPTFSSC 339          
BLAST of Fibrillin-2 vs. Ensembl Mouse
Match: Ltbp1 (latent transforming growth factor beta binding protein 1 [Source:MGI Symbol;Acc:MGI:109151])

HSP 1 Score: 101.679 bits (252), Expect = 3.410e-21
Identity = 128/469 (27.29%), Postives = 204/469 (43.50%), Query Frame = 1
Query:  772 QYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRC-LCNGEY----QGYNND-QECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYC-QCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL 2157
            +YTCIC + Y  S   + C+   + + C   + LC   G C+    S+ C CP+GF  SE+  +CI   + D C  P++   CR G C++    +RC  C+  Y    +GY  D  EC++  T                 C    CV+    Y C  C+EGF       +C+ ++       L    C  G C  L+  +Y C C RG+  + + R C   +  +         G+ C  G C       + C C +GY  S  +  C    +  D C++  +   C  GQC +   S++CVC+  Y +S  G  C    +            E  S+CQGG+C++T  +Y C C +G+   +N + C  I +        S+            G C+  +   F C+C  GF+ ++DGR+C  E +D+C+NN    + G C+ +  S FRC+C       +DG  C+
Sbjct:  569 RYTCICYEGYKFSEQLRKCV---DIDECAQVRHLC-SQGRCENTEGSFLCVCPAGFMASEEGTNCI---DVDECLRPDM---CRDGRCINTAGAFRCEYCDSGYRMSRRGYCEDIDECLKPST-----------------CPEEQCVNTPGSYQCVPCTEGFRGWNG--QCLDVDE-----CLQPKVCTNGSCTNLE-GSYMCSCHRGYSPTPDHRHCQDIDECQQ--------GNLCMNGQCRNT-DGSFRCTCGQGYQLSAAKDQC----EDIDECEHHHL---CSHGQCRNTEGSFQCVCNQGYRASVLGDHCEDINEC----------LEDSSVCQGGDCINTAGSYDCTCPDGFQLNDN-KGCQDINECAQPGLCGSH------------GECLNTQG-SFHCVCEQGFSISADGRTC--EDIDECVNNTVCDSHGFCDNTAGS-FRCLCYQGFQAPQDGQGCV 959          

HSP 2 Score: 92.8189 bits (229), Expect = 1.967e-18
Identity = 182/799 (22.78%), Postives = 301/799 (37.67%), Query Frame = 1
Query:  466 KEECCSIFQVAWG-NPCVFCDRNYCPKGFTQ-----------KENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLP----YGECQPYGLSYYCSCPS---GFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSE---PLVSRYCSKSE--YYSLCEGGSCVDLNNDYYCQCSEGF----------YATENRRRCIKIETIT--SQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRC-VCHGKYISSNNG-----QECVRYKQ-TEPPAVRLCSKWEYYSLCQG-----GECVDTXXXXXXXXXXXXXAT--ENGRKCSRIEKQVTEEPDNSYCLLQEYLSR---CMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVC--PYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICV 2685
            +E+CC     +WG N C  C +     G+TQ               C DI+ECQ + +C NGEC+N  GS+RC C      D    SC             C         S G++   C+ P SV    + C          + +K  LP    + E  P G+ Y  S        HQ   K++  V   +    +  +A+        ++ +    L +    G    +  V     E   P + +  ++ E     L  G S + L+  +     +             +T +  + I    +T  ++C +N   C  G C  L    Y C C  G+  SE  R C+  +        C    H C  G C       ++C C  G+  SE+   CI      D C   ++   CR G+C++   ++RC  C   Y  S  G      EC++     E   V     ++     +G     G+C+D +     K       T  E    CS   +  +  PD+ +C   +   +   CM G+C  +    F+C C  G+  ++    C  E +D+C  + ++C+ G+C R+   +F+CVC   Y AS+  D H   IN           + L +   C  G+C+N      C C  G++ + D K C  I + +                     ++ C C  G+  S +GR+C +     +  ++CD H      G C       + C C  G++   D + C+  D  +C +    C   +C ++   +LC+C 
Sbjct:  252 QEDCCGTVGTSWGFNKCQKCPKKQSYHGYTQMMECLQGYKRVNNTFCQDINECQLQGVCPNGECLNTMGSYRCSCKMGFGPDPTFSSCVPDPPVISEEKGPCYRL-----VSPGRH---CMHPLSVHLTKQICCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGYTVSGVHRRRPIHQHIGKEAVYVKPKN----TQPVAKSTHPPPLPAKEEPVEALTSSWEHGPRGAEPEVVTAPPEKEIPSLDQEKTRLEPGQPQLSPGVSTIHLHPQFPVVVEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLP-VRYTCICYEGYKFSEQLRKCVDIDE-------CAQVRHLCSQGRCENTE-GSFLCVCPAGFMASEEGTNCID----VDECLRPDM---CRDGRCINTAGAFRCEYCDSGYRMSRRGYCEDIDECLKPSTCPEEQCVNTPGSYQCVPCTEGFRGWNGQCLDVDECLQPKVCTNGSCTNLEGSYMCS-CHRGYSPTPDHRHCQDIDECQQGNLCMNGQCR-NTDGSFRCTCGQGYQLSAAKDQC--EDIDEC-EHHHLCSHGQC-RNTEGSFQCVCNQGYRASVLGD-HCEDIN-----------ECLEDSSVCQGGDCINTAGSYDCTCPDGFQLN-DNKGCQDINECAQPGLCGSHGECLNT-----QGSFHCVCEQGFSISADGRTC-EDIDECVNNTVCDSH------GFCDNTA-GSFRCLCYQGFQAPQDGQGCV--DVNECELLSGVCGEAFCENVEGSFLCVCA 988          

HSP 3 Score: 65.0846 bits (157), Expect = 5.096e-10
Identity = 167/711 (23.49%), Postives = 263/711 (36.99%), Query Frame = 1
Query:  520 CDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEY---YSLCEG-GSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELD--------NNNYECQCLRGFIRSENGRSCIKAERTR----------NSTSICE------------------LYGHRCQTGVCYPIYPNEY--ICACLEGYSQSEDRKYCIKNEQYKDYCQ----NQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEK--QVTEEPDNSYCLLQEYLSR--CMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTT--EPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDL 2484
            C R Y P   T     C DIDECQ  ++C+NG+C N  GSFRC C   + L      C+   D+C+ +   C   G+C  T +G + C+C + Y  S  G  C    + N C     +C   G+C     SY C+CP GF Q  D K C    + + C  P +      G C++    + C+C    QG++   +            R C   +     ++C+  G C +    + C C +GF A ++ + C+ +    ++C L    C    C+ ++        + N E   + G  RS          + R          N  S+C+                   +G  C+   C      E+  +C   +G   + +  Y    E YKD  +     +EI   C+ G C++    Y C C           +C    + + P           + C  G+CV+T  +Y C C +      + ++C +  +  +  EE D    L  E+LS         +G +T   +C CL G         C  +  D      NI   GR    G          Y     D +     ++ +  E   + C IL     C +G CV  +    C C  GY        C  + + S + +   L           + +Y+C CL GYI S+    C    SAL      DL
Sbjct:  738 CHRGYSP---TPDHRHCQDIDECQQGNLCMNGQCRNTDGSFRCTCGQGYQLSAAKDQCE-DIDECEHH-HLCS-HGQCRNT-EGSFQCVCNQGYRASVLGDHC---EDINECLEDSSVCQ-GGDCINTAGSYDCTCPDGF-QLNDNKGC---QDINECAQPGLCGS--HGECLNTQGSFHCVCE---QGFSISAD-----------GRTCEDIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDV----NECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRVTEDSGVDRQPREEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVQGTAEFTEMCPRGKGLVPAGESSYDTGGENYKDADECLLFGEEI---CKNGYCLNTQPGYECYCKQGTYYDPVKLQCFDMDECQDP-----------NSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCVQPTESNEQIEETDVYQDLCWEHLSEEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIPVTGRRRPYGRDALVDFSEQYGP-ETDPYFIQDRFLNSFEELQAEECGILNG---CENGRCVRVQEGYTCDCFDGYHLDMAKMTCVDVNECSELNNRMSLCKNAKCINT--EGSYKCLCLPGYIPSDKPNYCTPLNSALNLDKESDL 1393          

HSP 4 Score: 61.6178 bits (148), Expect = 6.909e-9
Identity = 98/366 (26.78%), Postives = 152/366 (41.53%), Query Frame = 1
Query:  199 CDY-DCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCI-CESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQ--LSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEY---YSLCEG-GSCVDLNNDYYCQCSEGFYATENRRRCIKI 1272
            C+Y D GY R      CE  D+ ++  TCP+     C N   +       +C+ C  G+ G +               G C    E LQ  +     C+  +   G+    C R Y P   T     C DIDECQ  ++C+NG+C N  GSFRC C   + L      C+   D+C+ +   C   G+C  T +G + C+C + Y  S  G  C    + N C     +C   G+C     SY C+CP GF Q  D K C    + + C  P +      G C++    + C+C    QG++   +            R C   +     ++C+  G C +    + C C +GF A ++ + C+ +
Sbjct:  655 CEYCDSGY-RMSRRGYCEDIDECLKPSTCPEEQ---CVNTPGSY------QCVPCTEGFRGWN---------------GQCLDVDECLQPKVCTNGSCTNLE---GSYMCSCHRGYSP---TPDHRHCQDIDECQQGNLCMNGQCRNTDGSFRCTCGQGYQLSAAKDQCE-DIDECE-HHHLCS-HGQCRNT-EGSFQCVCNQGYRASVLGDHC---EDINECLEDSSVCQ-GGDCINTAGSYDCTCPDGF-QLNDNKGC---QDINECAQPGLCG--SHGECLNTQGSFHCVCE---QGFSISAD-----------GRTCEDIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDV 961          
BLAST of Fibrillin-2 vs. UniProt/SwissProt
Match: sp|Q75N90|FBN3_HUMAN (Fibrillin-3 OS=Homo sapiens OX=9606 GN=FBN3 PE=2 SV=3)

HSP 1 Score: 157.147 bits (396), Expect = 3.112e-37
Identity = 236/961 (24.56%), Postives = 351/961 (36.52%), Query Frame = 1
Query:  148 CCSGWIKNVYG--DCVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQ-YRRDQC--QLYGSSCGIFGKCVPTSDGQYT---CICIKP--YSVSFNGKSCIKKTNYNVCNYFKKLC---LPYGECQP---YGLSYYCS---------------------CPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEE------PDNSY---CLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICD-------LHREKCKT-GICY--PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CC GW +   G   CV   C   CG G C   N+C C D T+   +C  +    C+ +C N G C+   C+C+ GY G  C   I                                    C+ ++    C+     L  +K  CC+    AWG PC  C    + C +GF        C D+DECQ    +C  G C+N  GSF C+CP  H L +++ +C+ YR   C   L+G      G+C     G YT   C C +   ++     + C  + +    N F++LC   LP     P    GL  + S                      PS    + +  +  +N   DIC+       C  G C+     YRC CN    GY  D   VR    E +    C+ S     C  G CV++   Y+C+C  GF AT  R+ C+ ++    +C ++   C  GRC   + + ++C C  GF  S +G++C+       ST         C  GVC       + C C  G+  +    YC+      D CQ   I   C  G C +   S+RC C G      +G              R+C      S C G                   A E G         VT+       PD+ +   C L           C    +  F+ LC  G    +DGR      +++C  +  +C  G CE    S +RCVC         G  C          T   +  +N L C +G C N      C C PG+   +D + C  +++  S   ++ +             +Y C+C  G     +G  C+ S        I++S C+       L  E C T G  +  P  + +   AC  G+ + T        D  +C      C  G C +    + C C     +  +GR C+
Sbjct:   68 CCPGW-RTFPGRSQCVVPICRRACGEGFCSQPNLCTCADGTL-APSCGVSRGSGCSVSCMNGGTCRGASCLCQKGYTGTVCGQPICDRGCHNGGRCIGPNRCACVYGFMGPQCERDYRTGPCFGQVGPEGCQHQLTGLVCTKALCCATVGRAWGLPCELCPAQPHPCRRGFIPNIHTGACQDVDECQAVPGLCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFG------GRCAGDLAGHYTRRQCCCDRGRCWAAGPVPELCPPRGS----NEFQQLCAQRLPLLPGHPGLFPGLLGFGSNGMGPPLGPARLNPHGSDARGIPSLGPGNSNIGTATLNQTIDICR--HFTNLCLNGRCLPTPSSYRCECN---VGYTQD---VR---GECIDVDECTSSP----CHHGDCVNIPGTYHCRCYPGFQATPTRQACVDVD----ECIVSGGLCHLGRCVNTEGS-FQCVCNAGFELSPDGKNCVDHNECATST--------MCVNGVCL-NEDGSFSCLCKPGFLLAPGGHYCMD----IDECQTPGI---CVNGHCTNTEGSFRCQCLGGLAVGTDG--------------RVCVDTHVRSTCYG-------------------AIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQL-----------CPAKDSAEFQALCSSGLGITTDGRD-----INECALDPEVCANGVCENLRGS-YRCVCNLGYEAGASGKDC----------TDVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSPCVSGVCRNLA-------GSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFARMT---GVTCDDVNECESFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCV 910          

HSP 2 Score: 129.413 bits (324), Expect = 9.775e-29
Identity = 219/954 (22.96%), Postives = 344/954 (36.06%), Query Frame = 1
Query:  310 NNCSNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKI----DRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELD----NNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLC-------SKWEYYSLCQGG--------ECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCL----LQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNN--ENICT-----------------PGR--------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRC--KGGYCYDIVDGYLCIC-VGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHEC 2913
            N C++   C NG CI   G +             G  C       C+++     D G+  S    + +++  CC     AWGNPC  C        R  CP G   + NR     +DIDECQ    +C  G+C+N  GSF+C+CPP ++L E+T  C+   D+C  +   CG  G C  T  G YTC+C   Y     G +C+         ++   C    E         C C     Q+ ++         + C +P   +             Y+ LC  +  G+  D       T +PL    C   E  ++C  G C++    + C+C  GF        C  ++    +C   +  CQ    Q  D      +Y C+C RG+  S  G +C+     R   ++C         G C       Y+C C  G+  S D+  C+      D C  Q     C  G C +   SY C+C   ++ ++NG +CV + +      ++C       +   ++ LCQ G         CVDTN              +N     R       +  + +C+      E  + C+ G C  +    F+CLC PGF  + +G  C       C        C+                 PG         C + G++ F+ +CP+       GH  +     +      C    N   C +G CVN     RC C  GY     G  C   ++ S      Q  C            +EC C +G+       +C   +   +   +C     +C         +  Y+C C  GY    D   C  +D  +CA  +  C  +G  C +++  + C+C  G   +  +G  C          D +E   Q              + C  G+CV     ++C C   F+ +    EC
Sbjct: 1447 NECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICE-DIDECSTHSGICGP-GTCYNTL-GNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTC--QNELAFNVTRKMCCCSYNIGQAWNRPC-------EACPTPISPD-------------YQILCGNQAPGFLTDIH-----TGKPLDIDECG--EIPAICANGICINQIGSFRCECPAGFNYNSILLACEDVD----ECGSRESPCQ----QNADCINIPGSYRCKCTRGYKLSPGG-ACVGRNECREIPNVC-------SHGDCMDTE-GSYMCLCHRGFQASADQTLCMD----IDECDRQP----CGNGTCKNIIGSYNCLCFPGFVVTHNG-DCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGTCT-NSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPF-------GHGAVPGPDDSREDVNEC--AENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCGQGTCTNVI------GGFECACADGFEPGLM-MTCEDIDECSLNPLLCAF---RCHNT------EGSYLCTCPAGYTLREDGAMCRDVD--ECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGC---------TDDNECHAQP-------------DLCVNGRCVNTAGSFRCDCDEGFQPSPTLTEC 2292          

HSP 3 Score: 116.701 bits (291), Expect = 7.791e-25
Identity = 225/978 (23.01%), Postives = 352/978 (35.99%), Query Frame = 1
Query:  319 SNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKG-------FTQKENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPT------------------------------------------SDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCR---GG---SCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYS----QSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLIN-----YVTTEPTTK-----YCDILVNRLR----CASGNCVNDRCICGPGYKSSE-----DGKECYKIEKVSSIXXXXXXXXXXXXXXXXDD-----NNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDI----VDGYLCICVGNYTVTENGRDCIL---------KIIAVKSVD--ISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTN 2895
            S  G C NG+C+  +G F             G  C    +  C+++ D   C  T          CCSI  V WG  C  C         + CP+G       F        D++EC+ F  +C +G C N  GSF C C     LD    +C    D+C++    CG  G CV T                                          +DG Y C C   + ++  G +C    + + C+    LC P+G+C     ++ CSC +GF  + D++ C+     DI         CR   GG    C++    YRC C   Y    + + C      E          E   +C+ G C ++   + C C +GF AT + R C+ ++    +C LN   C  G C+     ++ C C  G++  +    C   +        CE+ GH C +       P  + C CL G+     +  D   C+         Q    S R   G C++   SYRC C   +  + +G  C    +            E   LC  G+C++    Y C+C  G+  TE+ R C  +++                 + C  G C       F+C+C  G+     G +C    +++C +  N C  G C  +  S + C CP    L+  G  C+       ++ T            +I V   R    C+ G    + C   P   ++E      G E ++  +++ I        +  G  +  D      +++C+C  GY  SE+ R C   +        C  H   C  G CY    N Y C C   Y Q     +C+ M    C    +R   G C +     V   +C C  N     N R C           +I+        ++++    P     C   EI   C  G C+ +   ++C+CP  F  N
Sbjct:  875 SFPGVCPNGRCVNTAGSFRCECPEGLMLDASGRLCVDVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAV-WGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCT-DIDECRISPDLCGQ-GTCVNTPGSFECECFPGYESGFMLMKNCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELTAKGTAC---EDIDECSLSDGLC-PHGQCVNVIGAFQCSCHAGFQSTPDRQGCV-----DI-------NECRVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDECE----------ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVD----ECDLNPHICLHGDCENT-KGSFVCHCQLGYMVRKGATGCSDVDE-------CEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVS--------QEHRCSPR---GDCLNVPGSYRCTCRQGF--AGDGFFCEDRDECA----------ENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQG-------------NLCAFGSCENLPGM-FRCICNGGYELDRGGGNC--TDINECADPVN-CINGVCINTPGS-YLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDIDE-------CSTHSGICGPGTCYNTLGN-YTCVCPAEYLQVNGGNNCMDMRKSVC----FRHYNGTCQNELAFNVTRKMCCCSYNIGQAWN-RPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDEC--GEIPAICANGICINQIGSFRCECPAGFNYN 1755          

HSP 4 Score: 108.612 bits (270), Expect = 2.081e-22
Identity = 238/1052 (22.62%), Postives = 366/1052 (34.79%), Query Frame = 1
Query:  340 NGKCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQV--AWGNPCVFCDRNYCP----------KGFTQ--KENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGY--NNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIE---TITSQCALNQ---------------FQCQGGRCQELDN-----------------NNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK--------------------NEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYL--SRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCE-RSGNSNFRCVCPY-YASLSKDGHSCLI-NYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKK---------------SICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFC--TRKEIIEKCQPG-------------------------KCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC--PY-CFYGCFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTCRTKSLNRTLN 3105
            N  C+C + Y     G +C     S C+   + G C++      ++++ CC  + +  AW  PC  C     P           GF       +  DIDEC +  +IC NG CIN+ GSFRC+CP     +   ++C+   D+C    S C     C+    G Y C C + Y +S  G +C+ +   N C     +C  +G+C     SY C C  GF  S D+  C+     D        + C  G+C +    Y CLC   + G+   ++ +CV +     LV +         +C  G C++    ++C C +GF  T + + C+      ++   C                   FQ Q   C ++D                   +++C C  GF+ S+NG  C     TR S         +C     +        C+   G    +  + C +                    ++  +D  +  E    C  G CV+   S+RC C   Y     G  CV   +        C +    ++  G EC                A  +G +   +   +T E D   C L   L   RC       +    + C C  G+T   DG  C    VD+C + +  C     E ++    F CVCP     L   G  C   N    +P     D+ VN      G CVN     RC C  G++ S    EC+ I +      + Q  C+            EC C  G         C    ++  +K                 C +    C  G C       + C C  GY       +C+ MD  +C+     C    C +    +LC C   Y + E+GR C          D+ E + +    Q  C  T      +C PG                          C      ++C+C   F      H C  D N+C  P+ C +GC ++     CSC + +        C+   DE   +L   TC + S   TL 
Sbjct: 1627 NYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYN-GTCQNE-LAFNVTRKMCCCSYNIGQAWNRPCEACPTPISPDYQILCGNQAPGFLTDIHTGKPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSILLACE-DVDECGSRESPCQQNADCI-NIPGSYRCKCTRGYKLS-PGGACVGR---NECREIPNVC-SHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECD-------RQPCGNGTCKNIIGSYNCLC---FPGFVVTHNGDCVDFDECTTLVGQ---------VCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFD---TRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECS--VGHPCGQGTCTNVIGGFEC----------------ACADGFEPGLM---MTCE-DIDECSLNPLLCAFRCH------NTEGSYLCTCPAGYTLREDGAMC--RDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTDDNECHAQP-----DLCVN------GRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQTMCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRDVDECRMLAHLCAHGECI-NSLGSFRCHCQAGYTPDATATTCLDMD--ECSQVPKPCTF-LCKNTKGSFLCSCPRGYLLEEDGRTC---------KDLDECTSRQHNCQFLCVNTVGAFTCRCPPGFTQHHQACFDNDECSAQPGPCGAHGHCHNTPGSFRCECHQGFTLVSSGHGC-EDVNECDGPHRCQHGCQNQLGGYRCSCPQGFTQHSQWAQCV---DENECALSPPTCGSASCRNTLG 2589          

HSP 5 Score: 104.375 bits (259), Expect = 4.925e-21
Identity = 201/841 (23.90%), Postives = 313/841 (37.22%), Query Frame = 1
Query:  535 CPKGFT--QKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC----------QYRRDQCQLYGSSCGIFGKCVPTSDGQYTCIC----IKPY-SVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYR---CLCN-GEYQGYN----NDQECVRYGTSEP----LVSR-YCSKSEYY----------SLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENG----RSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGG---ECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            CP GF   Q    C D+DEC   S C++G C N  GS+ C+C P   LD +   C          + +  +C++      +  +C  T    +   C    I P  +  F   + +   + N C  F  +C P G C     S+ C CP G       + C+     D+   P           V+    YR   C C+ G   G       D E + + +  P      SR + S   +Y           LC  G+C +    ++C C+ GF      R C  I+    +C ++   C  G C     + +EC+C  G+   E+G    ++C+  +       +C       + G C       Y C C  G+  +     C    +  D C   +    C  GQCV+   +++C CH  + S+ + Q CV   +                +  GG    C++T  +Y C CG GY    +GR C+ +++             +E    C  G C  +   G +CLC  GF +  D R+C    VD+C  N +IC  G CE +  S F C C     + K    C  +    E     CD   + L        +  C C PG+    DG EC+ +++  S       +            +Y C C  G+  + +G  C   +       +CD        G C       Y C C +G+    D ++C  +D  +CA     C  G C ++   + CIC G Y +   G +C          DI+E +  +P +            C  G C+     Y C CP  F+ N     CV
Sbjct:  751 CPPGFHFWQDTEICKDVDEC-LSSPCVSGVCRNLAGSYTCKCGPGSRLDPSGTFCLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFARMTGVTCDDVNECESFPGVC-PNGRCVNTAGSFRCECPEGLMLDASGRLCV-----DVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAVWGVECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACAGGFALDAQERNCTDID----ECRISPDLCGQGTCVNTPGS-FECECFPGY---ESGFMLMKNCMDVDECARDPLLC-------RGGTCTNTD-GSYKCQCPPGHELTAKGTAC----EDIDECSLSD--GLCPHGQCVNVIGAFQCSCHAGFQSTPDRQGCVDINECR--------------VQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDE------------CEENPRVCDQGHCT-NMPGGHRCLCYDGFMATPDMRTC--VDVDECDLNPHICLHGDCENTKGS-FVCHCQLGYMVRKGATGC-SDVDECEVGGHNCDSHASCLNIPG----SFSCRCLPGWVG--DGFECHDLDECVSQEHRCSPRGDCLNV----PGSYRCTCRQGF--AGDGFFCEDRDECAENVDLCD-------NGQCL-NAPGGYRCECEMGFDPTEDHRACQDVD--ECAQGNL-CAFGSCENLPGMFRCICNGGYELDRGGGNC---------TDINECA--DPVN------------CINGVCINTPGSYLCSCPQDFELNPSGVGCV 1485          

HSP 6 Score: 95.5153 bits (236), Expect = 2.227e-18
Identity = 224/984 (22.76%), Postives = 341/984 (34.65%), Query Frame = 1
Query:  310 NNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKID---RGLCKSTPENLQLSKE----------ECCSIFQVAWGNPCVFCDRNYCPKGF----------TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-QYRRDQCQL---------------------YGSSCGIFGK--------CVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRY----------GTSEPLVS----------RYCSKSEYYSLCEGGSCVDLNNDYYCQC---SEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENG-----RKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSIC----------DLHREK----------CKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            + CS +G C N     +C C  G+ G+         C   +D    G C + P   +   E           C  + + A GN C F      P  F           +    C DI+EC     C+NG CIN  GS+ C CP D  L+ + + C   R   C L                       S C   G+        C   +  +Y  +C        N  + I + + + C     LC   G+C     S+ C CP G+H SE  + C      DI +    +  C  G+C +    Y C+C  EY   N    C+            GT +  ++           Y     +   CE      ++ DY   C   + GF    +  + + I+    +C      C  G C      ++ C+C  GF  +    +C   +   +  S C+      Q   C  I P  Y C C  GY  S       +NE        +EI   C  G C+    SY C+CH  + +S +   C+   + +               C  G C +   +Y C C  G+  T NG      +C+ +  QV                 C  G C+ +    F CLC  GF   +DG++C     ++CL+    C PG C+    S FRC+CP    +  D H   I+  + EP             C  G C N     +C+C PG+  S++G  C+   +          +C              C    G    +    C +  SA  ++ +C          D  RE           C  G+C       + C C  GY       +C+  D  +C+V  + C  G C +++ G+ C C   +   E G       + +   DI E S  NP   +F             +C   +  Y C CP  + T   D    RD ++C
Sbjct: 1330 HRCSPRGDCLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVDTRAGNCFLETHDRGDSGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCPGGEGFQPNRITVILE-DIDECQELPGLCQ-GGDCVNTFGSFQCECPPGYHLSEHTRIC-----EDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACP-TPISPDYQILCGNQAPGFLTDIHTGKPLDID----ECGEIPAICANGICIN-QIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQ------QNADCINI-PGSYRCKCTRGYKLSPGGACVGRNE-------CREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECD------------RQPCGNGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQV-----------------CRFGHCL-NTAGSFHCLCQDGFELTADGKNC--VDTNECLSLAGTCLPGTCQNLEGS-FRCICPPGFQVQSD-HCIDIDECSEEPNL-----------CLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQE-LCPFGHGAVPGPDDSREDVNECAENPGVCTNGVCVNT-DGSFRCECPFGYSLDFTGINCV--DTDECSVG-HPCGQGTCTNVIGGFECACADGF---EPG-------LMMTCEDIDECSL-NPLLCAF-------------RCHNTEGSYLCTCPAGY-TLREDGAMCRDVDEC 2211          

HSP 7 Score: 67.781 bits (164), Expect = 6.074e-10
Identity = 86/366 (23.50%), Postives = 137/366 (37.43%), Query Frame = 1
Query: 1921 SRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSE------------------SALIKKSIC------DLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            S C  G C+ +    + C C PGF +    ++C    VD+C+ +  +C  GRC  +  S F+CVC     LS DG +C+ +      T            C +G C+N+     C+C PG+  +  G  C  I++  +        C         + ++ CQCL G     +GR C+ +                      + KS C          E C+  +C      ++   C  G    TD +     D  +CA++   C  G C ++   Y C+C   Y    +G+DC          D+ E           C    ++  C  G C      Y C CP  F   + D E  +D ++C
Sbjct:  456 SPCHHGDCV-NIPGTYHCRCYPGFQATPTRQAC--VDVDECIVSGGLCHLGRCVNTEGS-FQCVCNAGFELSPDGKNCVDHNECATSTM-----------CVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTPGICVNGHCTNT------EGSFRCQCLGGLAVGTDGRVCVDTHVRSTCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQ--LCPAKDSAEFQALCSSGLGITTDGR-----DINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDC---------TDVDE-----------CALNSLL--CDNGWCQNSPGSYSCSCPPGFHF-WQDTEICKDVDEC 770          

HSP 8 Score: 62.3882 bits (150), Expect = 3.176e-8
Identity = 59/207 (28.50%), Postives = 91/207 (43.96%), Query Frame = 1
Query:  508 PCVFCDRNY-------CPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQ 1101
            PC F  +N        CP+G+  +E+   C D+DEC  +       C+N  G+F C+CPP     ++  +C +  D+C      CG  G C  T  G + C C + +++  +G  C    + N C+   +       CQ     Y CSCP GF Q      C+  +   +  SP     C   SC +   G+RC+C     G++ DQ
Sbjct: 2415 PCTFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFLCVNTVGAFTCRCPPG--FTQHHQAC-FDNDECSAQPGPCGAHGHCHNTP-GSFRCECHQGFTLVSSGHGC---EDVNECDGPHRC---QHGCQNQLGGYRCSCPQGFTQHSQWAQCVDENECAL--SPPT---CGSASCRNTLGGFRCVCP---SGFDFDQ 2603          
BLAST of Fibrillin-2 vs. UniProt/SwissProt
Match: sp|P35556|FBN2_HUMAN (Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3)

HSP 1 Score: 157.147 bits (396), Expect = 3.487e-37
Identity = 242/1008 (24.01%), Postives = 363/1008 (36.01%), Query Frame = 1
Query:  253 YDKTIRTETCPQNNQKLCTNNCSNKGQCQNG----KCICESGY----FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-YCPKGFTQ-KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-----------------------QYRRDQC-----QLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNY---NVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI-----------------VNSNSDI-----------------CQSPEIAER----CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTE--------------PPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQ-----------------EYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSIC-----DLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            Y     TETC   N+  C +N    G C+N      C C  G      G  C  ++  TC++ I    C+       L K ECC+    AWG+PC  C+ +  CP+G  + K   C+D++EC+ F  +C NG C+N KGSF C+CP    LD     C                       ++R D C       +G+ C    +C      +Y  +C +    +  G     +  Y   N C  F  +C  YG+C+    S+ C C SGF    ++++C                  VN+                     C   +  ER    CRGG+CV+    ++C C   ++   + ++CV            CS S+  +LC  G CV++   Y C C+ G+ AT +R+ C  I+           QC           +YEC C  G+    +GRSC   +   N+  IC+  G +C         P EY C C +G+  S D K CI      D  +    S  C  G+C +   S+ C C   Y        C    + E               P    CS  E + +  G +C+D                 NG     I  Q    P +  C                    E ++ C  G+C+ +    ++C C  GFT ASD RSC  + +D+C + +NIC  G C       F C+C     L + G +C              D   + + C +G CVN      C C P ++ +  G  C                          DN      L    + +   SC       + +S C           C+T  C P+   +Y   C  G     +  + I+ D  +C      C+GG C +    + C C   Y ++E+ R C          DI E  + +P              C PG C     +Y C CP  +      H C+
Sbjct:  841 YVFRTETETCEDINE--CESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATL-KSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECE---ECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCT-YGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDI--------NECSLSD--NLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSE------GSYECSCSEGYALMPDGRSCADIDECENNPDICD--GGQCTN------IPGEYRCLCYDGFMASMDMKTCI------DVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGW-IGNGIKCIDL------------DECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCL-NVPGAYRCECEMGFTPASDSRSC--QDIDEC-SFQNICVFGTCNNL-PGMFHCICDDGYELDRTGGNC-----------TDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCV-------------------------DNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCET--CPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRIC---------EDIDEC-FAHPGV------------CGPGTCYNTLGNYTCICPPEYMQVNGGHNCM 1733          

HSP 2 Score: 128.257 bits (321), Expect = 2.464e-28
Identity = 232/1006 (23.06%), Postives = 359/1006 (35.69%), Query Frame = 1
Query:  310 NNCSNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKI----DRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR-------NYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSV-----------------SFNGKSCIKKTNYNV------CNY-----FKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCE-GGSCVDLNNDYYCQCSEGFYATEN-----RRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQ------ECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNN--ENICT-----------------PGR--------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFDENSISTCSCSENYENLFDTGLC 3027
            + C++   C NG C+   G +             G  C    +  CY+K     D  L  +T   + +S+  CC     AWGNPC  C           CP G   + N      +DIDECQ    +C  G CIN  GSF+C+CP  +YL E+T  C+   D+C  +   CG  G C  T  G YTCIC   Y                   S+NG +C  +  +NV      C Y     + K C P            C    GF         +     DI +  EI   C  G C+++   +RC C   +    ND   V     E      CS  +  +LC+    C++    Y C+C+ GF  + N     R  C++I  +          C  G C +L   +Y+C C  GF  S++   C+  +         E   H C  G C       Y C C  G+  + +   C+  ++   +       + CR G+C +   S++C+C+  Y  + +G+      ECV    +  P      +  +  +C  G  V +                    C  I  +  E+P+            C+ G C  +   GF+CLC PGF  + +GR C       C  N     C+                 PG         C +     F+ +CPY       GH  + +   T      C  L +   C++G C+N     RC C  GY     G  C   ++ S         C           ++EC C  G+       +C           +C     +C            Y C C +GY    D+K C  +D     +++   +G  C +++  ++CIC        +G  C+                     ++ C  K  I  C+ G+CV     Y+C+C   F+++    EC+ +          CF E   + C  + +  NL     C
Sbjct: 1534 DECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICE-DIDECFAHPGVCGP-GTCYNTL-GNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAV-----DIDECKEIPGICANGVCINQIGSFRCECPTGFS--YNDLLLVCEDIDE------CSNGD--NLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNV----------CSHGLCVDL-QGSYQCICHNGFKASQDQTMCMDVD---------ECERHPCGNGTCKNTV-GSYNCLCYPGFELTHNND-CLDIDECSSF-----FGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKS------------------ENCIDI-NECDEDPN-----------ICLFGSCT-NTPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPY-------GHGTVPSLHDTREDVNEC--LESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCTNVI------GSFECNCNEGFEPGPM-MNCEDINECAQNPLLCAF---RCMNTF------GSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCV--------------------DENECRTKPGI--CENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGL------CFAEVLQTICQMASSSRNLVTKSEC 2410          

HSP 3 Score: 124.79 bits (312), Expect = 2.493e-27
Identity = 253/1072 (23.60%), Postives = 385/1072 (35.91%), Query Frame = 1
Query:  325 KGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR-------NYCPKGFTQKENRCD---------DIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNG-KSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGT------------SEPLVSRYCSKSEYYSL-------------------CEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLIN-----YVTTEPTTK-----YCDILVNRLR----CASGNCVNDRCICGPGYKSSE-----DGKECYKIEKVSSIXXXXXXXXXXXXXXXXDD-----NNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKC--AVNEYRCKGGYCYDIVDGYLCICVGNY--------------------TVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYY-------------DHECVR----------------------------DSNKCP----YCFYG-CFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTCR 3078
             G C NG+C+   G F             G  C    +  CY+K D   C   P   +   + CC     AWG  C  C +         CP+G     NR D         DI+EC+ F  +C  G+C N  GSF+C+C     LD    +C    D+C++    CG  G CV T  G + C C + Y   F   K+C+   + + C     LC   G C     S+ C CP G   S  ++ C+     DI +       CR G CV+    Y+C CN  YQ   + Q C                 +    S  CS SE Y+L                   C+GG C ++  +Y C C +GF A+ + + CI +    ++C LN   C  G C+     ++ C C  G+   +    C   +        CE+  H C         P  + C+C EG+  +  +  CI  ++  +      I+      QCV+   SYRC C   +  + +G  C    +            E  +LC+ G+C++    Y C+C  G+    + R C  I++          C  Q     C+ G C  +    F C+C  G+     G +C    +D+C +  N C  G C  +    + C CP    L+  G  C+ N     Y+   P          +I V   R    C+ G    + C   P   S+E      G E ++   ++ I        +  G  +  +      +++C+C  GY  SE+ R C   +        C  H   C  G CY    N Y C C   Y Q     +C+ M    C  + N   C+    +++    +C C  N                     T+  N       I   K+VDI E              KEI   C  G C+ +   ++C+CP  F  N               D+ C R                            D N+C      C +G C D      C C   ++   D  +C+   +   +  G+ TC+
Sbjct:  963 PGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIH-PVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRG-AGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCT-DIDECRISPDLCG-SGICVNTP-GSFECECFEGYESGFMMMKNCM---DIDECERNPLLCR-GGTCVNTEGSFQCDCPLGHELSPSREDCV-----DINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDV----NECDLNSNICMFGECENT-KGSFICHCQLGYSVKKGTTGCTDVDE-------CEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIK--CIDLDECSNGTHQCSINA-----QCVNTPGSYRCACSEGF--TGDGFTCSDVDECA----------ENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDE----------CSFQNI---CVFGTC-NNLPGMFHCICDDGYELDRTGGNC--TDIDECADPIN-CVNGLCVNT-PGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEDTRICEDIDE-------CFAHPGVCGPGTCYNTLGN-YTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTK-RMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDEC-------------KEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPCGNGTCK 1949          

HSP 4 Score: 123.25 bits (308), Expect = 7.697e-27
Identity = 234/1014 (23.08%), Postives = 344/1014 (33.93%), Query Frame = 1
Query:  148 CCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNY-------------------------------------CPKGFTQKEN--RCDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCI--CIKP---YSVSFNGKSCIKKTNYNVCNYFKKLC---LPYGEC------QPYGLSYYCSCPS--------------------GFHQSEDKKSC-------IVNSNSDICQSPEI----AERCRGGSCVSEGKGYRCLCNGEY-QGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLP----------GFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICD-------LHREKCKT-GICY--PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CC GW     G+ C+   C   CG G C   N+C C    I + TC   + + C+  C N G C +  C C+ GY G  C   +                                    C+ +++  +C+     +  +K  CC+    AWG+PC  C        R +                                     CP G  Q E   +C+DIDEC     IC  GEC N  GS+ C CP  +    +   C  +R      G    + G+C     G+ T +  C +P   + +    ++C  + +      +++LC   LP G        +P G       PS                    GF                I+   + + Q+ +I    A  C  G C+     YRC CN  Y Q  N D   V   TS P              C  G CV+    YYC+C  GF  T  ++ CI I+    +C  N   C+ GRC   D  +++C C  GF  + +G++C+  +    +        + C  G+C       + C C  G+  + + +YC       D CQ   I   C  G C+++  S+RC C        +G              R+C      S C GG                            I+K V   P        E         C  +  YGF   C P          G  S+  G + D   +++C  + +IC  G CE    S +RC C         G +C+             + LVNRL C +G C N      C C PGY    + + C  I +  S            G    +  ++ C+C  G   S  G  CI S        I+ S C+       L  E C T G  +  P  + +   AC  G  +    K     D  +C V    C  G C +    + C C    T+   GR C+
Sbjct:   97 CCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSSGQI-SSTCGSKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCIDQRTGMCFSGL---VNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGS----EEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNP--------------CTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDID----ECIQNGVLCKNGRCVNTD-GSFQCICNAGFELTTDGKNCVDHDECTTT--------NMCLNGMCI-NEDGSFKCICKPGFVLAPNGRYCTD----VDECQTPGI---CMNGHCINSEGSFRCDCPPGLAVGMDG--------------RVCVDTHMRSTCYGG----------------------------IKKGVCVRPFPGAVTKSEC--------CCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGS-YRCNCNSGYEPDASGRNCI----------DIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECES-------NPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARI---KGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCL 996          

HSP 5 Score: 119.013 bits (297), Expect = 1.571e-25
Identity = 242/956 (25.31%), Postives = 353/956 (36.92%), Query Frame = 1
Query:  205 YDCGYGRC---VGLNVCECYDKTIRTETCPQNNQKLCTNNCSNK-GQ-CQNGKCICESGYFGEDCNTAIISTCYVK--IDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKC-VPTS--DGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVR-YGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDK--------TYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY----CFYGCFDENSISTCSCSENY 3000
            + CG G C   VG   C CY     T     NN  L  + CS+  GQ C+NG+C  E G F   CN     T   K  ID   C + P +        C   + ++        R  CP G+  K   C DI+EC +  +ICL G C N  G F+C CPP   L +N   C   R   Q +  +    GKC VP +    +  C C K     +     +   +  V   F+ LC       PYG   + + PS     ED   C+        +SP I   C  G C++    +RC C     GYN D   VR   T E  +   C           G+C ++   + C C+EGF         +  E I ++CA N   C   RC      +YEC C  G+   E+ + C   +        CE  G  C+  +        ++C C  G ++  D + C+   + +           C  G+CV+   SYRC C+  + SS++G EC+  +Q       LC      ++CQ                                        +S  L+ +    C GGR  G +        T  +K +C  G    +DGR      +D+C    N+CT G+C  +  S FRC C    +    G SC I+      + K C+ +      +       +C C  GY   EDGK C  +++  +     Q  C            + C+C  G+ +     +CI +     + S+C         GIC       + C C  G+       +C  +D  +C  N +RC+ G C +I+ GY C C   Y        C         VD +E S  N               C    C      Y+C CP  F  + +   C  D N+C      C YGC +      C C   Y
Sbjct: 1941 HPCGNGTCKNTVGSYNCLCYPGFELT----HNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGT---CQNLEGSF--------RCICPPGYEVKSENCIDINECDEDPNICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTR---QSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEV--AFQDLC-------PYG---HGTVPSLHDTREDVNECL--------ESPGI---CSNGQCINTDGSFRCECP---MGYNLDYTGVRCVDTDECSIGNPCGN---------GTCTNVIGSFECNCNEGFEPGPM----MNCEDI-NECAQNPLLC-AFRCMNT-FGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLI------GTFMCICPPGMARRPDGEGCVDENECRTK------PGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQG------LCFAEVLQTICQ-------------------------------------MASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRD-----IDECKVMPNLCTNGQCINTMGS-FRCFCKVGYTTDISGTSC-IDLDECSQSPKPCNYICKNTEGSY------QCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTL------GGFTCKCPPGFTQHHT--ACIDNNECGSQPSLCG------AKGICQNT-PGSFSCECQRGFSLDATGLNCEDVD--ECDGN-HRCQHG-CQNILGGYRCGCPQGYIQHYQWNQC---------VDENECSNPN--------------ACGSASCYNTLGSYKCACPSGFSFDQFSSAC-HDVNECSSSKNPCNYGCSNTEGGYLCGCPPGY 2725          

HSP 6 Score: 117.087 bits (292), Expect = 6.629e-25
Identity = 227/954 (23.79%), Postives = 356/954 (37.32%), Query Frame = 1
Query:  340 NGKCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQV--AWGNPCVFCDR-----------NYCPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQ-GYNND----QECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGF-IRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC--------VRYKQTEP------PAVRLCSK-----WEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLS------KDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICDLHREK----------CKTG--------ICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDI-------SEVSYQNPQSQSFCTRKE-----IIEKCQPGK------CVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            N  CIC   Y     G +C     S CY   +   C++      ++K  CC  + V  AW  PC  C             N     F     +  DIDEC +   IC NG CIN+ GSFRC+CP     ++  + C+   D+C    + C     C+  S G Y C C   + +S NG +C+ +   N C     +C  +G C     SY C C +GF  S+D+  C+   + D C+       C  G+C +    Y CLC   ++  +NND     EC  +               +  +C  G C +    + C C+EG+  T + + CI     T++C      C  G CQ L+ + + C C  G+ ++SEN   CI         +IC L+G    T       P  + C C  G+  S++ + C    Q   +C     + +C   +   N    +C C  K      G  C        V ++   P      P++    +      E   +C  G+C++T+ ++ C+C  GY     G +C   ++     P             C  G C  +    F+C C  GF     G   + E +++C  N  +C   RC  +  S + C CP   +L       KD   C       E     C  L+    C          IC PG     DG+ C    +  +   + +              +Y C+C  G+  S +G  C+ +   L    + ++IC +              C  G        +C   G   Y   C  G    TD +     D  +C V    C  G C + +  + C C   YT   +G  CI      +S          +E SYQ    + +  +++      +++CQ  +      CV     + CKCP  F  +   H    D+N+C
Sbjct: 1714 NYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELP-FNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCE-DIDECSNGDNLCQRNADCI-NSPGSYRCECAAGFKLSPNG-ACVDR---NECLEIPNVC-SHGLCVDLQGSYQCICHNGFKASQDQTMCM---DVDECER----HPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSF---------------FGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCID----TNECVALPGSCSPGTCQNLEGS-FRCICPPGYEVKSEN---CIDINECDEDPNIC-LFGSCTNT-------PGGFQCLCPPGFVLSDNGRRCFDTRQ--SFCFTNFENGKCSVPK-AFNTTKAKCCCS-KMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNP-------------CGNGTCT-NVIGSFECNCNEGFEP---GPMMNCEDINECAQNPLLCA-FRCMNTFGS-YECTCPIGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMC----------ICPPGMARRPDGEGCVDENECRTKPGICENGRCVNII-----GSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGR-----DIDECKVMPNLCTNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNYICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQH---HTACIDNNEC 2575          

HSP 7 Score: 105.916 bits (263), Expect = 1.623e-21
Identity = 239/1042 (22.94%), Postives = 364/1042 (34.93%), Query Frame = 1
Query:  157 GWIKNVYGDCVK-SECDYD-CGYGRCV---GLNVCECYDKTIRTETCPQNNQKLCTNNCSNKG-QCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFN-GKSCIKKTNYNVCNYFKKLCLPYGE-CQPYGLSYYCSCPSG----FHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQS-----EDRKYC------IKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTE--------------PPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEP---DNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENIC-------TPG------------------------RCERSG-----------NSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKI---IAVKSVDISEVSYQNPQSQSFCTRKEII---------EKCQPG--------KCVEKQEDYQCKCPHSFKTNYYD----HECVRDSNKC 2934
            G+ ++  GDC+   EC  + C  G CV   G   C+C+    RT   P     +  + C   G  C+NG+C+   G F   CN                + T +       + C+   +     C+  D ++   C  GF    N   C D+DECQ   IC+NG CIN +GSFRC CPP   +  +   C     +   YG              G    +C++P+  +    + C    +Y            +GE CQP        CP+     FH        I     DI +     + C  G C +    YRC CN  Y+   + + C+     E LV+R         LC+ G C +    Y C C  G+        C  I    S        C  G C+  +  ++ C+C  G   S  G  CI + +    T    +   RC+  +      +E  CA L     S     E    C      IK    +D  + +     C  G+CV++  S+ C C         G+ C+  +  +              P   R+ +         G EC +                  G   +     +T  P   D + C  + +   C  G+C  +    FKC C  GF    + R+C    +D+C  + ++C       TPG                         CER+              +F+C CP    LS     C+ IN  +          L + L C +G CVN     +C C PGY+++ D + C  I++   +                 + +YEC C  GY    +GRSC   +       ICD        G C  I   +Y C C  G+  + D K+CI  D  +C +N   C  G C +    ++C C   Y+V +    C       I   + D+       P S     R+  I         ++C  G        +CV     Y+C C   F  + +      EC  + N C
Sbjct:  524 GYKQDANGDCIDVDECTSNPCTNGDCVNTPGSYYCKCHAGFQRT---PTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGF-------------ELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYG--------------GIKKGVCVRPFPGAVTKSECCCANPDYG-----------FGEPCQP--------CPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDI--DECLVNRL--------LCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESN------PCVNGACRN-NLGSFNCECSPGSKLSSTGLICIDSLK---GTCWLNIQDSRCEVNINGATLKSE-CCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEEC---PKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINEC--KAFPGMCTYGKCR-NTIGSFKCRCNSGFALDMEERNC--TDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECS----------LSDNL-CRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIM------NGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICD-------GGQCTNI-PGEYRCLCYDGFMASMDMKTCI--DVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLC 1460          

HSP 8 Score: 104.375 bits (259), Expect = 5.217e-21
Identity = 217/884 (24.55%), Postives = 320/884 (36.20%), Query Frame = 1
Query:  508 PCVFCDRNYCPKGFTQKEN-RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGG-----------------SCVDLNNDY----YCQCSEGFYATENRRRCIKIETIT------SQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIE------------KQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFR---CVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQA-TDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFDENSIST----CSCSENYENLFD 3015
            P V   R  C  G+ Q  N  C D+DEC   + C NG+C+N  GS+ C+C           +C    D+C   G  C   G+CV T DG + CIC   + ++ +GK+C+        N    +CL  G C     S+ C C  GF  + + + C   ++ D CQ+P I   C  G C++    +RC C                G +  +  R C  +   S C GG                  C   N DY     CQ      + E    C     IT      ++CAL+   C  G C+ L   +Y C C  G+    +GR+CI  +        C +    C  G+C    P  Y C C  GY    + + C      +D   N+  S  C  G C +N  S+ C C      S+ G  C+   +        C      S C+    V+ N                G  C R E            K VT E  N     + +   C  GRC+  K   F C C  G T    GR C    ++QC    +      C       FR   C C   A+   +   C       +P TK  + L     C  G    +R     G    +D  EC     + +                    +++C+C +G+      R+C   +        C +  + C +GIC       + C C  GY+      K+C+ +D  +C  N   C+GG C +    + C C   + ++ +  DC         VDI+E S  +               C+ GKCV     YQC C   ++    D +   D ++C     GC  + + S     CSCSE Y  + D
Sbjct:  512 PTVSSYRCECNMGYKQDANGDCIDVDECT-SNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQAC-IDIDECIQNGVLC-KNGRCVNT-DGSFQCICNAGFELTTDGKNCVDHDECTTTN----MCL-NGMCINEDGSFKCICKPGFVLAPNGRYC---TDVDECQTPGI---CMNGHCINSEGSFRCDC--------------PPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENL-RGSYRCNCNSGYEPDASGRNCIDIDE-------CLVNRLLCDNGLCRNT-PGSYSCTCPPGYVFRTETETC------EDI--NECESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKG------TCWLNIQDSRCE----VNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNE---CEVFPGVCPNGRCVNSKG-SFHCECPEGLTLDGTGRVCLDIRMEQCYLKWD---EDECIHPVPGKFRMDACCCAVGAAWGTECEEC------PKPGTKEYETL-----CPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTI-----------GSFKCRCNSGFALDMEERNCTDIDE-------CRISPDLCGSGICVNT-PGSFECECFEGYESGFMMMKNCMDID--ECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDC---------VDINECSLSD-------------NLCRNGKCVNMIGTYQCSCNPGYQATP-DRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPD 1277          

HSP 9 Score: 102.834 bits (255), Expect = 1.268e-20
Identity = 234/1039 (22.52%), Postives = 369/1039 (35.51%), Query Frame = 1
Query:  328 GQCQNG----KCICESGYF--GEDCNTAIISTCYVKID---RGLCKSTPENLQ-----------------LSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDECQFK-SICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLV--------------SRYCSKSEYYSLCEGGSCVDLN-------------------NDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVR------YKQTEPPA--------------------VRLCSKW-------------EYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLI----------------NYVTTEPTTKYCDILVNRLR--------CASGNCVNDRCICG--PGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYG-------CFDENSISTCSCSENYENLFDTGLCI 3030
            G+C+N     KC C SG+    E+ N   I  C +  D    G+C +TP + +                 +  +EC     +  G  CV  + ++   CP G     +R  C DI+EC    ++C NG+C+N  G+++C C P +    +   C    D+C +    C    +C   S+G Y C C + Y++  +G+SC    + + C     +C   G+C      Y C C  GF  S D K+CI  +  D+      +  C  G C +    + C C   Y        C      E                 S  CS  E + +  G  C+DL+                     Y C CSEGF  T +   C  ++    +CA N   C+ G+C  +    Y C+C  GF  + + RSC   +           + + C  G C  + P  + C C +GY        C   ++  D          C  G CV+    Y C C   +  +  G  CV       Y +  P                        L   W             EYY+LC GGE                     G + + I   + E+ D      QE    C GG CI   T+G F+C C  G+  + D R C  E +D+C  +  +C PG C  +   N+ C+CP        GH+C+                 N +    T + C    N  +        C +    + + ICG  PG+       +   I++   I  +                ++ C+C  G+  ++    C   +      ++C  + +   +          Y C C  G+K + +      +D  +C      C  G C D+   Y CIC   +  +++   C+         D+ E           C R      C  G C      Y C C   F+  + +++C+ D ++C   F+G       CF+E     C C+E YE   D   CI
Sbjct: 1087 GKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCT-DIDECMIMNGGCDT--QCT-NSEGSYECSCSEGYALMPDGRSC---ADIDECENNPDIC-DGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDL-----NSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGW-IGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGF--TGDGFTCSDVD----ECAENINLCENGQCLNVPGA-YRCECEMGFTPASDSRSCQDIDECS--------FQNICVFGTCNNL-PGMFHCICDDGYELDRTGGNCTDIDECAD-------PINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGE---------------------GFRPNPI-TIILEDIDE----CQELPGLCQGGNCI--NTFGSFQCECPQGYYLSEDTRIC--EDIDECFAHPGVCGPGTCYNT-LGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQI-----GSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINS-------PGSYRCECAAGFKLSPNGA---CVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCM---------DVDE-----------CER----HPCGNGTCKNTVGSYNCLCYPGFELTH-NNDCL-DIDECSS-FFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCI 2015          

HSP 10 Score: 100.523 bits (249), Expect = 7.943e-20
Identity = 178/760 (23.42%), Postives = 274/760 (36.05%), Query Frame = 1
Query:  307 TNNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKI---DRGLCKSTPENLQLSKE----------ECCSIFQVAWGNPCVFCDRNYCPKGF----------TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-QYRRDQCQL-YG--------------------SSCGIFGK--------CVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENR-------RRCIKIETITSQCALNQFQCQGGRCQELDN-----------------NNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENG-----RKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEK 2313
            T+ CS   QC N     +C C  G+ G+    + +  C   I   + G C + P   +   E           C  I + ++ N CVF   N  P  F           +    C DIDEC     C+NG C+N  G + C CPPD  L+   + C   R   C L +G                    S C   GK        C P +  +Y  +C        N  + I + + + C     LC   G C     S+ C CP G++ SED + C      DI +       C  G+C +    Y C+C  EY   N    C+       +   +C +S   + CE     ++     C C+       N+             +TI        F    G+  ++D                   ++ C+C  GF  ++    C   +   N  ++C+       +       P  Y C C  G+  S +     +NE         EI   C  G CV    SY+C+CH  + +S +   C+   + E               C  G C +T  +Y C C  G+  T N       +CS    QV                 C  GRC  ++   FKCLC  G+    DG++C     ++C+     C+PG C+    S FRC+CP    +  +  +C+ IN    +P             C  G+C N     +C+C PG+  S++G+ C+   +
Sbjct: 1416 THQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILE-DIDECQELPGLCQ-GGNCINTFGSFQCECPQGYYLSEDTRIC-----EDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMD------MRKSFCYRSYNGTTCENELPFNVTKRMCC-CTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINS-------PGSYRCECAAGFKLSPNGACVDRNECL-------EIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECE------------RHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQV-----------------CRNGRCF-NEIGSFKCLCNEGYELTPDGKNCID--TNECVALPGSCSPGTCQNLEGS-FRCICPPGYEVKSE--NCIDINECDEDPNI-----------CLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQ 2101          

HSP 11 Score: 85.8853 bits (211), Expect = 1.836e-15
Identity = 199/855 (23.27%), Postives = 304/855 (35.56%), Query Frame = 1
Query:  577 IDECQFKS-ICLNGECINEKGSFRCQCPPDHYLDEN--------------------------------------TMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGG-----------------SCVDLNNDY----YCQCSEGFYATENRRRCIKIETIT------SQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIE------------KQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCL--NNENIC---TPGR--------------------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRL---RCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKE 2811
            ID C+  + +CLNG CI    S+RC+C   +  D N                                      T       D+C   G  C   G+CV T DG + CIC   + ++ +GK+C+        N    +CL  G C     S+ C C  GF  + + + C   ++ D CQ+P I   C  G C++    +RC C                G +  +  R C  +   S C GG                  C   N DY     CQ      + E    C     IT      ++CAL+   C  G C+ L   +Y C C  G+    +GR+CI  +        C +    C  G+C    P  Y C C  GY    + + C      +D   N+  S  C  G C +N  S+ C C      S+ G  C+   +        C      S C+    V+ N                G  C R E            K VT E  N     + +   C  GRC+  K   F C C  G T    GR C    ++QC    +E+ C    PG+                    C + G   +  +CP  A  +  G     + +T  P  K  DI   +     C  G C N     +C C  G+    + + C  I++             G G       ++EC+C  GY   E+G   +K+    +    C+ +   C+ G C    +  + C C LG++ +  ++ C+ ++  +C++++  C+ G C +++  Y C C   Y  T + + C          DI E    N    + CT  E
Sbjct:  495 IDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLC-KNGRCVNT-DGSFQCICNAGFELTTDGKNCVDHDECTTTN----MCL-NGMCINEDGSFKCICKPGFVLAPNGRYC---TDVDECQTPGI---CMNGHCINSEGSFRCDC--------------PPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENL-RGSYRCNCNSGYEPDASGRNCIDIDE-------CLVNRLLCDNGLCRNT-PGSYSCTCPPGYVFRTETETC------EDI--NECESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKG------TCWLNIQDSRCE----VNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNE---CEVFPGVCPNGRCVNSKG-SFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRG-----DVLTGRPFYK--DINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECR-----ISPDLCGSGICVNTPGSFECECFEGY---ESGFMMMKN---CMDIDECERNPLLCRGGTCVNT-EGSFQCDCPLGHELSPSREDCVDIN--ECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGC---------TDIDECMIMNGGCDTQCTNSE 1261          

HSP 12 Score: 62.3882 bits (150), Expect = 3.325e-8
Identity = 110/428 (25.70%), Postives = 161/428 (37.62%), Query Frame = 1
Query:  310 NNCSNK-GQCQNGKCICESGYFGEDCNTAIIST-------------CYVKIDRGLCK--STPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQ-FKSICLNGECINEKGSF-----------------------------------------RCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGR 1398
            N C  K G C+NG+C+   G +  +CN    S+             C+ ++ + +C+  S+  NL ++K ECC      WG+ C  C        +  CP G     +   DIDEC+   ++C NG+CIN  GSF                                         +C CP  + L E+  +C+   D+CQ    +C     CV T  G +TC C  P   + +  +CI     N C     LC   G CQ    S+ C C  GF       +C    + D C       RC+ G C +   GYRC C   Y  +    +CV            CS     + C   SC +    Y C C  GF   +    C  +    ++C+ ++  C  G C   +   Y C C  G+ R   G 
Sbjct: 2340 NECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNL-VTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDG-RDIDECKVMPNLCTNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNYICKNTEGSYQCSCPRGYVLQEDGKTCK-DLDECQTKQHNCQFL--CVNTLGG-FTCKC--PPGFTQHHTACIDN---NECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNC---EDVDECDG---NHRCQHG-CQNILGGYRCGCPQGYIQHYQWNQCVD--------ENECSNP---NACGSASCYNTLGSYKCACPSGFSFDQFSSACHDV----NECSSSKNPCNYG-CSNTE-GGYLCGCPPGYYRVGQGH 2732          
BLAST of Fibrillin-2 vs. UniProt/SwissProt
Match: sp|Q61555|FBN2_MOUSE (Fibrillin-2 OS=Mus musculus OX=10090 GN=Fbn2 PE=1 SV=2)

HSP 1 Score: 155.221 bits (391), Expect = 1.158e-36
Identity = 242/1008 (24.01%), Postives = 362/1008 (35.91%), Query Frame = 1
Query:  253 YDKTIRTETCPQNNQKLCTNNCSNKGQCQNG----KCICESGY----FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY-CPKGFTQ-KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-----------------------QYRRDQC-----QLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNY---NVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI-----------------VNSNSDI-----------------CQSPEIAER----CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTE--------------PPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLS-----------------RCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSIC-----DLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            Y     TETC   N+  C +N    G C+N      C C  G      G  C  ++  TC++ I    C+       L K ECC+    AWG+PC  C+ +  CP+GF + K   C+D++EC+ F  +C NG C+N KGSF C+CP    LD     C                       ++R D C       +G+ C    +C      +Y  +C +    +  G     +  Y   N C  F  +C  YG+C+    S+ C C +GF    ++++C                  VN+                     C   +  ER    CRGG+CV+    ++C C   ++   + ++CV            CS S+  +LC  G CV++   Y C C+ G+ AT +R+ C  I+           QC           +YEC C  G+    +GRSC   +   N+  IC+  G +C         P EY C C +G+  S D K CI   +      N  I   C  G+C +   S+ C C   Y        C    + E               P    CS  E + +  G +C+D                 NG     I  Q    P +  C   E  +                  C  G+C+ +    ++C C  GFT ASD RSC  + +D+C + +NIC  G C       F C+C     L + G +C              D   + + C +G CVN      C C P ++ +  G  C                          DN      L    + +   SC       + +S C           C+T  C P+   +Y   C  G     +  + I+ D  +C      C+GG C +    + C C   Y ++E  R C          DI E  + +P              C PG C     +Y C CP  +      H C+
Sbjct:  834 YVFRTETETCEDVNE--CESNPCVNGACRNNLGSFHCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATL-KSECCATLGAAWGSPCERCELDAACPRGFARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEHCFLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECE---ECPKPGTKEYETLCPRGPGFANRGDILTGRPFYKDINECKAFPGMCT-YGKCRNTIGSFKCRCNNGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDI--------NECSLSD--NLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSE------GSYECSCSEGYALMPDGRSCADIDECENNPDICD--GGQCTN------IPGEYRCLCYDGFMASMDMKTCIDVNECD---LNPNI---CMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGW-VGNGIKCIDL------------DECANGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENTNLCENGQCL-NVPGAYRCECEMGFTPASDSRSC--QDIDEC-SFQNICVFGTCNNLPGM-FHCICDDGYELDRTGGNC-----------TDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCV-------------------------DNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCET--CPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRIC---------EDIDEC-FAHPGV------------CGPGTCYNTLGNYTCICPPEYMQVNGGHNCM 1726          

HSP 2 Score: 126.331 bits (316), Expect = 1.015e-27
Identity = 230/1007 (22.84%), Postives = 339/1007 (33.66%), Query Frame = 1
Query:  148 CCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNY-------------------------------------CPKGFTQKEN--RCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKP---YSVSFNGKSCIKKTNYNVCNYFKKLC---LPYGECQPYGLS-----------------YYCSCP--SGFHQSEDKKS-------------CIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEY-QGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLP----------GFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICD-----------LHREKCKT-GICY--PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CC GW     G+ C+   C   CG G C   N+C C    I + TC   + + C+  C N G C +  C C+ GY G  C   +                                    C+ +++  +C+     +  +K  CC+    AWG+PC  C        R +                                     CP G  Q E   +C+DIDEC     +C  G+C N  GS+ C CP       +   C  +R      G   G   + +P    +  C C +P   +S+    ++C  + +      +++LC   LP G      +S                  +   P  +GF                      I+N   DIC+    A  C  G C+     YRC CN  Y Q  N D   V   TS P              C  G CV+    YYC+C  GF  T  ++ CI I+    +C  N   C+ GRC   D  +++C C  GF  + +G++C+  +    +        + C  G+C       + C C  G+  + + +YC       D CQ   I   C  G C++N  S+RC C        +G              R+C      S C G                             I+K V   P        E         C  +  YGF   C P          G  S+  G + D   +++C  + +IC  G CE    S +RC C         G +C+             + LVNRL C +G C N      C C PGY    + + C  + +  S            G    +  ++ C+C  G   S  G  CI S       +I D           L  E C T G  +  P  + +   AC  G+ +    K     D  +C V    C  G C +    + C C    T+   GR C+
Sbjct:   97 CCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSSGQI-SPTCGAKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSVIPGVCETGDCSNTVGSYFCLCPRGFVTSTDGSRCIDQRAGTCFSGLVNGRCAQELPGRMAKAQC-CCEPGRCWSIGTIPEACPVRGS----EEYRRLCLDGLPMGGIPGSSVSRPGGTGSTGNGYGPGGTGFLPIPGDNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDICK--HHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNP--------------CSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDID----ECIQNGVLCKNGRCVNTD-GSFQCICNAGFELTTDGKNCVDHDECTTT--------NMCLNGMCI-NEDGSFKCVCKPGFILAPNGRYCTD----VDECQTPGI---CMNGHCINNEGSFRCDCPPGLAVGVDG--------------RVCVDTHMRSTCYG----------------------------EIKKGVCVRPFPGAVTKSEC--------CCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICANGICENLRGS-YRCNCNSGYEPDASGRNCI----------DIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDVNECES-------NPCVNGACRNNLGSFHCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFARI---KGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCL 989          

HSP 3 Score: 122.479 bits (306), Expect = 1.357e-26
Identity = 252/1078 (23.38%), Postives = 386/1078 (35.81%), Query Frame = 1
Query:  325 KGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR-------NYCPKGFTQKENRCD---------DIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNG-KSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGT------------SEPLVSRYCSKSEYYSL-------------------CEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNEN------ICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLIN-----YVTTEPT-------TKYCDILVNRLRC--ASGNCVNDRCICGPGYKSSE-----DGKECYKIEKVSSIXXXXXXXXXXXXXXXXDD-----NNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKC--AVNEYRCKGGYCYDIVDGYLCICVGNY--------------------TVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYY-------------DHECVR----------------------------DSNKCP----YCFYG-CFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTCR 3078
             G C NG+C+   G F             G  C    +  C++K D   C   P   +   + CC     AWG  C  C +         CP+G     NR D         DI+EC+ F  +C  G+C N  GSF+C+C     LD    +C    D+C++    CG  G CV T  G + C C + Y   F   K+C+   + + C     LC   G C     S+ C CP G   S  ++ C+     DI +       CR G CV+    Y+C CN  YQ   + Q C                 +    S  CS SE Y+L                   C+GG C ++  +Y C C +GF A+ + + CI +    ++C LN   C  G C+     ++ C C  G+   +    C   +        CE+  H C         P  + C+C EG+  +  +  CI  ++  +      I+      QCV+   SYRC C   +  + +G  C    +            E  +LC+ G+C++    Y C+C  G+    + R C  I++          C  Q     C+ G C  +    F C+C  G+     G +C    +D+C +  N      + TPGR        + C CP    L+  G  C+ N     Y+   P             + V+R  C  + G    + C   P   S+E      G E ++   ++ I        +  G  +  +      +++C+C  GY  SE  R C   +        C  H   C  G CY    N Y C C   Y Q     +C+ M    C  + N   C+    +++    +C C  N                     T+  N       I   K+VDI E              KEI   C  G C+ +   ++C+CP  F  N               D+ C R                            D N+C      C +G C D      C C+  ++   D  +C+   +   +  G+ TC+
Sbjct:  956 PGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEHCFLKWDEDECIH-PVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRG-PGFANRGDILTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNNGFALDMEERNCT-DIDECRISPDLCGS-GICVNTP-GSFECECFEGYESGFMMMKNCM---DIDECERNPLLCR-GGTCVNTEGSFQCDCPLGHELSPSREDCV-----DINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDV----NECDLNPNICMFGECENT-KGSFICHCQLGYSVKKGTTGCTDVDE-------CEIGAHNCDMHASCLNVPGSFKCSCREGWVGNGIK--CIDLDECANGTHQCSINA-----QCVNTPGSYRCACSEGF--TGDGFTCSDVDECA----------ENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDE----------CSFQNI---CVFGTC-NNLPGMFHCICDDGYELDRTGGNC--TDIDECADPINCVNGLCVNTPGR--------YECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDE-------CFAHPGVCGPGTCYNTLGN-YTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTK-RMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDEC-------------KEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCMDVDECERHPCGNGTCK 1942          

HSP 4 Score: 120.553 bits (301), Expect = 5.979e-26
Identity = 230/962 (23.91%), Postives = 357/962 (37.11%), Query Frame = 1
Query:  340 NGKCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQV--AWGNPCVFCDR-----------NYCPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQ-GYNND----QECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGF-IRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC--------VRYKQTEP------PAVRLCSK-----WEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLS------KDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICDLHREK----------CKTG--------ICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY----CFYGCFDENSISTCSCSENY 3000
            N  CIC   Y     G +C     S CY   +   C++      ++K  CC  + V  AW  PC  C             N     F     +  DIDEC +   IC NG CIN+ GSFRC+CP     ++  + C+   D+C    + C     C+  S G Y C C   + +S NG +C+ +   N C     +C  +G C     SY C C +GF  S+D+  C+   + D C+       C  G+C +    Y CLC   ++  +NND     EC  +               +  +C  G C +    + C C+EG+  T + + CI     T++C      C  G CQ L+  ++ C C  G+ +RSEN   CI         +IC L+G    T       P  + C C  G+  S++ + C    Q   +C     + +C   +   N    +C C  K      G  C        V ++   P      P++    +      E   +C  G+C++T+ ++ C+C  GY     G +C   ++     P             C  G C  +    F+C C  GF     G   + E +++C  N  +C   RC  +  S + C CP   +L       KD   C       E     C  L+              CIC PG     DG+ C    +  +   + +              +Y C+C  G+  S +G  C+ +   L    + +++C +              C  G        +C   G   Y   C  G   ATD +     D  +C V    C  G C + +  + C C   YT   +G  C         VD+ E S Q+P+  +F              C   +  YQC CP  +     D +  +D ++C      C + C +     TC C   +
Sbjct: 1707 NYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELP-FNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCE-DIDECSNGDNLCQRNADCI-NSPGSYRCECAAGFKLSPNG-ACVDR---NECLEIPNVC-SHGLCVDLQGSYQCICNNGFKASQDQTMCM---DVDECER----HPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSF---------------FGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCID----TNECVALPGSCSPGTCQNLE-GSFRCICPPGYEVRSEN---CIDINECDEDPNIC-LFGSCTNT-------PGGFQCICPPGFVLSDNGRRCFDTRQ--SFCFTNFENGKCSVPK-AFNTTKAKCCCS-KMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNP-------------CGNGTCT-NVIGSFECTCNEGFEP---GPMMNCEDINECAQNPLLCA-FRCMNTFGS-YECTCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTF----------MCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNII-----GSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYATDGR-----DIDECKVMPSLCTNGQCVNTMGSFRCFCKVGYTTDISGTAC---------VDLDECS-QSPKPCNF-------------ICKNTKGSYQCSCPRGYVLQ-EDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGF 2555          

HSP 5 Score: 119.013 bits (297), Expect = 1.467e-25
Identity = 240/956 (25.10%), Postives = 357/956 (37.34%), Query Frame = 1
Query:  205 YDCGYGRC---VGLNVCECYDKTIRTETCPQNNQKLCTNNCSNK-GQ-CQNGKCICESGYFGEDCNTAIISTCYVK--IDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKC-VPTS--DGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVR-YGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDK--------TYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY----CFYGCFDENSISTCSCSENY 3000
            + CG G C   VG   C CY     T     NN  L  + CS+  GQ C+NG+C  E G F   CN     T   K  ID   C + P +        C   + ++        R  CP G+  +   C DI+EC +  +ICL G C N  G F+C CPP   L +N   C   R   Q +  +    GKC VP +    +  C C K     +     +   +  V   F+ LC       PYG   + + PS     ED   C+        +SP I   C  G C++    +RC C     GYN D   VR   T E  +   C           G+C ++   + C C+EGF         +  E I ++CA N   C   RC      +YEC C  G+   E+ + C   +        CE  G  C+  +        ++C C  G ++  D + C+   + +           C  G+CV+   SYRC C+  + SS++G EC+  +Q       LC      ++CQ                                        +S  L+ +    C GGR  G +        T  +K +C  G   A+DGR      +D+C    ++CT G+C  +  S FRC C    +    G +C ++      + K C+ +    + +       +C C  GY   EDGK C  +++  +     Q  C            + C+C  G+ +     +CI +     + S+C         GIC       + C C  G+       +C  +D  +C  N +RC+ G C +I+ GY C C   Y        C         VD +E S  NP +            C    C      Y+C CP  F  + +   C  D N+C      C YGC +      C C   Y
Sbjct: 1934 HPCGNGTCKNTVGSYNCLCYPGFELT----HNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGT---CQNLEGSF--------RCICPPGYEVRSENCIDINECDEDPNICLFGSCTNTPGGFQCICPPGFVLSDNGRRCFDTR---QSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEV--AFQDLC-------PYG---HGTVPSLHDTREDVNECL--------ESPGI---CSNGQCINTDGSFRCECP---MGYNLDYTGVRCVDTDECSIGNPCGN---------GTCTNVIGSFECTCNEGFEPGPM----MNCEDI-NECAQNPLLC-AFRCMNT-FGSYECTCPVGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLI------GTFMCICPPGMARRPDGEGCVDENECRTK------PGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQG------LCFAEVLQTMCQ-------------------------------------MASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYATDGRD-----IDECKVMPSLCTNGQCVNTMGS-FRCFCKVGYTTDISGTAC-VDLDECSQSPKPCNFICKNTKGSY------QCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCVNTL------GGFTCKCPPGFTQHHT--ACIDNNECGSQPSLCGAK------GICQNT-PGSFSCECQRGFSLDASGLNCEDVD--ECDGN-HRCQHG-CQNILGGYRCGCPQGYVQHYQWNQC---------VDENECS--NPGA------------CGSASCYNTLGSYKCACPSGFSFDQFSSAC-HDVNECSSSKNPCSYGCSNTEGGYLCGCPPGY 2718          

HSP 6 Score: 105.145 bits (261), Expect = 3.009e-21
Identity = 215/882 (24.38%), Postives = 318/882 (36.05%), Query Frame = 1
Query:  508 PCVFCDRNYCPKGFTQKEN-RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQ------------------GYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNN--DYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGEC-VDTXXXXXXXXXXXXXATENGRKCSRIE------------KQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFR---CVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSED---GKECYK-IEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQA-TDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFDENSIST----CSCSENYENLFD 3015
            P V   R  C  G+ Q  N  C D+DEC   + C NG+C+N  GS+ C+C           +C    D+C   G  C   G+CV T DG + CIC   + ++ +GK+C+        N    +CL  G C     S+ C C  GF  + + + C   ++ D CQ+P I   C  G C++    +RC C                       G      CVR        S  C  +  Y   E        N  +++  CS G   T + R         ++CAL+   C  G C+ L   +Y C C  G+    +GR+CI  +        C +    C  G+C    P  Y C C  GY    + + C           N+  S  C  G C +N  S+ C C      S+ G  C+              K   +   Q   C V+ N                G  C R E            K VT E  N     + +   C  GRC+  K   F C C  G T    GR C    ++ C    +      C       FR   C C   A+   +   C       +P TK  + L  R               GPG+ +  D   G+  YK I +  +   +                +++C+C NG+      R+C   +        C +  + C +GIC       + C C  GY+      K+C+ +D  +C  N   C+GG C +    + C C   + ++ +  DC         VDI+E S  +               C+ GKCV     YQC C   ++    D +   D ++C     GC  + + S     CSCSE Y  + D
Sbjct:  505 PTVSSYRCECNMGYKQDANGDCIDVDECT-SNPCSNGDCVNTPGSYYCKCHAGFQRTPTKQAC-IDIDECIQNGVLC-KNGRCVNT-DGSFQCICNAGFELTTDGKNCVDHDECTTTN----MCL-NGMCINEDGSFKCVCKPGFILAPNGRYC---TDVDECQTPGI---CMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDGRD-------INECALDPDICANGICENL-RGSYRCNCNSGYEPDASGRNCIDIDE-------CLVNRLLCDNGLCRNT-PGSYSCTCPPGYVFRTETETCED--------VNECESNPCVNGACRNNLGSFHCECSPGSKLSSTGLICIDSL-----------KGTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFARIKGVTCEDVNE---CEVFPGVCPNGRCVNSKG-SFHCECPEGLTLDGTGRVCLDIRMEHCFLKWD---EDECIHPVPGKFRMDACCCAVGAAWGTECEEC------PKPGTKEYETLCPR---------------GPGFANRGDILTGRPFYKDINECKAFPGMCTYGKCRNTI-----GSFKCRCNNGFALDMEERNCTDIDE-------CRISPDLCGSGICVNT-PGSFECECFEGYESGFMMMKNCMDID--ECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDC---------VDINECSLSD-------------NLCRNGKCVNMIGTYQCSCNPGYQATP-DRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPD 1270          

HSP 7 Score: 103.219 bits (256), Expect = 1.079e-20
Identity = 206/914 (22.54%), Postives = 328/914 (35.89%), Query Frame = 1
Query:  148 CCSGWIKNVYGDCVK-SECDYD-CGYGRCV---GLNVCECYDKTIRTETCPQNNQKLCTNNCSNKG-QCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFN-GKSCIKKTNYNVCNYFKKLCLPYGE-CQP----YGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGV-----------------CYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTE--------------PPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEP---DNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            C  G+ ++  GDC+   EC  + C  G CV   G   C+C+    RT   P     +  + C   G  C+NG+C+   G F   CN                + T +       + C+   +     C+  D ++   C  GF    N   C D+DECQ   IC+NG CIN +GSFRC CPP   +  +   C     +   YG              G    +C++P+  +    + C    +Y            +GE CQP        ++  C SG   + D +        DI +     + C  G C +    YRC CN  Y+   + + C+     E LV+R         LC+ G C +    Y C C  G+        C  +    S        C  G C+  +  ++ C+C  G   S  G  CI + +    T    +  +RC+  +                   P    E   AC  G+++       IK    +D  + +     C  G+CV++  S+ C C         G+ C+  +                 P   R+ +         G EC +                  G   +     +T  P   D + C  + +   C  G+C  +    FKC C  GF    + R+C    +D+C  + ++C  G C  +  S F C C       + G   + N +  +   +      N L C  G CVN     +C C  G++ S   ++C  I + S   +L +               Y+C C  GY  + + + C   +  +I    CD               +  Y C+C  GY    D +SC  +D  +C  N   C GG C +I   Y C+C   +  + + + CI
Sbjct:  514 CNMGYKQDANGDCIDVDECTSNPCSNGDCVNTPGSYYCKCHAGFQRT---PTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGF-------------ELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCVCKPGFILAPNGRYCTDVDECQTPGICMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGE----------IKKG----VCVRPFPGAVTKSECCCANPDYG-----------FGEPCQPCPAKNSAEFHGLCSSGIGITVDGR--------DINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDI--DECLVNRL--------LCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDVNECESN------PCVNGACRN-NLGSFHCECSPGSKLSSTGLICIDSLK---GTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFAR-------IKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEHCFLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEEC---PKPGTKEYETLCPRGPGFANRGDILTGRPFYKDINEC--KAFPGMCTYGKCR-NTIGSFKCRCNNGFALDMEERNC--TDIDECRISPDLCGSGICVNTPGS-FECEC---FEGYESGFMMMKNCMDIDECER------NPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMI-----GTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTN---------SEGSYECSCSEGYALMPDGRSCADID--ECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCI 1317          

HSP 8 Score: 102.064 bits (253), Expect = 2.234e-20
Identity = 234/1043 (22.44%), Postives = 372/1043 (35.67%), Query Frame = 1
Query:  328 GQCQNG----KCICESGYF--GEDCNTAIISTCYVKID---RGLCKSTPENLQ-----------------LSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENR--CDDIDECQFK-SICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIK----KTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLV--------------SRYCSKSEYYSLCEGGSCVDLN-------------------NDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVR------YKQTEPPA--------------------VRLCSKW-------------EYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLI----------------NYVTTEPTTKYCDILVNRLR--------CASGNCVNDRCICG--PGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYG-------CFDENSISTCSCSENYENLFDTGLCI 3030
            G+C+N     KC C +G+    E+ N   I  C +  D    G+C +TP + +                 +  +EC     +  G  CV  + ++   CP G     +R  C DI+EC    ++C NG+C+N  G+++C C P +    +   C    D+C +    C    +C   S+G Y C C + Y++  +G+SC      + N ++C+         G+C      Y C C  GF  S D K+CI  +  D+  +P I   C  G C +    + C C   Y        C      E                 S  CS  E + +  G  C+DL+                     Y C CSEGF  T +   C  ++    +CA N   C+ G+C  +    Y C+C  GF  + + RSC   +           + + C  G C  + P  + C C +GY        C   ++  D          C  G CV+    Y C C   +  +  G  CV       Y +  P                        L   W             EYY+LC GGE                     G + + I   + E+ D      QE    C GG CI   T+G F+C C  G+  + + R C  E +D+C  +  +C PG C  +   N+ C+CP        GH+C+                 N +    T + C    N  +        C +    + + ICG  PG+       +   I++   I  +                ++ C+C  G+  ++    C   +      ++C  + +   +          Y C C  G+K + +      +D  +C      C  G C D+   Y CIC   +  +++   C+         D+ E           C R      C  G C      Y C C   F+  + +++C+ D ++C   F+G       CF+E     C C+E YE   D   CI
Sbjct: 1080 GKCRNTIGSFKCRCNNGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCT-DIDECMIMNGGCDT--QCT-NSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDG--------GQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDL--NPNI---CMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGW-VGNGIKCIDLDECANGTHQCSINAQCVNTPGSYRCACSEGF--TGDGFTCSDVD----ECAENTNLCENGQCLNVPGA-YRCECEMGFTPASDSRSCQDIDECS--------FQNICVFGTCNNL-PGMFHCICDDGYELDRTGGNCTDIDECAD-------PINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGE---------------------GFRPNPI-TIILEDIDE----CQELPGLCQGGNCI--NTFGSFQCECPQGYYLSEETRIC--EDIDECFAHPGVCGPGTCYNT-LGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQI-----GSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINS-------PGSYRCECAAGFKLSPNGA---CVDRNECLEIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCM---------DVDE-----------CER----HPCGNGTCKNTVGSYNCLCYPGFELTH-NNDCL-DIDECSS-FFGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCI 2008          

HSP 9 Score: 94.3597 bits (233), Expect = 5.579e-18
Identity = 176/760 (23.16%), Postives = 273/760 (35.92%), Query Frame = 1
Query:  307 TNNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKI---DRGLCKSTPENLQLSKE----------ECCSIFQVAWGNPCVFCDRNYCPKGF----------TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-QYRRDQCQL-YG--------------------SSCGIFGK--------CVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENR-------RRCIKIETITSQCALNQFQCQGGRCQELDN-----------------NNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENG-----RKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEK 2313
            T+ CS   QC N     +C C  G+ G+    + +  C       + G C + P   +   E           C  I + ++ N CVF   N  P  F           +    C DIDEC     C+NG C+N  G + C CPPD  L+   + C   R   C L +G                    S C   GK        C P +  +Y  +C        N  + I + + + C     LC   G C     S+ C CP G++ SE+ + C      DI +       C  G+C +    Y C+C  EY   N    C+       +   +C +S   + CE     ++     C C+       N+             +TI        F    G+  ++D                   ++ C+C  GF  ++    C   +   N  ++C+       +       P  Y C C  G+  S +     +NE         EI   C  G CV    SY+C+C+  + +S +   C+   + E               C  G C +T  +Y C C  G+  T N       +CS    QV                 C  GRC  ++   FKCLC  G+    DG++C     ++C+     C+PG C+    S FRC+CP    +  +  +C+ IN    +P             C  G+C N     +CIC PG+  S++G+ C+   +
Sbjct: 1409 THQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENTNLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEVGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILE-DIDECQELPGLCQ-GGNCINTFGSFQCECPQGYYLSEETRIC-----EDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMD------MRKSFCYRSYNGTTCENELPFNVTKRMCC-CTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINS-------PGSYRCECAAGFKLSPNGACVDRNECL-------EIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCMDVDECE------------RHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQV-----------------CRNGRCF-NEIGSFKCLCNEGYELTPDGKNCID--TNECVALPGSCSPGTCQNLEGS-FRCICPPGYEVRSE--NCIDINECDEDPNI-----------CLFGSCTNTPGGFQCICPPGFVLSDNGRRCFDTRQ 2094          
BLAST of Fibrillin-2 vs. UniProt/SwissProt
Match: sp|P35555|FBN1_HUMAN (Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4)

HSP 1 Score: 150.214 bits (378), Expect = 4.719e-35
Identity = 231/950 (24.32%), Postives = 375/950 (39.47%), Query Frame = 1
Query:  382 CNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-YCPKGFTQ-KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC----------QYRRDQCQL--------------YGSSCGIFG--KCVPTSDGQYTCICIKPYSVSF----NGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQ-SPEIAERCRGGSCVSEGKGYRCLCNGEYQ-GYNNDQECVRYG--TSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVT-ENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTR------------KEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCP---YCFYG-CFDENSISTCSCSENYENLFDTGLCIIKSDEISY 3054
            C   I  TC+  +  G C+       L K +CCS    AWG+PC  C  +  C KG+++ K  +C+DIDEC+ F  +C NG C+N +GSF+CQCP    LD     C          +Y  ++C L               G++ G     +C   +  +Y  +C +    +     NGK   K  + N C     LC  +G+C+    S+ C C SGF    ++++C   ++ D C+ SP++  R   G CV+    + C C+  Y+ G+   + C+       +PL            LC GG C +    Y C+C  G   + N   CI I    ++C L+   C  GRC  L    Y+C C  G+  + +   C+  +        CE +    +           Y C+C  G++   D++ C   ++ +D   N  I   C GGQC +    YRC+C+  +++S + + CV   + +             ++C  G C +T  ++ C C  GY   +    C+ I +              E  +   G   +   T G FKC C PG+    DG  C    +D+C N  ++C+     ++   ++RC+C      + DG +C          T   +   N   C +G C+N     RC C  G+  S DGK C  I++ S         C            + C+C  GY    +G +C      L   +        C +G C       YIC C   ++    +  C+   +  C + + R +G          + + V   +     G+          +V+ SE     P  + F               +E+   CQ GKC+     +QC+CP  +  N  D     D N+C     C  G C++     TC C  +Y  +     C+     + Y
Sbjct:  845 CIETIKGTCWQTVIDGRCEININGATL-KSQCCSSLGAAWGSPCTLCQVDPICGKGYSRIKGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLDATGRICLDIRLETCFLRYEDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPMRNTPEYEELCPRGPGFATKEITNGKPFFK--DINECKMIPSLCT-HGKCRNTIGSFKCRCDSGFALDSEERNC---TDIDECRISPDLCGR---GQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPL------------LCRGGVCHNTEGSYRCECPPGHQLSPNISACIDI----NECELSAHLCPNGRCVNLIGK-YQCACNPGYHSTPDRLFCVDIDECSIMNGGCETFCTNSE---------GSYECSCQPGFALMPDQRSCTDIDECED---NPNI---CDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNP----------NICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINEC-------------EIGAHNCGKHAVCTNTAGSFKCSCSPGWIG--DGIKCTD--LDECSNGTHMCSQHADCKNTMGSYRCLC--KEGYTGDGFTC----------TDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGL------FRCECEIGYELDRSGGNCTDVNECLDPTT--------CISGNCVNT-PGSYICDCPPDFELNPTRVGCVDTRSGNCYL-DIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLN-EDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCY 1696          

HSP 2 Score: 117.087 bits (292), Expect = 5.485e-25
Identity = 225/934 (24.09%), Postives = 344/934 (36.83%), Query Frame = 1
Query:  574 DIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCN-GEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNN---------------------------------------NYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCI--KNEQYK--------------------DYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNN------------------------GQECVRYKQTEPPAVRLC---SKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSR-----------IEKQV-----------------TEEPDNSYCL----LQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNN--ENICTPGRCERSGNSNFRC-------------VCPY-----YASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKG-GYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            DIDEC +   +C NG CIN  GSFRC+CP   + ++  + C+   D+CQ  G  C    +C+ T+ G Y C C   Y  +  G+      + N C     +C  +G+C     S+YC C +GF  ++D+  C+     DI +    A  C  G+C +    + C CN G    +NND  C+               S   +LC  G C++    + CQC+EG+    + R C+ I    ++C L   +C  G CQ LD +                                       +++C C  GF  S +GR C   +  R S    +  G +C +         E  CA L+G    +  + C    +E ++                    D C+  ++   C+ GQC++   SYRC C   YI + N                        G EC   +  EP  +  C   ++     L     CV+T  +Y CKC  GY   E+ R C              EKQ+                    PD   C+     Q     C  GRC+  +   + C C  GFT++ +   C       C     +N+C  G   R+  +   C             +CP+     +  L   G   + N    +      D+      C +G CVNDR    CIC  GY     G  C  + + +         C+        + +Y+C C  GYI  E+GRSC   +    K+  C      C   I        + C C  G+ Q     SCI  DN +C  +   C   G C +    + C C   +++ + G  C       + VD  E ++                +CQ G C      Y+C CP  +  +Y  ++CV D N+C
Sbjct: 1766 DIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCE-DIDECQ-NGPVCQRNAECINTA-GSYRCDCKPGYRFTSTGQC----NDRNECQEIPNIC-SHGQCIDTVGSFYCLCHTGFKTNDDQTMCL-----DINECERDA--CGNGTCRNTIGSFNCRCNHGFILSHNND--CIDVDEC---------ASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDI----NECLLEPRKCAPGTCQNLDGSYRCICPPGYSLQNEKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSSGRRC---QDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCA-LKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDV---CKHGQCINTDGSYRCECPFGYILAGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCVDENECQTKPGICENGRCLNTRG-SYTCECNDGFTASPNQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNGADIDECKVIHDV------CRNGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQAPKPCNFICKNT------EGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQF---LCVNTI------GGFTCKCPPGFTQ--HHTSCI--DNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQTGSSC-------EDVDECEGNH----------------RCQHG-CQNIIGGYRCSCPQGYLQHYQWNQCV-DENEC 2611          

HSP 3 Score: 114.005 bits (284), Expect = 5.442e-24
Identity = 221/949 (23.29%), Postives = 350/949 (36.88%), Query Frame = 1
Query:  325 KGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVC--NYFKKLCL-------------------PYGE-CQP----YGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALN--------QFQCQGGRCQELDNNNYEC-QCLRG--FIRSENGRSCIKAE----RTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC---------VRYKQTE---PPAVRL------CSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQE------YLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSC--------DPEY---------------------------------VDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKC 2826
            K  C  G+CI   G +   C     ST    + R  C+   E LQ  +        +     C+  D ++   C  GF  T+    C+D+DEC  +++CLNG CINE GSF+C C P   L  +   C+   ++C+  G    + G+CV T DG Y C C    +V  +G+ C+     + C   Y +  C+                    +GE CQP        Y   C SG          + ++ SDI +     + C  G C +    Y+C+CN  Y+  +  + CV    +E +++          LC+ G C +    + C C +GF    + + C  I+   S   +N         F C+      LD     C + ++G  +    +GR  I       +++  +S+   +G  C      PI        C +GYS+       IK  Q +D  + +     C+ G CV+   S++C C         G+ C         +RY+  E   P A R       CS    +   +  EC                  E    C R     T+E  N     ++        S C  G+C  +    FKC C  GF   S+ R+C         P+                                  +D+C  +  +C  G C  +  S +RC CP    LS +  +C+            C++  +   C +G CVN     +C C PGY S+ D   C  I++ S +    +  C         + +YEC C  G+    + RSC   +      +ICD        G C  I   +Y C C  G+  + D K+C+  D  +C +N   C  G C +    ++C C   Y+  +    C         ++  E+   N    + CT      KC
Sbjct:  496 KNPCAGGECINNQGSYTCQCRAGYQST----LTRTECRDIDECLQNGR--------ICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCK-DINECETPGIC--MNGRCVNT-DGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPG--------MTSAGSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDI--NECVLNSL--------LCDNGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESSPCINGVCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPI--------CGKGYSR-------IKGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLDATGRICLDIRLETCFLRYEDEECTLPIAGRHRMDACCCSVGAAWGTEECEEC------------PMRNTPEYEELCPRGPGFATKEITNGKPFFKDINECKMIPSLCTHGKCR-NTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGS-YRCECPPGHQLSPNISACI--------DINECELSAH--LCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCETFCTNS------EGSYECSCQPGFALMPDQRSCTDIDECEDNPNICD-------GGQCTNI-PGEYRCLCYDGFMASEDMKTCV--DVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCT-------DINECEIGAHNCGKHAVCTNTAGSFKC 1348          

HSP 4 Score: 110.153 bits (274), Expect = 8.031e-23
Identity = 159/624 (25.48%), Postives = 242/624 (38.78%), Query Frame = 1
Query:  346 KCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQ-VAWGNPCVFCD-------RNYCPKG---FTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRY---KQTEPPAVRLCSKWE--YYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENIC-TPGRCERSGNSNFRCVCPYYASLSKDGHSC 2154
            KC+C  G+     G  C    +S CY K + G C S+P++   SK+ECC   +   WG+PC  C        R  CP G       ++   D+DEC+   +C +G+CIN  GS+RC+CP  + L  N        D+C + G+ CG  G C     G + C C +     F     +   + N C     LC  +     YG SY C CP G+   ED++ C    + D C+  +     +   C +    Y C+C   YQ   + + CV     +              +CE G C++    Y C+C++GF A+ N+  C+          + Q  CQ G          EC C       + GR                 +G  C+          + +C    G+         + N    D C  + I   CR G+CV++  SY C+C   Y     G  CV      Q   P   +C   E  Y   C  G  +                 E+GR C  +++  T++ +  +  +              +   GF C C PGFT      SC     ++C ++ N+C + G C+ +  S F C C    SL + G SC
Sbjct: 2037 KCLCPEGFSLSSSGRRCQDLRMSYCYAKFEGGKC-SSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILAGNEC---VDTDECSV-GNPCG-NGTCKNVIGG-FECTCEE----GFEPGPMMTCEDINECAQNPLLCA-FRCVNTYG-SYECKCPVGYVLREDRRMC---KDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCVDENECQ----------TKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCC-------DGGRG----------------WGPHCEICPFQGTVAFKKLCPHGRGF---------MTNGADIDEC--KVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQ----------------EDGRSCKDLDECATKQHNCQFLCV--------------NTIGGFTCKCPPGFTQHH--TSCIDN--NECTSDINLCGSKGICQNTPGS-FTCECQRGFSLDQTGSSC 2565          

HSP 5 Score: 106.301 bits (264), Expect = 1.194e-21
Identity = 126/478 (26.36%), Postives = 194/478 (40.59%), Query Frame = 1
Query:  328 GQCQNG----KCICESGYF--GEDCNTAIISTCYVKID---RGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSI-CLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAV 1731
            G+C+N     KC C+SG+    E+ N   I  C +  D   RG C +TP + +                    CD  Y   GF   +N C DIDECQ   + C  G C N +GS+RC+CPP H L  N  +C    ++C+L    C   G+CV    G+Y C C   Y  + +   C+   + + C+     C  +  C     SY CSC  GF    D++SC     +DI +  +    C GG C +    YRCLC   +    + + CV     +             ++C  G+C +    + C C  G+   + +  C  I    ++C +    C           +++C C  G+I   +G  C   +   N T +C  +   C+  +        Y C C EGY+   D   C       D  +  E    C  GQC++    YRC C   ++ S +G+ C    +   P +
Sbjct: 1042 GKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECK------------------CDEGY-ESGFMMMKN-CMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISAC-IDINECELSAHLC-PNGRCV-NLIGKYQCACNPGYHSTPDRLFCV---DIDECSIMNGGCETF--CTNSEGSYECSCQPGFALMPDQRSC-----TDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECD----------LNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDI----NECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIG--DGIKCTDLDECSNGTHMCSQHAD-CKNTM------GSYRCLCKEGYTG--DGFTCT------DLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNI 1455          

HSP 6 Score: 101.679 bits (252), Expect = 2.730e-20
Identity = 181/787 (23.00%), Postives = 297/787 (37.74%), Query Frame = 1
Query:  535 CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQ-YRRDQC--QLYGSSCGIFGKCVPTSDGQYTCI--------------CIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPY-GL-----------SYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGR------------------------CIGDKTYGFKCLCL--PGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CP G+   E+   CDD++EC+   IC  G C N  G++ C CPPD+       +C   RR  C    Y  +    G+ +     +  C               C  P +  F    C  +    V + +  L +   EC+   G+           S+ C CP GF  ++     +V  + D CQ+  + +  R   C++    YRC C   Y+ + +  +C      +          E  ++C  G C+D    +YC C  GF   +++  C+ I    ++C  +   C  G C+     ++ C+C  GFI S N   CI  +   +        G+ C+ G C       + C C EGY  + D + C+      D  +     ++C  G C +   SYRC+C   Y   N   E +     EP             +C  G C +T  ++ C C  G+  + +GR+C  +          SYC  +    +C   +                        C  +    F+ +C    G     D  + D   +D+C    ++C  G+C  +  S +RC CP+   L+  G+ C+         T  C +      C +G C N   + G    + E+G E   +     I    Q              +YEC+C  GY+  E+ R C   +     K  C   + +CK  I        Y+C C  GY++  D + C+  D  +C      C+ G C +    Y C C   +T + N  +C+
Sbjct: 1633 CPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEF-ATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKL---LVCEDIDECQNGPVCQ--RNAECINTAGSYRCDCKPGYR-FTSTGQCNDRNECQ----------EIPNICSHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDI----NECERD--ACGNGTCRNTI-GSFNCRCNHGFILSHN-NDCIDVDECASGN------GNLCRNGQCINTV-GSFQCQCNEGYEVAPDGRTCV------DINECLLEPRKCAPGTCQNLDGSYRCICPPGYSLQNEKCEDIDECVEEP------------EICALGTCSNTEGSFKCLCPEGFSLSSSGRRCQDLRM--------SYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVD---MDEC-KEPDVCKHGQCINTDGS-YRCECPFGYILA--GNECV--------DTDECSV---GNPCGNGTCKN---VIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLI------GTYMCICGPGYQRRPDGEGCV--DENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECL 2332          

HSP 7 Score: 93.2041 bits (230), Expect = 1.049e-17
Identity = 76/267 (28.46%), Postives = 107/267 (40.07%), Query Frame = 1
Query:  148 CCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCI 831
            CC GW     G+ C+   C + CG G C   N+C C    I   +C   + + C   C N G C +  C+C+ GY G  C   +                                    C+  I   +C+     +  +K  CC+    AWG+PC  C    + C +GF    +   C D+DECQ    +C  G CIN  GSF C+CP  H L+E +  C+   D+C      C   G+C  T    Y C C   +  S +G  CI
Sbjct:   67 CCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQI-APSCGSRSIQHCNIRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERDYRTGPCFTVISNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKLNEVSQKCE-DIDECSTIPGIC-EGGECTNTVS-SYFCKCPPGFYTSPDGTRCI 329          

HSP 8 Score: 92.4337 bits (228), Expect = 2.098e-17
Identity = 227/1023 (22.19%), Postives = 373/1023 (36.46%), Query Frame = 1
Query:  307 TNNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKID---RGLCKSTPENLQ----------LSKEECCSIFQVAWGNPCVFCDRNYCPKGF----------TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-QYRRDQCQL----------------------YGSSCGIFGK--------CVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRY-----CSKSEYYSLCEGGSCVDLN-----NDYYCQC---SEGFYAT--ENRRRCIKIETITS------QCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGY-----SQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIE-----------KVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQ-----NDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFD-----ENSIST--CSCSENYENLFDTGLCIIKSD 3042
            T+ CS    C+N     +C+C+ GY G+      +  C   ++    G C + P   +             + C  I + +  N CVF   +  P  F           +    C D++EC   + C++G C+N  GS+ C CPPD  L+   + C   R   C L                        S C   GK        C   +  +Y  +C        N  + I + + + C     LC   G+C     S+ C CP+G++ +ED + C    + + C++P I   C  G+C +    Y C+C  +Y   N    C+    S    + Y     C     +++ +   C   N     N    QC   S   +AT   ++R    I+  T       +C      C+ G C  +   ++ C+C  GF  ++    C   +  +N        G  CQ           Y C C  GY      Q  DR  C            QEI   C  GQC+    S+ C+CH  + ++++   C+   + E  A            C  G C +T  ++ C+C +G+  + N   C  +++  +   +            C  G+CI +    F+C C  G+  A DGR+C    +++CL     C PG C+    S +RC+CP   SL  +     I+    EP             CA G C N     +C+C  G+  S  G+ C  +            K SS  S N  + +     + +     C+           + C      ++      +  ++CK       GQ       Y C C  GY  A ++     +D  +C+V    C  G C +++ G+ C C   +               +   DI+E + QNP   +F             +CV     Y+CKCP  +     D    +D ++C    + C +     +N I T  C C   Y+   D   C+ +++
Sbjct: 1371 THMCSQHADCKNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILE-DIDECQELPGLCQ-GGKCINTFGSFQCRCPTGYYLNEDTRVC---DDVNECETPGI---CGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINM-VGSFRCECPVGFFYNDKLLVCEDIDECQN--------GPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNEC------------QEIPNICSHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERDA------------CGNGTCRNTIGSFNCRCNHGFILSHN-NDCIDVDECASGNGN-----------LCRNGQCI-NTVGSFQCQCNEGYEVAPDGRTC--VDINECLLEPRKCAPGTCQNLDGS-YRCICPPGYSLQNEKCE-DIDECVEEPEI-----------CALGTCSNTEGSFKCLCPEGFSLSSSGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILAGNE----CVDTDECSVGN-PCGNGTCKNVIGGFECTCEEGFEPGP----------MMTCEDINECA-QNPLLCAF-------------RCVNTYGSYECKCPVGYVLR-EDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCVDENE 2294          

HSP 9 Score: 86.2705 bits (212), Expect = 1.458e-15
Identity = 189/846 (22.34%), Postives = 308/846 (36.41%), Query Frame = 1
Query:  526 RNYCPKGFTQKENR--CDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAE----------RTRNSTSIC------------------ELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAV-------------RLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLC---LPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGK-----ECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICY-PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAV-NEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            R  C  GF   E+   C D++EC    +ICL+G C N KGSF C C   +   +    C    ++C++   +CG    C  T+ G + C C    S  + G   IK T+ + C+    +C  + +C+    SY C C  G+  + D  +C     +D+ +  E    C  G C++   GYRC C+  +    + + C               +    ++C  G+C +L   + C+C  G+    +   C  +        L+   C  G C     + Y C C   F  +     C+             R  N  + C                  + +G  C+  +C  +  +EY   C  G     +    I     +D  + QE+   C+GG+C++   S++C C   Y  + + + C    + E P +                   +Y  +  G  C+D   +   +       T +G     + K++      SY + + +   C   +C    T  F  LC    PGF    D  +  P  +D+C     +C  G C     S FRC CP     +     C  I+     P  +            +  C+N     RC C PGY+ +  G+     EC +I  + S                    ++ C C  G+  +++   C+          I +  R+ C  G C   IG   + C C  G+   +    CI +D  +CA  N   C+ G C + V  + C C   Y V  +GR C         VDI+E   +               KC PG C      Y+C CP  +
Sbjct: 1262 RCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCT-DINECEIGAHNCGKHAVCTNTA-GSFKCSC----SPGWIGDG-IKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGY--TGDGFTC-----TDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDI-----------DECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNE-----CLDPTTCISGNCVNTPGS-YICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCE--MCPAVNTSEYKILCPGGEGFRPNPITVI----LEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMC---CCSYNIGRAWNKPCE--QCPIPSTDEFATLCGSQRPGF--VIDIYTGLPVDIDECREIPGVCENGVCINMVGS-FRCECPVGFFYNDKLLVCEDIDECQNGPVCQR-----------NAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTV-----------GSFYCLCHTGFKTNDDQTMCL---------DINECERDACGNGTCRNTIGS--FNCRCNHGFI-LSHNNDCIDVD--ECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTC---------VDINECLLE-------------PRKCAPGTCQNLDGSYRCICPPGY 2004          

HSP 10 Score: 82.0333 bits (201), Expect = 3.291e-14
Identity = 165/697 (23.67%), Postives = 246/697 (35.29%), Query Frame = 1
Query:  925 CPSGFHQSEDKKSCIVNSNSDICQSPE----IAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSEN---GRSCIKAERTRNSTSICEL-------------------------YGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSIC------DLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            CP+  H    ++  I N  +  CQ  +    I   C+GG+C++    + C C   ++     Q+C                S    +CEGG C +  + Y+C+C  GFY + +  RCI +       AL   +C     Q +     +C C  G   S              T +   +C +                          G      +  P  P EY+      Y   E  +    N    DYC  Q +   C+ G+C+    SYRC C+  +     G EC+   + E             + C GGEC++   +Y C+C  GY +T    +C  I++          CL    +  C  GRCI +    F C+C  GF    DG++C  E +D+C +  N+C  G C     S F+C+C     L+ DG  C  IN   T               C +G CVN     RC C PG     DG+ C                          D +    C  GY + +    CIK     + KS C          E C+        +   +C+   G   A         D  +CA++   C  G C ++   Y CIC   Y V   G++C         VDI+E           C    ++  C  G+C      + C CP  F
Sbjct:  224 CPAQPHPC--RRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKLNEVSQKCEDIDEC----------STIPGICEGGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALTNGRCSNQLPQSI--TKMQCCCDAGRCWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRPEYPPPPLGPIPPVLPVPPGFPPGPQIPVPRPPVEYL------YPSREPPRVLPVN--VTDYC--QLVRYLCQNGRCIPTPGSYRCECNKGFQLDLRG-ECIDVDECE------------KNPCAGGECINNQGSYTCQCRAGYQSTLTRTECRDIDE----------CLQNGRI--CNNGRCI-NTDGSFHCVCNAGFHVTRDGKNC--EDMDEC-SIRNMCLNGMCINEDGS-FKCICKPGFQLASDGRYCKDINECETPGI------------CMNGRCVNTDGSYRCECFPGLAVGLDGRVCV-------------------------DTHMRSTCYGGYKRGQ----CIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGS-------DINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNC---------VDINE-----------CVLNSLL--CDNGQCRNTPGSFVCTCPKGF 796          

HSP 11 Score: 78.1814 bits (191), Expect = 4.625e-13
Identity = 111/433 (25.64%), Postives = 180/433 (41.57%), Query Frame = 1
Query: 1426 NSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECY-KIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDC 2721
            N T  C+L  + CQ G C P  P  Y C C +G+ Q + R  CI      D C+       C GG+C++N  SY C C   Y S+    EC    +            +   +C  G C++T+ +++C C  G++ T +G+ C  +++          C ++   + C+ G CI ++   FKC+C PGF  ASDGR C  + +++C     IC  GRC  +  S +RC C    ++  DG  C+  ++                          R  C  GYK  +  K  +  + K    C+  +             N+ E Q L     S  G +     SA    + C L  + C  GIC  + +  Y C C  GY+  +  K+C+ ++  +C +N   C  G C +    ++C C   +    + + C
Sbjct:  448 NVTDYCQLVRYLCQNGRCIPT-PGSYRCECNKGF-QLDLRGECID----VDECEKNP----CAGGECINNQGSYTCQCRAGYQSTLTRTECRDIDEC----------LQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDE----------CSIR---NMCLNGMCI-NEDGSFKCICKPGFQLASDGRYC--KDINEC-ETPGICMNGRCVNTDGS-YRCECFPGLAVGLDGRVCVDTHM--------------------------RSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQAL---CSSGPGMT-----SAGSDINECALDPDICPNGICENL-RGTYKCICNSGYEVDSTGKNCVDIN--ECVLNSLLCDNGQCRNTPGSFVCTCPKGFIYKPDLKTC 805          

HSP 12 Score: 75.8702 bits (185), Expect = 2.027e-12
Identity = 111/422 (26.30%), Postives = 158/422 (37.44%), Query Frame = 1
Query:  310 NNCSNK-GQCQNGKCICESGYFGEDCNTAIIST-------------CYVKIDRGLCKSTPENLQ-LSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSC-------IKKTN-----------------------------YNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGR 1398
            N C  K G C+NG+C+   G +  +CN    ++             C+ ++ + +C+    N   ++K ECC      WG  C  C        +  CP G     N   DIDEC+    +C NGEC+N++GS+ C C   +  D    SC    ++C      C    K    ++G Y C C K Y +  +G+SC        K+ N                              N C     LC   G CQ    S+ C C  GF   +   SC    + D C   E   RC+ G C +   GYRC C   Y  +    +CV    +E L +          +C G SC +    Y C C  GF   +    C  I    ++C   Q  C  G C   +   Y C C  G+ R   G 
Sbjct: 2293 NECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNG-ADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTSC-VDLNECNQAPKPCNFICK---NTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQHHTSCIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQTGSSC---EDVDEC---EGNHRCQHG-CQNIIGGYRCSCPQGYLQHYQWNQCVD--ENECLSAH---------ICGGASCHNTLGSYKCMCPAGFQYEQFSGGCQDI----NECGSAQAPCSYG-CSNTE-GGYLCGCPPGYFRIGQGH 2685          

HSP 13 Score: 68.1662 bits (165), Expect = 5.230e-10
Identity = 128/563 (22.74%), Postives = 208/563 (36.94%), Query Frame = 1
Query: 1135 VSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVT--EEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLP----------GFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICD------LHREKCKTGICYPIG----------QNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            V+ YC    Y  LC+ G C+     Y C+C++GF   + R  CI ++    +C  N   C GG C   +  +Y CQC  G+  +     C   +        C   G  C  G C       + C C  G+  + D K C    +  D C    I   C  G C++   S++C+C   +  +++G+ C    + E P +           C  G CV+T+ +Y C+C  G     +GR C     + T         C+   + +      C     Y F   C P             S+  G +     +++C  + +IC  G CE      ++C+C     +   G +C+ IN           + ++N L C +G C N      C C  G+    D K C  I++  S            G  +    ++ C+C +          CI++      +++ D      ++    K+  C  +G          Q D IC    GY +    K     D  +C V    CK G C +    + C C    T+   GR C+
Sbjct:  449 VTDYCQLVRY--LCQNGRCIPTPGSYRCECNKGF-QLDLRGECIDVD----ECEKNP--CAGGECIN-NQGSYTCQCRAGYQSTLTRTECRDIDE-------CLQNGRICNNGRCINT-DGSFHCVCNAGFHVTRDGKNC----EDMDECS---IRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGI-----------CMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGSDINECALDPDICPNGICENL-RGTYKCICNSGYEVDSTGKNCVDIN-----------ECVLNSLLCDNGQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDECES-------SPCINGVCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICG--KGYSRI---KGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLDATGRICL 951          
BLAST of Fibrillin-2 vs. UniProt/SwissProt
Match: sp|Q61554|FBN1_MOUSE (Fibrillin-1 OS=Mus musculus OX=10090 GN=Fbn1 PE=1 SV=2)

HSP 1 Score: 145.976 bits (367), Expect = 8.153e-34
Identity = 233/957 (24.35%), Postives = 373/957 (38.98%), Query Frame = 1
Query:  382 CNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-YCPKGFTQ-KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC----------QYRRDQCQL--------------YGSSCGIFG--KCVPTSDGQYTCICIKPYSVSF----NGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQ-SPEIAERCRGGSCVSEGKGYRCLCNGEYQ-GYNNDQECVRYG--TSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVN--------EYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTR------------KEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCP---YCFYG-CFDENSISTCSCSENYENLFDTGLCIIKSDEISY 3054
            C   I  TC+  +  G C+       L K ECCS    AWG+PC  C  +  C KGF++ K  +C+DI+EC+ F  +C NG C+N +GSF+C+CP    LD     C          +Y  ++C L               G++ G     +C   +  +Y  +C +    +     NGK   K  + N C     LC  +G+C+    S+ C C SGF    ++++C   ++ D C+ SP++  R   G CV+    + C C+  Y+ G+   + C+       +PL            LC GG C +    Y C+C  G   + N   CI I    ++C L+   C  GRC  L    Y+C C  G+  + +   C+  +        CE +                Y C+C  G++   D++ C   ++ +D   N  I   C GGQC +    YRC+C+  +++S + + CV   + +             ++C  G C +T  ++ C C  GY   +    C+ I +              E  +   G   +   T G FKC C PG+    DG  C    +D+C N  ++C+     ++   ++RC+C      + DG +C          T   +   N   C +G C+N     RC C  G+  S DGK C  I++ S         C            + C+C  GY    +G +C      L   +        C +G C       Y C C   ++    +  C+   +  C ++        +  C       +     C  +G       G  C L      SV+ SE     P  + F               +E+   CQ GKC+     +QC+CP  +  N  D     D N+C     C  G C++     TC C  +Y  +     C+     + Y
Sbjct:  847 CIETIKGTCWQTVIDGRCEININGATL-KSECCSSLGAAWGSPCTICQLDPICGKGFSRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICLDIRLETCFLKYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPLRNSREYEELCPRGPGFATKDITNGKPFFK--DINECKMIPSLCT-HGKCRNTIGSFKCRCDSGFALDSEERNC---TDIDECRISPDLCGR---GQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPL------------LCRGGICHNTEGSYRCECPPGHQLSPNISACIDI----NECELSANLCPHGRCVNLIGK-YQCACNPGYHPTHDRLFCVDIDECSIMNGGCETFCTNSD---------GSYECSCQPGFALMPDQRSCTDIDECED---NPNI---CDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNP----------NICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINEC-------------EIGAHNCGRHAVCTNTAGSFKCSCSPGWIG--DGIKCTD--LDECSNGTHMCSQHADCKNTMGSYRCLC--KDGYTGDGFTC----------TDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGL------FRCECEIGYELDRSGGNCTDVNECLDPTT--------CISGNCVNT-PGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAW----GTPCEL----CPSVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLN-EDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCY 1698          

HSP 2 Score: 116.701 bits (291), Expect = 9.042e-25
Identity = 225/934 (24.09%), Postives = 344/934 (36.83%), Query Frame = 1
Query:  574 DIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCN-GEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNN---------------------------------------NYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCI--KNEQYK--------------------DYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNN------------------------GQECVRYKQTEPPAVRLC---SKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSR-----------IEKQV-----------------TEEPDNSYCL----LQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNN--ENICTPGRCERSGNSNFRC-------------VCPY-----YASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKG-GYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            DIDEC +   +C NG CIN  GSFRC+CP   + ++  + C+   D+CQ  G  C    +C+ T+ G Y C C   Y ++  G+      + N C     +C  +G+C     S+YC C +GF  + D+  C+     DI +    A  C  G+C +    + C CN G    +NND  C+               +   +LC  G CV+    + C+C+EG+    + R C+ I    ++C L+  +C  G CQ LD +                                       +++C C  GF  S  GR C   +  R S    +  G +C +         E  CA L+G    +  + C    +E ++                    D C+  ++   CR GQC++   SYRC C   YI   N                        G EC   +  EP  +  C   ++     L     CV+T  +Y CKC  GY   E+ R C              EKQ+                    PD   C+     Q     C  GRC+ +    + C C  GFT++     C       C +   +N+C  G   R+  +   C             +CP+     Y  L   G   + N    +      D+      C +G CVNDR    CIC  GY     G  C  + + +         C+        + +Y+C C  GYI  E+GRSC   +    K+  C      C   I        + C C  G+ Q     +CI  DN +C  +   C   G C +    + C C   +++ ++G  C       + VD  E ++                +CQ G C      Y+C CP  +  +Y  ++CV D N+C
Sbjct: 1768 DIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCE-DIDECQ-NGPVCQRNAECINTA-GSYRCDCKPGYRLTSTGQC----NDRNECQEIPNIC-SHGQCIDTVGSFYCLCHTGFKTNVDQTMCL-----DINECERDA--CGNGTCRNTIGSFNCRCNHGFILSHNND--CIDVDEC---------ATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDI----NECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRC---QDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCA-LKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDV---CRHGQCINTDGSYRCECPFGYILEGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPGICENGRCL-NTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFEGTVAYKKLCPHGRGFMTNGADIDECKVIHDV------CRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNT------EGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQF---LCVNTI------GGFTCKCPPGFTQ--HHTACI--DNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASC-------EDVDECEGNH----------------RCQHG-CQNIIGGYRCSCPQGYLQHYQWNQCV-DENEC 2613          

HSP 3 Score: 109.383 bits (272), Expect = 1.452e-22
Identity = 219/950 (23.05%), Postives = 348/950 (36.63%), Query Frame = 1
Query:  325 KGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVC--NYFKKLCL-------------------PYGE-CQP----YGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALN--------QFQCQGGRCQELDNNNYEC-QCLRG--FIRSENGRSCIKAE----RTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ------------TEPPAVRL------CSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQE------YLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENIC-------TPG----RCERSGNSNF-------------------------------RCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKC 2826
            K  C  G+CI   G +   C     ST    + R  C+   E LQ  +        +     C+  D ++   C  GF  T+    C+D+DEC  +++CLNG CINE GSF+C C P   L  +   C+   ++C+  G    + G+CV T DG Y C C    +V  +G+ C+     + C   Y +  C+                    +GE CQP        Y   C SG          + ++ +DI +     + C  G C +    Y+C+CN  Y+     + CV    +E +++          LC+ G C +    + C C +GF    + + C  I+   S   +N         F C+      LD     C + ++G  +    +GR  I       ++   +S+   +G  C      PI        C +G+S+       IK  Q +D  + +     C+ G CV++  S++C C         G+ C+  +             T P A R       CS    +   +  EC                + E    C R     T++  N     ++        S C  G+C  +    FKC C  GF   S+ R+C    +D+C  + ++C       TPG    +C+    S F                               RC CP    LS +  +C+            C++  N   C  G CVN     +C C PGY  + D   C  I++ S +    +  C         D +YEC C  G+    + RSC   +      +ICD        G C  I   +Y C C  G+  + D K+C+  D  +C +N   C  G C +    ++C C   Y+  +    C         ++  E+   N    + CT      KC
Sbjct:  498 KNPCTGGECINNQGSYTCHCRAGYQST----LTRTECRDIDECLQNGR--------ICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCK-DINECETPGIC--MNGRCVNT-DGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPG--------MTSAGTDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNCVDI--NECVLNSL--------LCDNGQCRNTPGSFVCTCPKGFVYKPDLKTCEDIDECESSPCINGVCKNSPGSFICECSPESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQLDPI--------CGKGFSR-------IKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICLDIRLETCFLKYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEEC------------PLRNSREYEELCPRGPGFATKDITNGKPFFKDINECKMIPSLCTHGKCR-NTIGSFKCRCDSGFALDSEERNCTD--IDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGICHNTEGSYRCECPPGHQLSPNISACI--------DINECELSAN--LCPHGRCVNLIGKYQCACNPGYHPTHDRLFCVDIDECSIMNGGCETFCTNS------DGSYECSCQPGFALMPDQRSCTDIDECEDNPNICD-------GGQCTNI-PGEYRCLCYDGFMASEDMKTCV--DVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCT-------DINECEIGAHNCGRHAVCTNTAGSFKC 1350          

HSP 4 Score: 107.457 bits (267), Expect = 5.124e-22
Identity = 125/478 (26.15%), Postives = 195/478 (40.79%), Query Frame = 1
Query:  328 GQCQNG----KCICESGYF--GEDCNTAIISTCYVKID---RGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSI-CLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAV 1731
            G+C+N     KC C+SG+    E+ N   I  C +  D   RG C +TP + +                    CD  Y   GF   +N C DIDECQ   + C  G C N +GS+RC+CPP H L  N  +C    ++C+L  + C   G+CV    G+Y C C   Y  + +   C+   + + C+     C  +  C     SY CSC  GF    D++SC     +DI +  +    C GG C +    YRCLC   +    + + CV     +             ++C  G+C +    + C C  G+   + +  C  I    ++C +    C           +++C C  G+I   +G  C   +   N T +C  +   C+  +        Y C C +GY+   D   C       D  +  E    C  GQC++    YRC C   ++ S +G+ C    +   P +
Sbjct: 1044 GKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECK------------------CDEGY-ESGFMMMKN-CMDIDECQRDPLLCRGGICHNTEGSYRCECPPGHQLSPNISAC-IDINECELSANLC-PHGRCV-NLIGKYQCACNPGYHPTHDRLFCV---DIDECSIMNGGCETF--CTNSDGSYECSCQPGFALMPDQRSC-----TDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECD----------LNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDI----NECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIG--DGIKCTDLDECSNGTHMCSQHAD-CKNTM------GSYRCLCKDGYTG--DGFTCT------DLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNI 1457          

HSP 5 Score: 107.071 bits (266), Expect = 7.692e-22
Identity = 158/624 (25.32%), Postives = 242/624 (38.78%), Query Frame = 1
Query:  346 KCICESGY----FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQ-VAWGNPCVFCD-------RNYCPKG---FTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRY---KQTEPPAVRLCSKWE--YYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENIC-TPGRCERSGNSNFRCVCPYYASLSKDGHSC 2154
            KC+C  G+     G  C    +S CY K + G C S+P++   SK+ECC   +   WG+PC  C        R  CP G       ++   D+DEC+   +C +G+CIN  GS+RC+CP  + L+ N        D+C + G+ CG  G C     G + C C +     F     +   + N C     LC  +     YG SY C CP G+   ED++ C    + D C   +     +   C +    Y C+C   YQ   + + C+     +              +CE G C++    Y C+C++GF A+  +  C+          + Q  CQ G          EC C       + GR                 +G  C+          + +C    G+         + N    D C+   I   CR G+CV++  SY C+C   Y     G  CV      Q   P   +C   E  Y   C  G  +                 E+GR C  +++  T++ +  +  +            IG    GF C C PGFT      +C     ++C ++ N+C + G C+ +  S F C C    SL + G SC
Sbjct: 2039 KCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKC-SSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGYILEGNEC---VDTDECSV-GNPCG-NGTCKNVIGG-FECTCEE----GFEPGPMMTCEDINECAQNPLLCA-FRCVNTYG-SYECKCPVGYVLREDRRMC---KDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENECQ----------TKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCC-------DGGRG----------------WGPHCEICPFEGTVAYKKLCPHGRGF---------MTNGADIDECK--VIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICKNTEGSYQCSCPKGYILQ----------------EDGRSCKDLDECATKQHNCQFLCVNT----------IG----GFTCKCPPGFTQHH--TACIDN--NECTSDINLCGSKGVCQNTPGS-FTCECQRGFSLDQSGASC 2567          

HSP 6 Score: 103.219 bits (256), Expect = 1.172e-20
Identity = 189/773 (24.45%), Postives = 295/773 (38.16%), Query Frame = 1
Query:  535 CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQ-YRRDQC--QLYGSSCGIFGKCVPTSDGQYTCI--------------CIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPY-GL-----------SYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQ----GYNNDQ-ECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK-NEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPP--AVRLCSKWE--YYSLC-QGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQE-YLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            CP G+   E+   CDD++EC+   IC  G C N  G++ C CPPD+       +C   RR  C    Y  +    G+ +     +  C               C  P +  F    C  +    V + +  L +   EC+   G+           S+ C CP GF  ++     +V  + D CQ+  + +  R   C++    YRC C   Y+    G  ND+ EC                 E  ++C  G C+D    +YC C  GF    ++  C+ I    ++C  +   C  G C+     ++ C+C  GFI S N   CI  +            G+ C+ G C       + C C EGY  + D + C+  NE   D         +C  G C +   SYRC+C   Y   N+  E +     EP   A+  CS  E  +  LC +G     T         +  YA   G KCS  + +   + +    L  E +   C       D+ +   C    G     D  + D   +D+C    ++C  G+C  +  S +RC CP+   L  +G+ C+         T  C +      C +G C N   + G    + E+G E   +     I    Q              +YEC+C  GY+  E+ R C   +     K  C   + +CK  I        Y+C C  GY++  D + CI  D  +C      C+ G C + +  Y C C   +T +    +C+
Sbjct: 1635 CPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEF-ATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKL---LVCEDIDECQNGPVCQ--RNAECINTAGSYRCDCKPGYRLTSTGQCNDRNEC----------------QEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDI----NECERD--ACGNGTCRNTI-GSFNCRCNHGFILSHN-NDCIDVDECATGN------GNLCRNGQCVNTV-GSFQCRCNEGYEVAPDGRTCVDINECVLD-------PGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVD---MDEC-KEPDVCRHGQCINTDGS-YRCECPFGYIL--EGNECV--------DTDECSV---GNPCGNGTCKN---VIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMCKDEDECAEGKHDCTEKQMECKNLI------GTYMCICGPGYQRRPDGEGCI--DENECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECL 2334          

HSP 7 Score: 98.5969 bits (244), Expect = 2.678e-19
Identity = 219/927 (23.62%), Postives = 328/927 (35.38%), Query Frame = 1
Query:  454 LQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVC--NYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGG----RCQELDNN--NYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK-NEQYKDYCQNQEI---------------------------------SKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ--TEP----PAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNF---RCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKS---------------ICDLHREKCKTGICYPI---GQNDYICA-------------CVLGYKQATDKKSCIIMDNPKCAVNEYRC--KGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCF 2946
            + +SK  CC     AWG PC  C        +  CP G   + N      +DIDECQ    +C  G+CIN  GSF+C+CP  +YL+E+T  C    ++C+  G  CG  G C  T  G YTCIC   Y     G +C+     ++C  NY+       GE         C C     ++ +K         + C  P   E             +  LC  +  G+      +   T  P+    C   E   +CE G C+++   + C+C  GF+  +    C  I+           +CQ G    R  E  N   +Y C C  G+  +  G+         N  + C+   + C  G C       + C C  G+  + D+  C+  NE  +D C N                                       CR GQCV+   S++C C+  Y  + +G+ CV   +   +P    P         Y  +C  G  +  +                  KC  I++ V EEP+            C  G C  +    FKCLC  GF+ +S GR C    +  C         G+C    + N     C C    +L  +G         TEP   +      R  C  G+ +    I GP   S+ D  EC + +                G     D +Y C+C  GYI    G  C+ ++   +                   C+   E      C  I    QN  +CA             C +GY    D++ C   D  +CA  ++ C  K   C +++  Y+CIC   Y    +G  CI                     ++ C  K  I  C+ G+C+     Y C+C   F  +    EC+   N+  YCF
Sbjct: 1557 VGVSKASCCCSLGKAWGTPCELCPSVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCD-DVNECETPGI-CGP-GTCYNTV-GNYTCICPPDYMQVNGGNNCMD-MRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPC-------EQCPIPSTDE-------------FATLCGSQRPGF-----VIDIYTGLPVDIDECR--EIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDID-----------ECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTGQC--------NDRNECQEIPNICSHGQCIDTV-GSFYCLCHTGFKTNVDQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECATGNGNLCRNGQCVNTVGSFQCRCNEGYEVAPDGRTCVDINECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQND------------------KCEDIDECV-EEPE-----------ICALGTC-SNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFE---GGKCSSPKSRNHSKQECCC----ALKGEGWGDPCELCPTEPDEAF------RQICPFGSGI----IVGPD-DSAVDMDECKEPDVCRH------------GQCINTDGSYRCECPFGYILE--GNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVGYVLREDRRMC--KDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCI--------------------DENECQTKPGI--CENGRCLNTLGSYTCECNDGFTASPTQDECL--DNREGYCF 2342          

HSP 8 Score: 92.8189 bits (229), Expect = 1.615e-17
Identity = 226/1018 (22.20%), Postives = 372/1018 (36.54%), Query Frame = 1
Query:  307 TNNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKID---RGLCKSTPENLQ----------LSKEECCSIFQVAWGNPCVFCDRNYCPKGF----------TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-QYRRDQCQL----------------------YGSSCGIFGK--------CVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRY-----CSKSEYYSLCEGGSCVDLN-----NDYYCQC---SEGFYAT--ENRRRCIKIETITS------QCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIE-----------KVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQ-----NDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFD-----ENSIST--CSCSENYENLFDTGLCIIKSD 3042
            T+ CS    C+N     +C+C+ GY G+      +  C   ++    G C + P   +             + C  I + +  N CVF   +  P  F           +    C D++EC   + C++G C+N  GS+ C CPPD  L+   + C   R   C L                        S C   GK        C   +  +Y  +C        N  + I + + + C     LC   G+C     S+ C CP+G++ +ED + C    + + C++P I   C  G+C +    Y C+C  +Y   N    C+    S    + Y     C     +++ +   C   N     N    QC   S   +AT   ++R    I+  T       +C      C+ G C  +   ++ C+C  GF  ++    C   +  +N        G  CQ           Y C C  GY  +          Q  D  + QEI   C  GQC+    S+ C+CH  + ++ +   C+   + E  A            C  G C +T  ++ C+C +G+  + N   C  +++  T   +            C  G+C+ +    F+C C  G+  A DGR+C    +++C+ +   C PG C+    S +RC+CP   SL  D     I+    EP             CA G C N     +C+C  G+  S  G+ C  +            K SS  S N  + +     + +     C+           + C      ++      +  ++CK       GQ       Y C C  GY    +   C+  D  +C+V    C  G C +++ G+ C C   +               +   DI+E + QNP   +F             +CV     Y+CKCP  +     D    +D ++C    + C +     +N I T  C C   Y+   D   CI +++
Sbjct: 1373 THMCSQHADCKNTMGSYRCLCKDGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCELCPSVNTSEYKILCPGGEGFRPNPITVILE-DIDECQELPGLCQ-GGKCINTFGSFQCRCPTGYYLNEDTRVC---DDVNECETPGI---CGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINM-VGSFRCECPVGFFYNDKLLVCEDIDECQN--------GPVCQRNAECINTAGSYRCDCKPGYRLT-------STGQCNDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINECERDA------------CGNGTCRNTIGSFNCRCNHGFILSHN-NDCIDVDECATGNGN-----------LCRNGQCV-NTVGSFQCRCNEGYEVAPDGRTC--VDINECVLDPGKCAPGTCQNLDGS-YRCICPPGYSLQNDKCE-DIDECVEEPEI-----------CALGTCSNTEGSFKCLCPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPFGSGIIVGPDDSAVDMDECKEPDVCRHGQCINTDGSYRCECPFGY--ILEGNECV--DTDECSVGN-PCGNGTCKNVIGGFECTCEEGFEPGP----------MMTCEDINECA-QNPLLCAF-------------RCVNTYGSYECKCPVGYVLR-EDRRMCKDEDECAEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCIDENE 2296          

HSP 9 Score: 92.4337 bits (228), Expect = 2.012e-17
Identity = 73/267 (27.34%), Postives = 108/267 (40.45%), Query Frame = 1
Query:  148 CCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCI 831
            CC GW     G+ C+   C + CG G C   N+C C    I + +C   + + C+  C N G C +  C+C+ GY G  C   +                                    C+  +   +C+     +  +K  CC+    AWG+PC  C    + C +GF    +   C D+DECQ    +C  G CIN  GSF C+CP  H  +E +  C+   D+C      C   G+C  T    Y C C   +  S +G  C+
Sbjct:   67 CCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQI-SPSCGSRSIQHCSIRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERDYRTGPCFTVVSNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGMCQGGNCINTVGSFECKCPAGHKFNEVSQKCE-DIDECSTIPGVCD-GGECTNTVS-SYFCKCPPGFYTSPDGTRCV 329          

HSP 10 Score: 88.1965 bits (217), Expect = 4.508e-16
Identity = 191/879 (21.73%), Postives = 315/879 (35.84%), Query Frame = 1
Query:  526 RNYCPKGFTQKENR--CDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAE----------RTRNSTSIC------------------ELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAV-------------RLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLC---LPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCP----YYASLS--------KDGHSCLINYVTTEPTTKY-CDILVNRLRCASGNCVNDR-----------------------CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHEC 2913
            R  C  GF   E+   C D++EC    +ICL+G C N KGSF C C   +   +    C    ++C++   +CG    C  T+ G + C C    S  + G   IK T+ + C+    +C  + +C+    SY C C  G+  + D  +C     +D+ +  E    C  G C++   GYRC C+  +    + + C               +    ++C  G+C +L   + C+C  G+    +   C  +        L+   C  G C     + Y C C   F  +     C+             R  N  + C                  + +G  C+  +C  +  +EY   C  G     +    I     +D  + QE+   C+GG+C++   S++C C   Y  + + + C    + E P +                   +Y  +  G  C+D   +   +       T +G     + K++      SY + + +   C   +C    T  F  LC    PGF    D  +  P  +D+C     +C  G C     S FRC CP    Y   L         ++G  C  N         Y CD        ++G C NDR                       C+C  G+K++ D   C  I +       N               ++ C+C +G+I S N       E A    ++C       + G C       + C C  GY+ A D ++C+ ++  +C ++  +C  G C ++   Y CIC   Y++  +           K  DI E               E  E C  G C   +  ++C CP  F  +     C
Sbjct: 1264 RCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCT-DINECEIGAHNCGRHAVCTNTA-GSFKCSC----SPGWIGDG-IKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKDGY--TGDGFTC-----TDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACEDI-----------DECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNE-----CLDPTTCISGNCVNTPGS-YTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCE--LCPSVNTSEYKILCPGGEGFRPNPITVI----LEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCC---CSYNIGRAWNKPCE--QCPIPSTDEFATLCGSQRPGF--VIDIYTGLPVDIDECREIPGVCENGVCINMVGS-FRCECPVGFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTGQC-NDRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNVDQTMCLDINECERDACGNGTCRNTI-------GSFNCRCNHGFILSHNNDCIDVDECATGNGNLC-------RNGQCVNT-VGSFQCRCNEGYEVAPDGRTCVDIN--ECVLDPGKCAPGTCQNLDGSYRCICPPGYSLQND-----------KCEDIDECV-------------EEPEICALGTCSNTEGSFKCLCPEGFSLSSTGRRC 2055          

HSP 11 Score: 78.5666 bits (192), Expect = 3.874e-13
Identity = 109/435 (25.06%), Postives = 178/435 (40.92%), Query Frame = 1
Query: 1426 NSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCAS---GNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDC 2721
            N T  C+L  + CQ G C P  P  Y C C +G+ Q + R  CI      D C+       C GG+C++N  SY C C   Y S+    EC    +            +   +C  G C++T+ +++C C  G++ T +G+ C  +++          C ++   + C+ G CI ++   FKC+C PGF  ASDGR C  + +++C     IC  GRC  +  S +RC C    ++  DG  C+  ++ +     Y      R +C     G      C C     +   G+ C      +S                     Y+  C +G   +          SA    + C L  + C  GIC  + +  Y C C  GY+     K+C+ ++  +C +N   C  G C +    ++C C   +    + + C
Sbjct:  450 NVTDYCQLVRYLCQNGRCIPT-PGSYRCECNKGF-QLDIRGECID----VDECEKNP----CTGGECINNQGSYTCHCRAGYQSTLTRTECRDIDEC----------LQNGRICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDE----------CSIR---NMCLNGMCI-NEDGSFKCICKPGFQLASDGRYC--KDINEC-ETPGICMNGRCVNTDGS-YRCECFPGLAVGLDGRVCVDTHMRSTCYGGY-----RRGQCVKPLFGAVTKSECCCASTEYAF--GEPCQPCPAQNSA-------------------EYQALCSSGPGMT----------SAGTDINECALDPDICPNGICENL-RGTYKCICNSGYEVDITGKNCVDIN--ECVLNSLLCDNGQCRNTPGSFVCTCPKGFVYKPDLKTC 807          

HSP 12 Score: 75.0998 bits (183), Expect = 3.568e-12
Identity = 110/422 (26.07%), Postives = 159/422 (37.68%), Query Frame = 1
Query:  310 NNCSNK-GQCQNGKCICESGYFGEDCNTAIIST-------------CYVKIDRGLCKSTPENLQ-LSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSC-------IKKTN-----------------------------YNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGR 1398
            N C  K G C+NG+C+   G +  +CN    ++             C+ ++ + +C+    N   ++K ECC      WG  C  C        +  CP G     N   DIDEC+    +C NGEC+N++GS+ C C   +  D    +C    ++C      C    K    ++G Y C C K Y +  +G+SC        K+ N                              N C     LC   G CQ    S+ C C  GF   +   SC    + D C   E   RC+ G C +   GYRC C   Y  +    +CV    +E L +          +C G SC +    Y C C  GF   +    C  I    ++C  +Q  C  G C   +   Y C C  G+ R   G 
Sbjct: 2295 NECQTKPGICENGRCLNTLGSYTCECNDGFTASPTQDECLDNREGYCFSEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFEGTVAYKKLCPHGRGFMTNG-ADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTAC-VDLNECNQAPKPCNFICK---NTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASC---EDVDEC---EGNHRCQHG-CQNIIGGYRCSCPQGYLQHYQWNQCVD--ENECLSAH---------VCGGASCHNTLGSYKCMCPTGFQYEQFSGGCQDI----NECGSSQAPCSYG-CSNTE-GGYLCGCPPGYFRIGQGH 2687          

HSP 13 Score: 69.3218 bits (168), Expect = 2.120e-10
Identity = 89/346 (25.72%), Postives = 131/346 (37.86%), Query Frame = 1
Query: 1927 CMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSE-------------------SALIKKSICDLHREKCKTGICYP-IGQN--DYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            C GG CI ++   + C C  G+ S      C    +D+CL N  IC  GRC  +  S F CVC     +++DG +C             C I   R  C +G C+N+    +CIC PG++ + DG+ C  I +  +       +C         D +Y C+C  G     +GR C+ +                     A+ K   C    E      C P   QN  +Y   C  G    +        D  +CA++   C  G C ++   Y CIC   Y V   G++C         VDI+E           C    ++  C  G+C      + C CP  F
Sbjct:  501 CTGGECINNQG-SYTCHCRAGYQSTLTRTEC--RDIDECLQNGRICNNGRCINTDGS-FHCVCNAGFHVTRDGKNC--------EDMDECSI---RNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGICMNGRCVNT------DGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAG-----TDINECALDPDICPNGICENLRGTYKCICNSGYEVDITGKNC---------VDINE-----------CVLNSLL--CDNGQCRNTPGSFVCTCPKGF 798          

HSP 14 Score: 63.1586 bits (152), Expect = 1.503e-8
Identity = 126/563 (22.38%), Postives = 205/563 (36.41%), Query Frame = 1
Query: 1135 VSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVT--EEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLP----------GFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICD------LHREKCKTGICYPIG----------QNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            V+ YC    Y  LC+ G C+     Y C+C++GF   + R  CI ++    +C  N   C GG C   +  +Y C C  G+  +     C   +        C   G  C  G C       + C C  G+  + D K C    +  D C    I   C  G C++   S++C+C   +  +++G+ C    + E P +           C  G CV+T+ +Y C+C  G     +GR C     + T         C+   + +      C     Y F   C P             S+  G +     +++C  + +IC  G CE      ++C+C     +   G +C+ IN           + ++N L C +G C N      C C  G+    D K C  I++  S            G  +    ++ C+C            CI++      +++ D      ++    K+  C  +G          Q D IC      K  +  K     D  +C V    CK G C +    + C C    T+   GR C+
Sbjct:  451 VTDYCQLVRY--LCQNGRCIPTPGSYRCECNKGF-QLDIRGECIDVD----ECEKNP--CTGGECIN-NQGSYTCHCRAGYQSTLTRTECRDIDE-------CLQNGRICNNGRCINT-DGSFHCVCNAGFHVTRDGKNC----EDMDECS---IRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINECETPGI-----------CMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYRRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGTDINECALDPDICPNGICENL-RGTYKCICNSGYEVDITGKNCVDIN-----------ECVLNSLLCDNGQCRNTPGSFVCTCPKGFVYKPDLKTCEDIDECES-------SPCINGVCKNSPGSFICECSPESTLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQLDPICG-----KGFSRIKGTQCEDINECEVFPGVCKNGLCVNSRGSFKCECPNGMTLDATGRICL 953          
BLAST of Fibrillin-2 vs. TrEMBL
Match: A0A4D6FZQ5 (Uncharacterized protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 293/293 (100.00%), Postives = 293/293 (100.00%), Query Frame = 1
Query:  859 YFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRL 1737
            YFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRL
Sbjct:    1 YFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRL 293          

HSP 2 Score: 157.918 bits (398), Expect = 5.710e-39
Identity = 122/293 (41.64%), Postives = 163/293 (55.63%), Query Frame = 1
Query: 1471 GVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENI-------CTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKV 2316
            G C P Y   Y C+C  G+ QSED+K CI N    D CQ+ EI++RCRGG CVS G  YRC+C+G+Y   NN QECVRY  +EP   R CSK EYYSLC+GG CVD NN+YYC+C  G+YATEN R+C +IE   ++      C L ++  +C GGRC       ++C CL GF  + +GRSC     ++  N+ +I       C  G C     + + C C    S S+D   C+ N    E    YC       RC  G CV++    RC+C   Y SS +G+EC + ++ 
Sbjct:   10 GECQP-YGLSYYCSCPSGFHQSEDKKSCIVNSN-SDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQ------CALNQF--QCQGGRCQELDNNNYECQCLRGFIRSENGRSCIK--AERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKN----EQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQT 286          

HSP 3 Score: 142.51 bits (358), Expect = 1.036e-33
Identity = 112/272 (41.18%), Postives = 154/272 (56.62%), Query Frame = 1
Query: 1966 FKCLCLPGFTSASDGRSC----------DPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEP-TTKYCDILVNRLRCASGNCV---NDR-CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPK--CAVNEY--RCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            + C C  GF  + D +SC           PE  ++C         G C   G   +RC+C        +   C + Y T+EP  ++YC        C  G+CV   ND  C C  G+ ++E+ + C KIE ++S C+LNQ QCQGG CQELD+NNYECQCL G+I+SENGRSCIK+E      SIC+L+  +C+TG+CYPI  N+YICAC+ GY Q+ D+K CI  +  K  C   E   RC+GG C    + Y C+C G Y  + NG++C+
Sbjct:   19 YYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRG-------GSCVSEGKG-YRCLCNGEYQGYNNDQEC-VRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECV 281          

HSP 4 Score: 98.9821 bits (245), Expect = 1.043e-18
Identity = 90/305 (29.51%), Postives = 148/305 (48.52%), Query Frame = 1
Query: 2053 ENICTP-GRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEK----VSSIXXXXXXXXXXXXXXXXDDNN-YECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPK-----CAVNEYRCKGGYCYDIV-DGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVR 2919
            + +C P G C+  G S + C CP     S+D  SC++N       +  C       RC  G+CV++    RC+C   Y+   + +EC +       VS  CS ++      G   +D NN Y CQC  G+  +EN R CIK E+     S C L++ +C+ G C  +  N+Y C C+ G+ ++ + +SCI  +  +     C +  +RC+ G CY I  + Y+C C+  Y+ +E+ + CI                +N Q + +C  +EI ++C+ G+CV     Y+C C   + ++    ECVR
Sbjct:    3 KKLCLPYGECQPYGLS-YYCSCPSGFHQSEDKKSCIVN-----SNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETIT---SQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCI----------------KNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVR 282          
BLAST of Fibrillin-2 vs. TrEMBL
Match: G7YU07 (Fibrillin-2 OS=Clonorchis sinensis OX=79923 GN=CLF_110880 PE=4 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 2.186e-58
Identity = 169/576 (29.34%), Postives = 253/576 (43.92%), Query Frame = 1
Query:   34 FRDKLMIFLIFLFYFDTILWNHIVVASICDYSDNGEPLCCSGWIKNVYGDCVKSECDYDCG-YGRCVGLNVCECYDKTIR---TETCPQNNQK-----LCTNNCSNKGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLC--------KSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKK--TNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLN-NDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNG-NSYRCVCHGKYISSNNGQEC 1698
            F       LIF+    T          IC Y    +P+CCSGW  N+   C    C  DCG YG+C+  N C C D+ +R       P++ Q       C ++C+ +G+C +G C C+ G+ GE C   + S C+ K+ RGLC         S     ++S+E CC+ F +AWG PC  C  +YC +G+ QK   C DIDECQ   +C NG+C N +G F C+CP  +  +E ++ C+   D C  +G  C   G+CVP   G + C+C   Y  + + KSCI+K    +++C  + K     G C   G SY C C  GF  S D+KSC      D+C +      C  G CVS G+ + C C+  +    + + C+           +C +    ++C  G CV +   DY CQC  G+  + +R+ C+   T  +                     YE   +  ++  E       A  +    +    Y     TG   P   N +       Y     R +   N      C    I +RC GG C++ G +SY C C   + S + G+ C
Sbjct:    8 FETLFGAVLIFVSLSVTCSLGVDSNRRICAYGK--KPICCSGWYNNISSPCSIPSCAGDCGDYGQCIRPNTCLCADRRLRFSCDADEPESMQHDQPSVTCVDDCNRRGRCVDGTCECDDGFSGEACEEILESACFAKLQRGLCVNPIQYSQHSGNVTTKMSREVCCNSFGIAWGEPCHPCQTSYCGRGYAQKNGSCRDIDECQIPGVCQNGKCSNHEGMFTCKCPDGYTFNEESLQCKPTTDICASHGQQCLPGGRCVPLKSGDFKCVCKWNYRSAGDQKSCIQKKAITFDICAVYSKSICKNGVCVSRGNSYECDCNDGFEPSVDRKSC--RRKIDVC-ALHRGYLCPNGECVSFGRDFYCNCDPGFTPSFDRRRCL----------NHCERMG-PNICPNGRCVAMPYGDYECQCYPGYERSTDRKHCVPEATSVT---------------------YELPPIMPYVNDE------AASPSNFPYAPTARY-----TGGNQPYQWNSWRSHRAPSYPPFPRRSWSRPNGVSNAPCNQPHIVQRCSGGTCLNLGRHSYMCECLPGFDSYDQGRYC 535          

HSP 2 Score: 67.0106 bits (162), Expect = 2.028e-7
Identity = 91/357 (25.49%), Postives = 142/357 (39.78%), Query Frame = 1
Query: 1312 CQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTG-VCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYK-DYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCV---------------------CPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND-----RCICGPGYKSSEDGKEC 2298
            CQ G+C   +   + C+C  G+  +E    C      + +T IC  +G +C  G  C P+   ++ C C   Y  + D+K CI+ +    D C     S  C+ G CVS GNSY C C+  +  S + + C R        + +C+    Y LC  GECV    ++YC C  G+  + + R+C    +++               + C  GRC+      ++C C PG+  ++D + C PE          I      E +  SNF                         P Y    +   S   N V+  P    C+      RC+ G C+N       C C PG+ S + G+ C
Sbjct:  213 CQNGKCSNHEGM-FTCKCPDGYTFNEESLQC------KPTTDICASHGQQCLPGGRCVPLKSGDFKCVCKWNYRSAGDQKSCIQKKAITFDICAVYSKSI-CKNGVCVSRGNSYECDCNDGFEPSVDRKSCRR-------KIDVCALHRGY-LCPNGECVSFGRDFYCNCDPGFTPSFDRRRCLNHCERMGP-------------NICPNGRCVAMPYGDYECQCYPGYERSTDRKHCVPEATSVTYELPPIMPYVNDEAASPSNFPYAPTARYTGGNQPYQWNSWRSHRAPSYPPFPRRSWS-RPNGVSNAP----CNQPHIVQRCSGGTCLNLGRHSYMCECLPGFDSYDQGRYC 535          
BLAST of Fibrillin-2 vs. TrEMBL
Match: A0A3Q0KBG5 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 2.278e-58
Identity = 189/684 (27.63%), Postives = 304/684 (44.44%), Query Frame = 1
Query:   46 LMIFLIFLFYFDTILWNHIVVASICDYSDNGEPLCCSGWIKNVYGDCVKSECDYDCG-YGRCVGLNVCECYDKTIR----TETCPQNNQKL--------CTNNCSNKGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTP---------ENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYR-RDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCI--KKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYY--SLCEGGSCVDLNN-DYYCQCSEGFYATENRRRCI-KIETITSQCALNQFQ--CQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVS-NGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSY---CLLQEYLSRCMGGRCIGDKTYGFKCLCLPGF 1992
            ++++ I ++Y   + +++ + + IC+   NG+P+CC GW   +   C+   C  +CG  G C+  N C C D+ +R     E   + +  +        C +NC+  G C++G CIC++GY G  C T +   CY  + RGLC +           E + L+ E CC+   +AWG PC  C   +C KG+ Q +  C DI+EC+   +C  G+CINE+GS++C CP +   D+ T+ C Y+ +  C+     C   GKC+    G Y CIC      S + KSCI  K+ ++++C  +K      G+C P G +Y C C  GF  SED+K+C      DIC S      C  G C+  G+ + C CN  +    + + C+             SK E    S+C  G C+ L+N DY CQC  G+ +T + ++CI +IE   S     +     +     + +N  YE        + +  +S I  E++ N      L   R  +G     Y         +   +   + +          C   +I KRC GG C++  G+ Y C C   Y++ N G+ CV++K                   +G   V  N+              N +  +   K+    P   Y   C   + L++C  G C+      +KC CLP +
Sbjct:    6 ILLYSIVIYYL-YVDYSYGIRSHICN-KYNGQPVCCPGWRNGIGAPCIIPVCAGNCGERGECIKPNTCICSDRRLRFSCREEDIDEESDTMQLDQAENQCPDNCNEHGTCESGACICQTGYSGRKCETKLTGACYTSLKRGLCVNPMQYRISQYDYEAIPLTHEICCNALGIAWGEPCQICQITHCSKGYEQIDGICKDINECEVDGVCQRGQCINEEGSYKCNCPENTQFDKTTLDCVYKLKMPCESDPYRCHHGGKCIDLPSGDYKCICPWGTRTSQDRKSCIEDKELHFDICQLYKSSVCKNGQCIPRGNTYECVCNEGFEPSEDRKTC--QYKVDIC-SVHRGYLCTNGQCIPAGRDFFCECNPGFTLSYDRRRCM-------------SKCEELGPSICPNGYCIALSNGDYECQCEIGYQSTSDHKKCIMQIEEPNSNIHFAKTVQYYKNKYYGDKENEAYEHSIEMNKPKLQIDQSEIDDEKSYNWWQSDSL--SRKSSGKQQKTYSQYKQLDSSDVTYEKPTQLHLRGTSLRSTPCGQDDIVKRCNGGICLNLGGDGYFCECLPSYLAINGGRACVKHK-------------------EGANNVWQNDESIEDIRKSSRPVNNKQHNNYHLKKDFNSPFYQYQSPCNRNDVLNKCQWGTCLNLGRNSYKCDCLPEY 650          
BLAST of Fibrillin-2 vs. TrEMBL
Match: A0A4E0RGA0 (Fibrillin-2 OS=Fasciola hepatica OX=6192 GN=D915_003571 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 2.475e-58
Identity = 184/596 (30.87%), Postives = 277/596 (46.48%), Query Frame = 1
Query:   49 MIFLIFLFYFDTILWNHIVVASICDYSDN--------GEPLCCSGWIKNVYGDCVKSECDYDCG-YGRCVGLNVCECYDKTIRTE------TCPQNNQKL--CTNNCSNKGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPEN--------LQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTN--YNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSK--SEYYSL--CEGGSCVDLNNDY-YCQ----CSEG--FYAT-----ENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSI-CELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNG-NSYRCVCHGKYISSNNGQECV 1701
            M+  ++L  F  I   H V   +  Y ++        G P+C  GW   +   C    C  +CG  G C+  + C C D   R           Q++Q +  C +NC+  G C+NGKC C+ GY G +C  A+ S+CY K++RGLC+   ++        ++++ EECC+   VAWG+ C  C  +YC +G+   +  C DIDEC+   IC  G+C N +GSF C+CP  +  D++T  C    + C+L    C   GKCV   +G + C+C   Y +S + KSCI K    +++C+ ++      G C P G SY C C  GF  S D+K+CI     DIC +    + C+ G CVS G+ Y C CN  Y    + Q CV+       + +Y  +  SE YS     G S   L  D  Y Q     SEG  F+       EN   C++ E         +  C GG C  L    Y C C   ++  + GR+C +A+ +RN      ++   R ++ V       + + + L     ++ R   I     K  C   EI  +C GG C++ G  +YRC C   +    NG+ C 
Sbjct:    1 MLIRVYLLLFCGI---HSVYCPLPYYPESSNIVGYKKGVPICRFGWRNGIQRPCTIPVCAGNCGERGFCMKPDTCFCADGVQRFSCDEDEWDQVQSDQAITRCVDNCNGHGTCENGKCACDFGYGGINCQVALTSSCYTKLNRGLCERPLQHQTIAGNRTMKMTLEECCNSIGVAWGDLCQQCRTSYCGRGYRLVDGACRDIDECRIPGICQRGQCANTEGSFTCKCPSGYTYDKDTFECNIAVNVCELGRHQCSPGGKCVNLMNGDHRCVCNWRYHLSLDKKSCIPKRTSVFDICSIYRSSICENGICIPRGSSYECICDEGFEPSVDRKTCI--HKIDIC-AVHRGQLCKNGECVSLGREYYCRCNPGYTPSYDRQSCVQ-------IKQYAQQVISEIYSPRSIRGRSSRQLTGDMIYAQPQQDLSEGSRFWPPQKVKKENEPPCLRPEI--------RALCAGGLCLNLGAGAYRCDCRTDYVTVDEGRACKRAKISRNKIPWQNDVNQDRSESDV------EKSVTSVL-----NKPRTGHIYLTDPKSSCGRPEIVSKCLGGFCLNLGRKAYRCECLPGFREIENGKACT 564          

HSP 2 Score: 86.6557 bits (213), Expect = 1.320e-13
Identity = 99/374 (26.47%), Postives = 145/374 (38.77%), Query Frame = 1
Query: 1171 LCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQ-GGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELY-GHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ---------------------------------------------------TEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXAT-ENGRKCSR----------------------IEKQVTE-------------EPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDP 2025
            +C+ G C +    + C+C  G+   ++   C       + C L + QC  GG+C  L N ++ C C   +  S + +SCI  +RT +   IC +Y    C+ G+C P   + Y C C EG+  S DRK CI      D C      + C+ G+CVS G  Y C C+  Y  S + Q CV+ KQ                                                    EPP    C + E  +LC GG C++     Y       Y T + GR C R                      +EK VT              +P +S C   E +S+C+GG C+      ++C CLPGF    +G++C P
Sbjct:  207 ICQRGQCANTEGSFTCKCPSGYTYDKDTFEC---NIAVNVCELGRHQCSPGGKCVNLMNGDHRCVCNWRYHLSLDKKSCI-PKRT-SVFDICSIYRSSICENGICIP-RGSSYECICDEGFEPSVDRKTCIHK---IDICAVHR-GQLCKNGECVSLGREYYCRCNPGYTPSYDRQSCVQIKQYAQQVISEIYSPRSIRGRSSRQLTGDMIYAQPQQDLSEGSRFWPPQKVKKENEPP----CLRPEIRALCAGGLCLNLGAGAYRCDCRTDYVTVDEGRACKRAKISRNKIPWQNDVNQDRSESDVEKSVTSVLNKPRTGHIYLTDPKSS-CGRPEIVSKCLGGFCLNLGRKAYRCECLPGFREIENGKACTP 565          
BLAST of Fibrillin-2 vs. TrEMBL
Match: G4V5Q9 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_001100 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.122e-57
Identity = 171/588 (29.08%), Postives = 277/588 (47.11%), Query Frame = 1
Query:   46 LMIFLIFLFYFDTILWNHIVVASICDYSDNGEPLCCSGWIKNVYGDCVKSECDYDCG-YGRCVGLNVCECYDKTIR----TETCPQNNQKL--------CTNNCSNKGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTP---------ENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYR-RDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCI--KKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYY--SLCEGGSCVDLNN-DYYCQCSEGFYATENRRRCI-KIETITSQCALNQFQ--CQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVS-NGNSYRCVCHGKYISSNNGQECVRYKQ 1713
            ++++ I ++Y   + +++ + + IC+   NG+P+CC GW   +   C+   C  +CG  G C+  N C C D+ +R     E   + +  +        C ++C+  G C++G CIC++GY G  C T +   CY  + RGLC +           E + L+ E CC+   +AWG PC  C   +C KG+ Q +  C DI+EC+   +C  G+CINE+GS++C CP +   D+ T+ C Y+ +  C+     C   GKC+    G Y CIC      S + KSCI  K+ ++++C  +K      G+C P G +Y C C  GF  SED+K+C      DIC S      C  G C+  G+ + C CN  +    + + C+             SK E    S+C  G C+ L+N DY CQC  G+ +T + ++CI +IE   S     +     +     + +N  YE        + +  +S I  E++ N      L   R  +G     Y         +   +   + +          C   +I KRC GG C++  G+ Y C C   Y++ N G+ CV++K+
Sbjct:    6 ILLYSIVIYYL-YVDYSYGIRSHICN-KYNGQPVCCPGWRNGIGAPCIIPVCAGNCGERGECIKPNTCICSDRRLRFSCREEDIDEESDTMQLDQAENQCPDSCNEHGTCESGACICQTGYSGRKCETKLTGACYTSLKRGLCVNPMQYRISQYDYEAIPLTHEICCNALGIAWGEPCQICQITHCSKGYEQIDGICKDINECEVDGVCQRGQCINEEGSYKCNCPENTQFDKTTLDCVYKLKMPCESDPYRCHHGGKCIDLPSGDYKCICPWGTRTSQDRKSCIEDKELHFDICQLYKSSVCKNGQCIPRGNTYECVCNEGFEPSEDRKTC--QYKVDIC-SVHRGYLCTNGQCIPAGRDFFCECNPGFTLSYDRRRCM-------------SKCEELGPSICPNGYCIALSNGDYECQCEIGYQSTSDHKKCIMQIEEPNSNIHFAKTVQYYKNKYYGDKENEAYEHSIEMNKPKLQIDQSEIDDEKSYNWWQSDSL--SRKSSGKQQKTYSQYKQLDSSDVTYEKPTQLHLRGTSLRSTPCGQDDIVKRCNGGICLNLGGDGYFCECLPSYLAINGGRACVKHKE 573          

HSP 2 Score: 68.1662 bits (165), Expect = 1.016e-7
Identity = 71/257 (27.63%), Postives = 116/257 (45.14%), Query Frame = 1
Query: 1003 EIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDL-NNDYYCQCSEGFYATENRRRCIKIETITSQ-CALNQFQ-CQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELY-GHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGN-SYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYY 1758
            E+   C+ G C++E   Y+C C    Q      +CV Y    P       +S+ Y    GG C+DL + DY C C  G   +++R+ CI+ + +    C L +   C+ G+C     N YEC C  GF  SE+ ++C      +    IC ++ G+ C  G C P    ++ C C  G++ S DR+ C+        C+    S  C  G C++  N  Y C C   Y S+++ ++C+   +     +      +YY
Sbjct:  207 EVDGVCQRGQCINEEGSYKCNCPENTQFDKTTLDCV-YKLKMPC------ESDPYRCHHGGKCIDLPSGDYKCICPWGTRTSQDRKSCIEDKELHFDICQLYKSSVCKNGQCIPR-GNTYECVCNEGFEPSEDRKTC------QYKVDICSVHRGYLCTNGQCIPA-GRDFFCECNPGFTLSYDRRRCMSK------CEELGPSI-CPNGYCIALSNGDYECQCEIGYQSTSDHKKCIMQIEEPNSNIHFAKTVQYY 441          
BLAST of Fibrillin-2 vs. Ensembl Cavefish
Match: fbn2b (fibrillin 2b [Source:ZFIN;Acc:ZDB-GENE-090112-3])

HSP 1 Score: 164.851 bits (416), Expect = 1.667e-40
Identity = 235/995 (23.62%), Postives = 356/995 (35.78%), Query Frame = 1
Query:   25 FSFFRDKLMIFLIFLFYFDTILWNHIVVASICDYSDNGEPLCCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIK-------------KTNYNVCNYFKKL--CLPYGECQPYGLSYYCSCPSGFHQSEDKKSC--------------------IVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQ--ECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICD-----------LHREKCKT-GICY--PIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            +SF     + F+    YF         V     +S      CC GW     G+ C+   C   CG G C   N+C C    +     P      C+  C N G C +  C+C+ GY G  C   +                                    C+ +++  +C+     +  +K  CC+    AWG+PC  C    + C +GF    +   C D+DECQ    +C  G CIN  GS+ C+CP  H   E    C+   D+C L G   G  G+C  T+ G Y C C + Y  S +G  CI              +    +   F K+  C   G C   G      CP         K+C                    +++S  D+C+       C  G C+     YRC CN    GY  D   EC+     +  +S  C           G CV+    Y+C+C EG+  T  ++ CI I+    +C +N   C+ GRC   D  +++C C  GF  S +G++CI  +    +        + C  G+C       + C C +G++ + + +YC       D CQ   I   C  G+C+++  S+ C C        +G+ CV              +   Y   + G C         K        E+G                       +   C    C    +  F+ +C  G    +DGR      +++C  +  IC  G CE    S +RC+C         G +C+ IN           + LVNRL C +G C N      C C  G+    D + C  I +  S   +N +             ++ C+C +G         C+ S       +I D           L  E C T G  +  P  + +   AC  G  +    K  I  D  +C V    C  G C +    + C C    T+ E GR C+
Sbjct:    3 YSFLLPLFLPFISCFVYFACFFCYRPNVCGSRFHS-----YCCPGWKTLPGGNQCIVPICRNTCGDGFCSRPNMCTCSSGHLA----PSCGAASCSVRCMNGGACNDDSCVCQKGYTGNHCGQPVCESGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLSGIVCTKTLCCATIGRAWGHPCEVCPAQPHPCRRGFIPNIRSGACQDVDECQAIPGLCAGGNCINTVGSYECKCPAGHRQSETNQKCE-DIDECALPGLCDG--GECTNTA-GSYVCTCPRGYVSSADGSRCIDQRIGTCFSALANGRCAAELTGQFSKMQCCCDLGRCWALGHIPE-MCPVRGSGELFAKACDSPQSYASSPSPSPYPPELLLLHSTIDVCK--HFTNLCLNGRCIPTTASYRCECN---MGYRQDMRGECIDV---DECISNPCVN---------GDCVNTQGSYHCKCHEGYQGTATKQACIDID----ECIVNGVMCRNGRCVNTD-GSFQCICNAGFDLSPDGKNCIDHDECATT--------NMCLNGMCIN-EDGSFKCICKQGFALAPNGRYCTD----IDECQTPGI---CMNGRCINSEGSFHCECPPGLAIDVDGRVCVDTHM----------RTTCYGAIKMGTCSRPFPGAVTKSECCCANPEHG-----------------------FGQPCQ--PCPARNSAEFQAVCSSGIGITTDGRD-----INECALDPEICQNGMCENLLGS-YRCICNIGYESDSSGKNCVDIN-----------ECLVNRLLCDNGLCRNTPGSFTCSCPKGFVFKADSETCEDINECESSPCVNGICRNLA-------GSFTCECSHGSKLDSTNTVCVDSMKGTCWLNIQDNRCEVNINGATLKSECCSTLGAAWGSPCERCEVDTACPRGLARM---KGLICEDINECEVFPGVCSNGVCVNTHGSFRCECAEGLTLDEGGRTCV 883          

HSP 2 Score: 143.665 bits (361), Expect = 5.034e-34
Identity = 217/940 (23.09%), Postives = 339/940 (36.06%), Query Frame = 1
Query:  382 CNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-YCPKGFTQKENR-CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-----------------------QYRRDQC-----QLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNY---NVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQ-GYNNDQECVRYGTSE--PLVSR-------------YCSKSEYYS-----------------LCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEE------------PDNSYCLLQ-----------------EYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSIC-----DLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            C  ++  TC++ I    C+       L K ECCS    AWG+PC  C+ +  CP+G  + +   C+DI+EC+ F  +C NG C+N  GSFRC+C     LDE   +C                       +YR D C       +G  C     C      +Y  IC +    +  G     +  Y   N C  FK LC  +G C+    S+ C C +GF  + ++++C     +DI +     + C  G+CV+    + C C   Y+ G+   + C+     E  PL+ R              C +    S                 LC  G CV++   Y C C  G+  T +R+ C+ I+  T         C           +YEC C  G+    + R+C   +   ++  IC+  G +C         P EY C C +G+  + D + C   E   +   N  I   C  G C +   S+ C C   Y        C    + E  A       + ++ C        N     KC        +G KC  +++  TEE            P +  C  +                 E ++ C  G+C+ +   G++C C  GFT   D ++C  + +D+C N +NIC  G C+      FRCVC     L + G +C       +P           + C +G CVN      C C   ++ +  G  C      +                           L+   + + G SC       + ++ C           C+  +C P+   +Y   C  G     +  + I+ D  +C      C+GG C +    + C C   Y + E  R C          DI E +               I  C PG C     +Y C CP  +
Sbjct:  777 CVDSMKGTCWLNIQDNRCEVNINGATL-KSECCSTLGAAWGSPCERCEVDTACPRGLARMKGLICEDINECEVFPGVCSNGVCVNTHGSFRCECAEGLTLDEGGRTCVDVRSEHCYMKWDEDECGEPLPGRYRVDMCCCSVGAAWGLECE---SCPKPGTPEYRTICPRGPGFANRGDILTGRPFYKDVNECKVFKGLCT-HGTCRNTIGSFKCRCNNGFALTMEERNC-----TDIDECAISPDLCGQGTCVNTPGSFECECFEGYESGFMMMKNCMDIDECERDPLLCRGGTCLNTEGSYECECPRGHQLSPGGSSCEDVNECELSDNLCRNGQCVNMVGSYQCSCDTGYQVTPDRQGCVDIDECTIMNGGCDTHCTNSE------GSYECSCSEGYALMPDLRTCADIDECEDTPDICD--GGQCTN------IPGEYRCLCFDGFMSTMDMRTC---EDVNECDLNPNI---CLHGDCENTKGSFICHCQLGYFVKKGSTGCTDVDECEIGA----HNCDMHAAC-------VNVPGSFKCRCRDGWVGDGIKCVDLDECSTEEHSCNPNANCVNTPGSYRCACKEGFNGDGFSCSDMDECAENVNLCENGQCL-NTPGGYRCECEMGFTPTEDTKAC--QDIDEC-NFQNICVFGSCQNLPGM-FRCVCDDGYELDRSGGNCTDVNECADP-----------VNCINGLCVNMPGSYLCNCPADFELNPTGVGCVDTRVGNCF-------------------------LDTLDRGDGGISCSAEIGVGVTRASCCCSLGGAWGNPCE--LCPPVNSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRIC---------EDIDECTAH-------------IGICGPGTCYNTLGNYTCVCPPEY 1610          

HSP 3 Score: 125.946 bits (315), Expect = 1.310e-28
Identity = 216/944 (22.88%), Postives = 340/944 (36.02%), Query Frame = 1
Query:  307 TNNCSNKGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKI----DRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENR----CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEY----------------VDQCLNNENI---CT--PGR--------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSI--CDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCF 2946
             N C++   C NG C+   G +             G  C    +  C++      D G+  S    + +++  CC     AWGNPC  C        +  CP G   + N      +DIDECQ    +C  G C+N  GSF+C+CP  +YL+E T  C+   D+C  +   CG  G C  T  G YTC+C   Y     G +C+          F   C    E         C C     ++ +K         + C +P  +E             Y+ LC  +  G+  D       T +P+    C   E   +C  G C++    + C+C  GF        C  I+   S   L Q   +   C  +  + Y C+C  GF  S +G +C+     +   ++C         G C  +    Y C C  G+  + D+  C+  ++           + CR GQC+++  S++C+C   Y  + + + C    +             +   C  G C +   ++ C C  GY    +   C         EP+            C  G CI +    F+C+C PGF  + +GR C  ++                V + LN       C+  PG         C R   + F  +CPY       GH  L            C  L N   C +G C+N     RC C  GY     G  C   ++ S         C            +EC C  G+          +    +  + I  C L+   C        G   Y C C  GY    D++ C   D     +++   +G  C +++  ++CIC    T   +G  C+         D++E           C  K  +  C+ G+CV     Y+C+C   F+ +    EC+   N+  +CF
Sbjct: 1420 VNECADPVNCINGLCVNMPGSYLCNCPADFELNPTGVGCVDTRVGNCFLDTLDRGDGGISCSAEIGVGVTRASCCCSLGGAWGNPCELCPPVNSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICE-DIDECTAHIGICGP-GTCYNTL-GNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNFNDTC--ENELSFNMTKKMCCCAYNVGKAWNKPC-------EACPTPATSE-------------YQLLCGNQAPGFIIDIH-----TGKPIDIDECR--EIPGICANGVCINQIGSFRCECPMGFSYNNILLICEDIDECNSGDNLCQ---RNANCINIPGS-YRCECSPGFKLSPSG-ACVDRNECKEKPNVC-------SHGDCIDMQ-GSYRCLCHNGFKATADQTMCMDVDECTTL-----SGQVCRHGQCINSLGSFQCLCQEGYELTPDNKNCADVNEC----------VTFPGTCSPGTCQNLVGSFRCICPPGYAVQNDQLTCVVYINDCEVEPN-----------ICQFGTCI-NTPGSFQCICQPGFVLSDNGRRCFGKFTVDIFCFTRFEAGKCSVPKALNTTKAKCCCSKMPGEGWGDPCELCPRENEAGFNALCPY-------GHGTLPGPGDGREDMNEC--LDNPGICVNGMCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCGNGTCTNVV------GGFECSCQEGF----------EPGPMMTCEDINECSLNPLLCAFRCVNTFGS--YECMCPAGYVLRDDQRMCRDQDECTEGLDDCASRGMACKNLIGTFMCICPPGMTRRPDGEGCM---------DLNE-----------CRTKPGL--CKNGRCVNTVGSYRCECSEGFEPSATGTECI--DNRQGFCF 2240          

HSP 4 Score: 112.079 bits (279), Expect = 2.490e-24
Identity = 234/1022 (22.90%), Postives = 370/1022 (36.20%), Query Frame = 1
Query:  340 NGKCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPEN---LQLSKEECCSIFQV--AWGNPCVFCDR-----------NYCPKGFTQ--KENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQY--------------------KDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ--------------------------TEPPAVRLCSKWEYYSLCQ---GGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLIN---YVTTEPTTKYCDI-LVNRLRCASGNC----------------------VNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCP---YCFYGCFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTCRTKSLNRTL 3102
            N  C+C   Y     G +C     S CY   +      T EN     ++K+ CC  + V  AW  PC  C             N  P GF       +  DIDEC +   IC NG CIN+ GSFRC+CP     +   + C+   D+C    + C     C+    G Y C C   + +S +G +C+ +   N C     +C  +G+C     SY C C +GF  + D+  C+   + D C +    + CR G C++    ++CLC   Y+   +++ C                  +   C  G+C +L   + C C  G+    ++  C+      + C +    CQ G C     + ++C C  GF+ S+NGR C   + T +          +C           +  C+ + G    +  + C +  +                     +D  +  +    C  G C++   S+RC C   Y     G  CV   +                           EP  +  C      SL        CV+T  +Y C C  GY   ++ R C R + + TE        L +  SR M  +   +    F C+C PG T   DG  C    +++C     +C  GRC  +  S +RC C      S  G  C+ N   +  TE     C     NR       C                          C  GPGY +  DG++  + E + ++C   Q              ++ C C  GY    +G SCI  +        C+     CK        +  Y+C+C  GY    D K+C  +D  +C+  ++ C+   C + + G+ C C   +T  +              +D +E + Q     S C  +          C+     + C+C   F  +    EC  D ++C     C +GC +      C C + Y   +    C+   DE   S G+  C + S   TL
Sbjct: 1601 NYTCVCPPEYMQVNGGNNCMDMRKSVCYRNFN-----DTCENELSFNMTKKMCCCAYNVGKAWNKPCEACPTPATSEYQLLCGNQAP-GFIIDIHTGKPIDIDECREIPGICANGVCINQIGSFRCECPMGFSYNNILLICE-DIDECNSGDNLCQRNANCI-NIPGSYRCECSPGFKLSPSG-ACVDR---NECKEKPNVC-SHGDCIDMQGSYRCLCHNGFKATADQTMCM---DVDECTTLS-GQVCRHGQCINSLGSFQCLCQEGYELTPDNKNCADVNEC----------VTFPGTCSPGTCQNLVGSFRCICPPGYAVQNDQLTCV---VYINDCEVEPNICQFGTCINTPGS-FQCICQPGFVLSDNGRRCF-GKFTVDIFCFTRFEAGKCSVPKALNTTKAKCCCSKMPGEGWGDPCELCPRENEAGFNALCPYGHGTLPGPGDGREDMNECLDNPGICVNGMCINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCGNGTCTNVVGGFECSCQEGFEPGPMMTCEDINECSLNPLLCAFRCVNTFGSYECMCPAGYVLRDDQRMC-RDQDECTEG-------LDDCASRGMACK---NLIGTFMCICPPGMTRRPDGEGC--MDLNECRTKPGLCKNGRCVNTVGS-YRCECSEGFEPSATGTECIDNRQGFCFTEVLQTMCQQGSTNRNSVTKSECCCNGGRGWGPQCELCPLPGTVQYKKMCPLGPGYTT--DGRDINECEVLPNLCKNGQCINSV--------GSFRCHCNVGYTNDFSGTSCIDLDECSQSPKPCNF---LCKNT------EGSYLCSCPRGYILQPDGKTCKDLD--ECSTKQHNCQF-LCVNTIGGFTCKCPSGFTQHQ-----------TACIDNNECTNQ----PSVCGSR--------ASCLNTPGSFNCECQKGFSLDGTGVEC-EDVDECTGNHRCQHGCQNMLGGFRCGCPQGYVQHYQWNQCV---DENECS-GNQVCGSASCYNTL 2526          

HSP 5 Score: 107.071 bits (266), Expect = 6.990e-23
Identity = 228/943 (24.18%), Postives = 345/943 (36.59%), Query Frame = 1
Query:  334 CQNG---------KCICESGYFGEDC--NTAIISTCYVK---IDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC----------QYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIK-------PYSVS-FNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI--------VNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNG-------EYQ-------GYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSI--CELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGG---ECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNC-VNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDC-------ILKIIAVKSVD--------ISEVSYQNPQSQSFCTRKEIIEKCQP-----GKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            CQNG         +CIC  GY  +    N   I+ C V     D GLC++TP +   S                       CPKGF  K +   C+DI+EC+  S C+NG C N  GSF C+C     LD     C            + ++C++  +   +  +C  T    +   C +       P  ++   G  C    + N C  F  +C   G C     S+ C C  G    E  ++C+        +  + D C  P          C S G  +   C         EY+       G+ N  + +   T  P          +  LC  G+C +    + C+C+ GF  T   R C  I+    +CA++   C  G C     + +EC+C  G+   E+G   +K     N   I  CE     C+ G C       Y C C  G+  S     C      +D  + +     CR GQCV+   SY+C C   Y  + + Q CV   +               ++  GG    C ++  +Y C C  GY    + R C+ I+ +  + PD            C GG+C  +    ++CLC  GF S  D R+C  E V++C  N NIC  G CE +  S F C              C + Y   + +T   D  V+     + NC ++  C+  PG                                      +++C+C +G++   +G  C+  +    ++  C+ +     T          Y CAC  G+    D  SC  MD  +CA N   C+ G C +   GY C C   +T TE+ + C          I    S          + +  Y+  +S   CT  ++ E   P     G CV     Y C CP  F+ N     CV
Sbjct:  666 CQNGMCENLLGSYRCICNIGYESDSSGKNCVDINECLVNRLLCDNGLCRNTPGSFTCS-----------------------CPKGFVFKADSETCEDINECE-SSPCVNGICRNLAGSFTCECSHGSKLDSTNTVCVDSMKGTCWLNIQDNRCEVNINGATLKSECCSTLGAAWGSPCERCEVDTACPRGLARMKGLIC---EDINECEVFPGVC-SNGVCVNTHGSFRCECAEGLTLDEGGRTCVDVRSEHCYMKWDEDECGEPLPGRYRVDMCCCSVGAAWGLECESCPKPGTPEYRTICPRGPGFANRGDIL---TGRPFYKDVNECKVFKGLCTHGTCRNTIGSFKCRCNNGFALTMEERNCTDID----ECAISPDLCGQGTCVNTPGS-FECECFEGY---ESGFMMMK-----NCMDIDECERDPLLCRGGTCLNTE-GSYECECPRGHQLSPGGSSC------EDVNECELSDNLCRNGQCVNMVGSYQCSCDTGYQVTPDRQGCVDIDEC--------------TIMNGGCDTHCTNSEGSYECSCSEGYALMPDLRTCADID-ECEDTPD-----------ICDGGQCT-NIPGEYRCLCFDGFMSTMDMRTC--EDVNECDLNPNICLHGDCENTKGS-FIC-------------HCQLGYFVKKGSTGCTD--VDECEIGAHNCDMHAACVNVPG--------------------------------------SFKCRCRDGWVG--DGIKCVDLDECSTEEHSCNPNANCVNT-------PGSYRCACKEGFNG--DGFSCSDMD--ECAENVNLCENGQCLNTPGGYRCECEMGFTPTEDTKACQDIDECNFQNICVFGSCQNLPGMFRCVCDDGYELDRSGGNCT--DVNECADPVNCINGLCVNMPGSYLCNCPADFELNPTGVGCV 1459          

HSP 6 Score: 106.686 bits (265), Expect = 9.972e-23
Identity = 198/819 (24.18%), Postives = 320/819 (39.07%), Query Frame = 1
Query:  526 RNYCPKGFTQK-ENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECV------------RYGTSEPLVSRYCSKSE---------YYSLCEGGSCVDLNN-DYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVC-HGKYISSNNGQECVRYKQTEPPAVR--LCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLN--NENIC---TPGR--------------------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYC-DILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKE 2811
            R  C  G+ Q     C D+DEC   + C+NG+C+N +GS+ C+C   +       +C    D+C + G  C   G+CV T DG + CIC   + +S +GK+CI        N    +CL  G C     S+ C C  GF  + + + C   ++ D CQ+P I   C  G C++    + C C        + + CV            + GT         +KSE         +   C+   C   N+ ++   CS G   T + R         ++CAL+   CQ G C+ L   +Y C C  G+    +G++C+           C +    C  G+C    P  + C+C +G+    D + C      +D   N+  S  C  G C +   S+ C C HG  + S N       K T    ++   C      +  +   C      +   C      T   R  +R++  + E+ +      + +   C  G C+   T+G F+C C  G T    GR+C     + C    +E+ C    PGR                    C + G   +R +CP     +  G     + +T  P  K   +  V +  C  G C N     +C C  G+  + + + C  I++ +           G G       ++EC+C  GY   E+G   +K+    +    C+     C+ G C    +  Y C C  G++ +    SC   D  +C +++  C+ G C ++V  Y C C   Y VT + + C         VDI E +  N    + CT  E
Sbjct:  405 RCECNMGYRQDMRGECIDVDEC-ISNPCVNGDCVNTQGSYHCKCHEGYQGTATKQAC-IDIDECIVNGVMC-RNGRCVNT-DGSFQCICNAGFDLSPDGKNCIDHDECATTN----MCL-NGMCINEDGSFKCICKQGFALAPNGRYC---TDIDECQTPGI---CMNGRCINSEGSFHCECPPGLAIDVDGRVCVDTHMRTTCYGAIKMGTCSRPFPGAVTKSECCCANPEHGFGQPCQ--PCPARNSAEFQAVCSSGIGITTDGRD-------INECALDPEICQNGMCENL-LGSYRCICNIGYESDSSGKNCVDINE-------CLVNRLLCDNGLCRNT-PGSFTCSCPKGFVFKADSETC------EDI--NECESSPCVNGICRNLAGSFTCECSHGSKLDSTNTVCVDSMKGTCWLNIQDNRCEVNINGATLKSECCSTLGAAWGSPCERCEVDTACPRGLARMKGLICEDINE----CEVFPGVCSNGVCV--NTHGSFRCECAEGLTLDEGGRTCVDVRSEHCYMKWDEDECGEPLPGRYRVDMCCCSVGAAWGLECESCPKPGTPEYRTICPRGPGFANRG-----DILTGRPFYKDVNECKVFKGLCTHGTCRNTIGSFKCRCNNGFALTMEERNCTDIDECA-----ISPDLCGQGTCVNTPGSFECECFEGY---ESGFMMMKN---CMDIDECERDPLLCRGGTCLNT-EGSYECECPRGHQLSPGGSSC--EDVNECELSDNLCRNGQCVNMVGSYQCSCDTGYQVTPDRQGC---------VDIDECTIMNGGCDTHCTNSE 1148          

HSP 7 Score: 93.5893 bits (231), Expect = 8.928e-19
Identity = 156/662 (23.56%), Postives = 248/662 (37.46%), Query Frame = 1
Query:  526 RNYCPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLC-------NGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSIC-ELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYC--IKNEQYKDYCQNQ--------------------EISKRCRGGQCVSNGNSYRCVCHGKYISSN-------------------NGQECVR----YKQTEPPAVRLCSKW---------EYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL--INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECY 2301
            R  C  GFT  E+   C DIDEC F++IC+ G C N  G FRC C   + LD +  +C    D  +       I G CV    G Y C C   + ++  G  C+                  G C              F  + D+    ++ +++I          R   C S G  +   C       + EY+      E  R      ++       E   LC+GG+CV+    + C+C  G+Y  E  R C  I+  T+   +    C  G C      NY C C   +++   G +C+   +     S+C   +   C+  + + +      CA   G + ++  + C      +Y+  C NQ                    EI   C  G C++   S+RC C   +  +N                       C+     Y+    P  +L             E  ++C  G+C+D   +Y C C NG+ AT +   C  +++  T                C  G+CI +    F+CLC  G+    D ++C    V++C+     C+PG C+    S FRC+CP   ++  D  +C+  IN    EP             C  G C+N     +CIC PG+  S++G+ C+
Sbjct: 1360 RCECEMGFTPTEDTKACQDIDECNFQNICVFGSCQNLPGMFRCVCDDGYELDRSGGNCT---DVNECADPVNCINGLCV-NMPGSYLCNCPADFELNPTGVGCVDTR--------------VGNC--------------FLDTLDRGDGGISCSAEI-----GVGVTRASCCCSLGGAWGNPCELCPPVNSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGGNCVNTFGSFQCECPAGYYLNEETRICEDIDECTAHIGI----CGPGTCYNT-LGNYTCVCPPEYMQVNGGNNCMDMRK-----SVCYRNFNDTCENELSFNMTKKMCCCAYNVGKAWNKPCEACPTPATSEYQLLCGNQAPGFIIDIHTGKPIDIDECREIPGICANGVCINQIGSFRCECPMGFSYNNILLICEDIDECNSGDNLCQRNANCINIPGSYRCECSPGFKLSPSGACVDRNECKEKPNVCSHGDCIDMQGSYRCLCHNGFKATADQTMCMDVDECTTLSG-----------QVCRHGQCI-NSLGSFQCLCQEGYELTPDNKNC--ADVNECVTFPGTCSPGTCQNLVGS-FRCICPPGYAVQNDQLTCVVYINDCEVEPNI-----------CQFGTCINTPGSFQCICQPGFVLSDNGRRCF 1948          

HSP 8 Score: 93.2041 bits (230), Expect = 1.362e-18
Identity = 198/876 (22.60%), Postives = 310/876 (35.39%), Query Frame = 1
Query:  334 CQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQV-AWGNPCVFCDRNYCPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNV----------CNYFKKLCLPYGEC--------------------QPYGLSYYC-----SCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDK--------TYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICD-----------------------------------LHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDC 2721
            C +G CI   G +   C+    +T     D+ +C    E   LS + C     + + G+    C   Y     T     C D++EC  F   C  G C N  GSFRC CPP + +  + ++C    + C++  + C  FG C+ T  G + CIC   + +S NG+ C  K   ++          C+  K L     +C                       G +  C     + P      ED   C+ N        P I   C  G C++    +RC C     GYN D     Y     + +  CS     + C  G+C ++   + C C EGF         +  E I ++C+LN   C   RC      +YEC C  G++  ++ R C   +        C   G  C+  +        ++C C  G ++  D + C+      D  + +     C+ G+CV+   SYRC C   +  S  G EC+  +Q        C      ++CQ G                          S     VT+    S C        C GGR  G +        T  +K +C  G    +DGR      +++C    N+C  G+C  S  S FRC C    +    G SC I+      + K C+ L      +        C C  GY    DGK C  +++ S+     Q  C            + C+C +G+ + +   +CI +     + S+C                                        +C+ G    +G   + C C  GY Q      C+  D  +C+ N+  C    CY+ +  Y C+C   +        C
Sbjct: 1790 CSHGDCIDMQGSYRCLCHNGFKAT----ADQTMCMDVDECTTLSGQVCRHGQCINSLGSFQCLCQEGY---ELTPDNKNCADVNECVTFPGTCSPGTCQNLVGSFRCICPPGYAVQNDQLTCVVYINDCEVEPNIC-QFGTCINTP-GSFQCICQPGFVLSDNGRRCFGKFTVDIFCFTRFEAGKCSVPKALNTTKAKCCCSKMPGEGWGDPCELCPRENEAGFNALCPYGHGTLPGPGDGREDMNECLDN--------PGI---CVNGMCINTDGSFRCEC---PFGYNLD-----YTGVNCVDTDECSIG---NPCGNGTCTNVVGGFECSCQEGFEPGPM----MTCEDI-NECSLNPLLC-AFRCVNT-FGSYECMCPAGYVLRDDQRMCRDQDECTEGLDDCASRGMACKNLI------GTFMCICPPGMTRRPDGEGCM------DLNECRTKPGLCKNGRCVNTVGSYRCECSEGFEPSATGTECIDNRQG------FCFTEVLQTMCQQG--------------------------STNRNSVTK----SECC-------CNGGRGWGPQCELCPLPGTVQYKKMCPLGPGYTTDGRD-----INECEVLPNLCKNGQCINSVGS-FRCHCNVGYTNDFSGTSC-IDLDECSQSPKPCNFLCKNTEGSY------LCSCPRGYILQPDGKTCKDLDECSTKQHNCQFLCVNTI------GGFTCKCPSGFTQHQT--ACIDNNECTNQPSVCGSRASCLNTPGSFNCECQKGFSLDGTGVECEDVDECTGNHRCQHGCQNMLG--GFRCGCPQGYVQHYQWNQCV--DENECSGNQV-CGSASCYNTLGSYKCVCPSGFDFQAGAGGC 2546          
BLAST of Fibrillin-2 vs. Ensembl Cavefish
Match: FBN1 (fibrillin 1 [Source:HGNC Symbol;Acc:HGNC:3603])

HSP 1 Score: 140.969 bits (354), Expect = 3.078e-33
Identity = 231/943 (24.50%), Postives = 354/943 (37.54%), Query Frame = 1
Query:  346 KCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-YCPKGFTQ-KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-QYRRDQCQL---------------------------YGSSCGIFGKCVPTSDGQYTCICIKPYSVS-----FNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNS------------------------DICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNN---YECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ--------------TEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXAT-ENGRKCSRIEKQVTEEPDNSYCL----LQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESA---LIKKSICDLHRE-KCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYR--CKGGYCYDIVDGYLCICVGNYTVTENGRDCIL----KIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
             C+C +G      G  C      TC++KI   LC+       L K +CC+    AWG+PC  C+R+  CPKG ++ + + C+D++EC+ F  +C+NG+C+N  GSF CQCP    +D +  +C   R +QC L                           +G  C    +C      +Y  +C +    S      NGK  +K  + N C     LC   G C+    S+ C C SG+    D+++C   S                          D C+   +   CRGG C++    +RC C   ++   +   C        L    C  S+   LC  G CV++   Y C C+ G+ +T++   C+ I+  T    LN      G C+    N+   YEC C RG+    + RSC   +   +S  IC+  G +C         P EY C C +G+  SED K C+  ++ +    N  I   C  G+C +   S+ C C   Y        C    +              T  P    CS    + +  G +C D +            A   N     R   +     D  +C       + ++ C  G C+ +   G++C C  GF    DG++C  E +D+C    +IC  GRC+      FRC C     L + G +C       +PTT           C SG CVN      PG                                      +Y C C   +  +  G  C+   S    L  +S  D      C   I   +G +   C C LG    T  ++C ++++     +EY+  C GG      +G+        TV   GR   L     +I +  + +   SY +    + C    I   C PG+C     +Y C CP  +
Sbjct:  796 SCLCSTGSSLDNSGLQCIETSKGTCWLKIVNALCEVNINGATL-KSQCCATLGAAWGSPCSPCERDPVCPKGHSRVRGSICEDVNECEVFPGVCINGKCVNTLGSFICQCPTGMTVDASGRTCIDLRTEQCYLSHEDERCGAPISGRHRVDTCCCSVGVAWGPECD---ECPEKGTPEYNLLCPRGPGFSQRGDFINGKPFLK--DINECKMIHSLCT-NGRCRNTIGSFRCRCDSGYALDSDERNCTGESERKQPLHQCKKDKGDDCGLQKGQAYIDECERNPLL--CRGGDCINTEGSFRCQCPPGHEIAPDGSAC--------LDINECELSD--KLCRNGQCVNMIGRYQCSCNTGYKSTQDLLSCVDIDECT---ILN------GGCETTCTNSEGSYECSCRRGYALMPDQRSCTDIDECEDSPDICD--GGQCTN------IPGEYQCLCFDGFMSSEDLKTCLDVDECE---LNPNI---CLSGKCENTKGSFICHCDLGYSVRKGTTGCTDVNECEIGAHNCDRHATCTNTPGSFKCSCTPGW-IGNGIQCTDLDECSNGTHLCSSNADCMNTMGSYRCVCKEGFSGDGFFCTDSDECADNVNLCENGHCL-NVAGGYRCECDMGFIPTPDGKAC--EDIDEC-TFADICVNGRCQNIPGL-FRCECSIGFELDRSGGNCTDINECADPTT-----------CISGFCVNT-----PG--------------------------------------SYFCNCPPDFQLNPTGVGCVDIRSGNCYLDVRSRGDASESLDCSNEI--GVGVSKASCCCSLGQGWGTPCEACPLLNS-----SEYKSLCPGG------EGFR---PNPITVILEGRSKALCGFCSVIYIFFIFL--YSYASFSDINECQEPGI---CGPGQCYNTIGNYTCICPPDY 1615          

HSP 2 Score: 119.783 bits (299), Expect = 9.152e-27
Identity = 205/856 (23.95%), Postives = 323/856 (37.73%), Query Frame = 1
Query:  535 CPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVC--NYFKKLCL-------------------PYGE-CQP----YGLSYYCSCPSGFHQSEDKKSCIVNS---NSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAER----TRNSTSICE-------LYGHRCQT-GVCY--PIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYK--------QTEPPAVRLCSKWEYYSLC------QGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEP---DNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPE-------------------------YVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKC 2826
            C  GF  +     C D+DECQ +++CLNG CIN+ GSF+C C   + LD                G  C    +CV T +G + C C+   +V  +G++C+     + C   Y +  C+                    +GE CQP        +   CP G   + D K   +N    N DICQ+         G C +  + Y+C CN  ++  +  + C+     E  V+R         LC+ G C +    + C C  G+    +   C  I+    +CA N   C    C+     ++ C C  G     +G  CI+  +     +   ++CE       L    C T G  +  P  P E    C +G+S+       ++    +D  + +     C  G+CV+   S+ C C        +G+ C+  +        + E     +  +    + C       G EC +                  G   S+    +  +P   D + C +   L  C  GRC  +    F+C C  G+   SD R+C  E                         Y+D+C  N  +C  G C  +  S FRC CP    ++ DG +CL IN             L ++L C +G CVN     +C C  GYKS++D   C  I++ + +    +  C         + +YEC C  GY    + RSC   +       ICD        G C  I   +Y C C  G+  + D K+C+ +D  +C +N   C  G C +    ++C C   Y+V +    C         V+  E+   N    + CT      KC
Sbjct:  535 CNSGFEISPDGKNCQDMDECQIRNMCLNGMCINDDGSFKCICKSGYLLDGT--------------GRYCIDVDECVNT-EGSFRCECVAGLAVGLDGRTCVDTHMRSTCYGGYKRGQCIQPFFGAVTKSECCCAKVEYAFGEPCQPCPPETSAEFAALCPGGIGSTTDSKD--INECALNPDICQN---------GECENLLRTYKCNCNQGFEVDSTGKNCIDI--DECSVNRL--------LCDNGMCRNTPGSFTCHCPLGYIFQPDTDVCEDID----ECASN--PCVNADCKNT-QGSFSCLCSTGSSLDNSGLQCIETSKGTCWLKIVNALCEVNINGATLKSQCCATLGAAWGSPCSPCERDPVCPKGHSR-------VRGSICEDVNECEVFPGVCINGKCVNTLGSFICQCPTGMTVDASGRTCIDLRTEQCYLSHEDERCGAPISGRHRVDTCCCSVGVAWGPECDEC---PEKGTPEYNLLCPRGPGFSQRGDFINGKPFLKDINECKMIHSL--CTNGRCR-NTIGSFRCRCDSGYALDSDERNCTGESERKQPLHQCKKDKGDDCGLQKGQAYIDECERNPLLCRGGDCINTEGS-FRCQCPPGHEIAPDGSACLDINECE----------LSDKL-CRNGQCVNMIGRYQCSCNTGYKSTQDLLSCVDIDECTILNGGCETTCTNS------EGSYECSCRRGYALMPDQRSCTDIDECEDSPDICD-------GGQCTNI-PGEYQCLCFDGFMSSEDLKTCLDVD--ECELNPNICLSGKCENTKGSFICHCDLGYSVRKGTTGCT-------DVNECEIGAHNCDRHATCTNTPGSFKC 1299          

HSP 3 Score: 113.62 bits (283), Expect = 7.055e-25
Identity = 178/737 (24.15%), Postives = 285/737 (38.67%), Query Frame = 1
Query:  160 WIK--------NVYGDCVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSN-------KGQCQNGKCICESGYF-------------GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-------YCPKG--FTQKENRCD------DIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLY-------GSSCGI------------------FGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNE-QYKDYCQNQEISKRCRG-GQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL 2157
            W+K        N+ G  +KS+C    G       + CE      R   CP+ + ++  + C +        G C NGKC+   G F             G  C       CY+  +   C + P + +   + CC    VAWG  C  C           CP+G  F+Q+ +  +      DI+EC+   S+C NG C N  GSFRC+C   + LD +  +C    ++ Q         G  CG+                   G C+ T +G + C C   + ++ +G +C+   + N C    KLC   G+C      Y CSC +G+  ++D  SC+     DI +   +   C      SEG  Y C C   Y    + + C      E          +   +C+GG C ++  +Y C C +GF ++E+ + C+ ++    +C LN   C  G+C+     ++ C C  G+   +    C            CE+  H C         P  + C+C  G+         I N  Q  D  +    +  C     C++   SYRCVC   +  S +G  C    +            +  +LC+ G C++    Y C+C  G+  T +G+ C  I++               +   C+ GRC       F+C C  GF     G +C    +++C  +   C  G C  +  S F C CP    L+  G  C+
Sbjct:  821 WLKIVNALCEVNINGATLKSQCCATLGAAWGSPCSPCE------RDPVCPKGHSRVRGSICEDVNECEVFPGVCINGKCVNTLGSFICQCPTGMTVDASGRTCIDLRTEQCYLSHEDERCGA-PISGRHRVDTCCCSVGVAWGPECDECPEKGTPEYNLLCPRGPGFSQRGDFINGKPFLKDINECKMIHSLCTNGRCRNTIGSFRCRCDSGYALDSDERNCTGESERKQPLHQCKKDKGDDCGLQKGQAYIDECERNPLLCRGGDCINT-EGSFRCQCPPGHEIAPDGSACL---DINECELSDKLCR-NGQCVNMIGRYQCSCNTGYKSTQDLLSCV-----DIDECTILNGGCETTCTNSEGS-YECSCRRGYALMPDQRSCTDIDECE----------DSPDICDGGQCTNIPGEYQCLCFDGFMSSEDLKTCLDVD----ECELNPNICLSGKCENT-KGSFICHCDLGYSVRKGTTGCTDVNE-------CEIGAHNCDRHATCTNTPGSFKCSCTPGW---------IGNGIQCTDLDECSNGTHLCSSNADCMNTMGSYRCVCKEGF--SGDGFFCTDSDECA----------DNVNLCENGHCLNVAGGYRCECDMGFIPTPDGKACEDIDECT-------------FADICVNGRCQNIPGL-FRCECSIGFELDRSGGNC--TDINECA-DPTTCISGFCVNTPGSYF-CNCPPDFQLNPTGVGCV 1478          

HSP 4 Score: 111.694 bits (278), Expect = 3.350e-24
Identity = 161/627 (25.68%), Postives = 244/627 (38.92%), Query Frame = 1
Query:  328 GQCQNG----KCICESGY----FGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVA--WGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYG--TSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYK---QTEPPAVRLCSKWE--YYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTP-GRCERSGNSNFRCVCPYYASLSKDGHSC 2154
            G CQN     KCIC  G+     G  C    +S CY K + G C + P+ L  +K  CC        WG+PC  C             +  +DIDEC+   IC NG+CIN  G FRC+CP  + LD + ++C    D+C+  G+ CG  G C     G + C C +     F     +   + N C+    LC  +     YG SY C CP+G+   ED++ C    + D C       + RG +C +    Y C+C   Y    N + C+     T++P             +CE G C +    Y C+C  GF  +  +  C  I        + Q  CQ G    +     EC C       + GR                 +G  C+  +C       Y   C +G   + D          +D  + + +   C+ G+CV+   SY+CVC+  Y +  +G  CV      Q   P   +C   E  Y   C  G  +                 E+ + C  +++  T++ +  +  +              +   GF C C PGFT      +C     ++C  +  +C P G C+ S  S F C C    SL ++G  C
Sbjct: 1925 GTCQNTPGSFKCICPEGFQLSSSGRRCVDMRVSFCYTKFENGRCVA-PKPLNTTKSHCCCSMMPGQGWGDPCEICPNMTDVGVPYGTGDTPEDIDECKEPGICKNGQCINTDGGFRCECPTGYSLDSSRVNCT-DTDECK-DGNPCG-NGTCNNVFGG-FECTCDE----GFEPGPMMTCEDINECSQNPLLCA-FRCVNTYG-SYECKCPTGYVLREDRRMC---KDQDECADEVDDCQSRGMTCKNLIGTYMCICPQGYTRQPNGEGCMDLNECTAKP------------GICENGRCENTVGSYRCRCETGFEPSPTQTECYDIRRGFCFTEVLQTMCQMGSSNRVSVTKSECCC-------DGGRG----------------WGASCE--LCPLPGTTHYKRMCPQGPGYTTDG---------QDINECKVMGNLCQKGRCVNTEGSYKCVCNSGYTTDISGTICVDVDECVQAPKPCNFICKNVEGGYQCSCPRGYILQ----------------EDRKSCRDLDECSTKQHNCQFLCV--------------NTIGGFTCKCPPGFTQHH--TACIDN--NECNTDPGLCGPNGMCQNSPGS-FNCECQRGFSLDQNGQHC 2456          

HSP 5 Score: 103.605 bits (257), Expect = 9.469e-22
Identity = 207/866 (23.90%), Postives = 320/866 (36.95%), Query Frame = 1
Query:  532 YCPKGFTQKEN-RCDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQEC--------VRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ-TEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGR------------CIGDKTYGFKC-LC-LPGFT------SASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKT--GICYPIGQ-----NDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY----CFYGCFDENSISTCSCSENY 3000
             C  GF    N  C D DEC   + IC NG+C N  GSF C C   + L  +   C    ++C L   +CG  G C    DG Y CIC   + +  +     +  + + C      C+ +G CQ    S+ C CP GF  S   + C V+     C +     RC     ++  K + C      QG+ +  E         V YGT +        + +   +C+ G C++ +  + C+C  G+    +R  C    T T +C  +   C  G C  +    +EC C  GF       +C        +  +C           C   Y   Y C C  GY   EDR+ C    + +D C ++    + RG  C +   +Y C+C   Y    NG+ C+   + T  P +           C+ G C +T  +Y C+C  G+  +    +C  I +         +C  +   + C  G             C G + +G  C LC LPG T          G + D + +++C    N+C  GRC  +  S ++CVC    +    G  C+ ++     P  K C+ +   +          +C C  GY   ED K C  +++ S+                     + CQ L   + +  G +C K      +     +   +C T  G+C P G        + C C  G+    + + C  MD  +C  N +RC+ G C ++V GY C C   Y        C+            E   QN Q             C    C      ++C CP  F        C  D N+C      C YGC + +    C C   Y
Sbjct: 1814 LCYPGFQLSHNIDCIDTDECATQRGICRNGDCFNTVGSFVCVCRQGYELSLDGRFC-VDINECALSPGTCGP-GTCQ-NLDGSYRCICNTGHYLKDD-----RCEDIDECAQAPDFCI-FGTCQNTPGSFKCICPEGFQLSSSGRRC-VDMRVSFCYTKFENGRCVAPKPLNTTKSHCCCSMMPGQGWGDPCEICPNMTDVGVPYGTGD--TPEDIDECKEPGICKNGQCINTDGGFRCECPTGYSLDSSRVNC----TDTDECK-DGNPCGNGTCNNV-FGGFECTCDEGF-EPGPMMTCEDINECSQNPLLCAFR--------CVNTY-GSYECKCPTGYVLREDRRMC----KDQDECADEVDDCQSRGMTCKNLIGTYMCICPQGYTRQPNGEGCMDLNECTAKPGI-----------CENGRCENTVGSYRCRCETGFEPSPTQTECYDIRR--------GFCFTEVLQTMCQMGSSNRVSVTKSECCCDGGRGWGASCELCPLPGTTHYKRMCPQGPGYTTDGQDINECKVMGNLCQKGRCVNTEGS-YKCVCNSGYTTDISGTICVDVDECVQAP--KPCNFICKNVEGGY------QCSCPRGYILQEDRKSCRDLDECST-------------------KQHNCQFL--CVNTIGGFTC-KCPPGFTQHHTACIDNNECNTDPGLCGPNGMCQNSPGSFNCECQRGFSLDQNGQHCEDMD--ECDGN-HRCQHG-CQNLVGGYRCNCPQGYLQHYQWNQCV-----------DENECQNGQ------------ICGGASCHNTLGSFRCLCPTGFSFEQTSGGC-HDVNECSSQQNPCTYGCSNTDGGYLCGCPPGY 2569          

HSP 6 Score: 100.138 bits (248), Expect = 9.059e-21
Identity = 80/301 (26.58%), Postives = 120/301 (39.87%), Query Frame = 1
Query:   46 LMIFLIFLFYFDTILWNHIVVASICDYSDNGEPLCCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFT--QKENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCI 831
             M+    LF   ++ + H  + ++C      +  CC GW     G+ C+   C   CG G C   N+C C    I + +C   + + C   C N G C    C+C+ GY G  C   +                                    C+  +   +C+     +  +K  CC+    AWG+PC  C    + C +GF    +   C D+DECQ    +C  G CIN  GSF C+CP  H  +E +  C+   D+C      CG  G+C  T  G Y C C   +  + +G  CI
Sbjct:   14 FMVICWGLFCSVSVFFLHSCLPNVC--GSRHQTYCCPGWKTLTGGNQCIVPICRSSCGDGFCSRPNMCTCPSGQI-SPSCGSKSAQHCNIRCMNGGTCAEDNCMCQKGYSGTHCGQPVCESGCLNGGRCVAPNRCVCTYGFTGAQCERDYRTGPCFASVSNQMCQGQLTGIVCTKTLCCATVGRAWGHPCEQCPAQPHPCRRGFIPNHRTGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHRFNEVSQKCE-DIDECSNIPGLCGA-GECSNTI-GSYFCRCPVGFETALDGSRCI 308          

HSP 7 Score: 97.0561 bits (240), Expect = 8.233e-20
Identity = 195/824 (23.67%), Postives = 297/824 (36.04%), Query Frame = 1
Query:  454 LQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRC-------------------------------DDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQ-YRRDQC--QLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLP---------YGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCH-GKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVT---EEPDNSYCLLQEYLSRCMGGRC---IGDKTYGFKCLCLPGFTSASD--GRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSS-----EDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDC 2721
            + +SK  CC      WG PC  C        ++ CP G   + N                                  DI+ECQ   IC  G+C N  G++ C CPPD+       +C   RR  C    Y  +         T DG+ T          FN    +   +YN+   + K C P            C    + YY    +G  Q  D   C    N  +CQ   +        C++    YRC C   Y         ++Y  S   +S YC   E  ++C  G C+D+   Y C C  G+  T     C+  +    +C   Q  C  G C+     +Y C C  GF  S N   CI  +       I       C+ G C+      ++C C +GY  S D ++C+      D  +       C  G C +   SYRC+C+ G Y+  +  ++     Q                 C  G C +T  ++ C C  G+  + +GR+C  ++ +V+    + +N  C+  + L+      C   +  + +G  C   P  T      G    PE +D+C     IC  G+C  + +  FRC CP   SL     S  +N   T       D   +   C +G C N      C C  G++       ED  EC +   + +   +N               +YEC+C  GY+  E+ R C   +    +   C      CK  I        Y+C C  GY +  + + C  MD  +C      C+ G C + V  Y C C   +  +    +C
Sbjct: 1507 VGVSKASCCCSLGQGWGTPCEACPLLNSSEYKSLCPGGEGFRPNPITVILEGRSKALCGFCSVIYIFFIFLYSYASFSDINECQEPGICGPGQCYNTIGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYSDN--------ATCDGELT----------FNMTKKMCCCSYNIGRAWNKPCEPCPVSGTSEFAILCGSDRIGYYIDIYTG--QVIDIDEC---QNGPVCQQNAV--------CLNLPGSYRCDCKPGYLIL------IKYLVSTVNISVYC--VENPNVCNPGQCIDMVGSYRCLCPSGYKTTTAPAMCVDRD----ECEREQ-PCGNGTCKNT-VGSYSCLCYPGFQLSHN-IDCIDTDECATQRGI-------CRNGDCFNTV-GSFVCVCRQGYELSLDGRFCV------DINECALSPGTCGPGTCQNLDGSYRCICNTGHYLKDDRCEDIDECAQAP-------------DFCIFGTCQNTPGSFKCICPEGFQLSSSGRRC--VDMRVSFCYTKFENGRCVAPKPLNTTKSHCCCSMMPGQGWGDPCEICPNMTDVGVPYGTGDTPEDIDEC-KEPGICKNGQCINT-DGGFRCECPTGYSLD----SSRVNCTDT-------DECKDGNPCGNGTCNNVFGGFECTCDEGFEPGPMMTCEDINECSQNPLLCAFRCVNTY------------GSYECKCPTGYVLREDRRMCKDQDECADEVDDCQSRGMTCKNLI------GTYMCICPQGYTRQPNGEGC--MDLNECTAKPGICENGRCENTVGSYRCRCETGFEPSPTQTEC 2222          

HSP 8 Score: 96.2857 bits (238), Expect = 1.619e-19
Identity = 193/859 (22.47%), Postives = 313/859 (36.44%), Query Frame = 1
Query:  526 RNYCPKGFTQ---KENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRY----------------GTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRR--CIKIETI--------------------------------TSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCL---------LQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQC-LNNEN----------------ICTPG--------RCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDI----LVNRLRCASGNCVND----RCICGPGYKSSEDGKECY-KIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSC-IKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKE 2811
            RN  P+  TQ     N CD +     +++CLNG CI   GS+RC+C   + LD          D+C+    +    G+C+ T+ G Y C C   +  +     C    + + C    ++C   G C     S++C C SGF  S D K+C    + D CQ   I   C  G C+++   ++C+C   Y      + C+                  G +  L  R C  +   S C GG           QC + F+    +    C K+E                                   ++CALN   CQ G C+ L    Y+C C +GF     G++CI  +        C +    C  G+C    P  + C C  GY    D   C    +  D C     S  C    C +   S+ C+C       N+G +C+   +        C      +LC+    V+ N                G  CS  E+       +S             + +   C+ G+C+ +    F C C  G T  + GR+C     +QC L++E+                 C+ G         C   G   +  +CP     S+ G     +++  +P  K  DI    +++ L C +G C N     RC C  GY    D + C  + E+   +                    ++C       K + G  C ++   A I +  C+ +   C+ G C    +  + C C  G++ A D  +C+ ++  +C +++  C+ G C +++  Y C C   Y  T++   C         VDI E +  N   ++ CT  E
Sbjct:  414 RNGIPRILTQNITHTNLCDAV-----RNLCLNGRCIPTPGSYRCECNMGYQLDIRGHC--IDDDECERNPCA---HGQCMNTA-GSYYCQCPAGFQTTATRTEC---KDLDECVANGRIC-NNGRCVNTEGSFHCVCNSGFEISPDGKNC---QDMDECQ---IRNMCLNGMCINDDGSFKCICKSGYLLDGTGRYCIDVDECVNTEGSFRCECVAGLAVGLDGRTCVDTHMRSTCYGGY-------KRGQCIQPFFGAVTKSECCCAKVEYAFGEPCQPCPPETSAEFAALCPGGIGSTTDSKDINECALNPDICQNGECENL-LRTYKCNCNQGFEVDSTGKNCIDIDE-------CSVNRLLCDNGMCRNT-PGSFTCHCPLGYIFQPDTDVC----EDIDECA----SNPCVNADCKNTQGSFSCLCSTGSSLDNSGLQCIETSKG------TCWLKIVNALCE----VNINGATLKSQCCATLGAAWGSPCSPCERDPVCPKGHSRVRGSICEDVNECEVFPGVCINGKCV-NTLGSFICQCPTGMTVDASGRTCIDLRTEQCYLSHEDERCGAPISGRHRVDTCCCSVGVAWGPECDECPEKGTPEYNLLCPRGPGFSQRG-----DFINGKPFLK--DINECKMIHSL-CTNGRCRNTIGSFRCRCDSGYALDSDERNCTGESERKQPL--------------------HQC-------KKDKGDDCGLQKGQAYIDE--CERNPLLCRGGDCINT-EGSFRCQCPPGHEIAPDGSACLDIN--ECELSDKLCRNGQCVNMIGRYQCSCNTGYKSTQDLLSC---------VDIDECTILNGGCETTCTNSE 1167          

HSP 9 Score: 86.2705 bits (212), Expect = 1.534e-16
Identity = 215/943 (22.80%), Postives = 335/943 (35.52%), Query Frame = 1
Query:  364 GYFGEDC-NTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-------YCPKGFTQKENRCDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSC--IKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSD--------ICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVR-YGTSEPLVSRYCSKSEYY-SLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIET---------------ITSQCALNQFQCQGG--------RCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCI-----------------------KNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEK-QVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGR------DCILKIIAV--KSVDIS-------EVSYQNPQSQSFCTRKEIIEKCQP-----GKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            G  G  C +T + STCY    RG C           E CC+  + A+G PC  C           CP G     +   DI+EC     IC NGEC N   +++C C     +D    +C    D+C +    C   G C  T  G +TC C   Y    +   C  I +   N C           +C+    S+ C C +G         CI  S           +C+        +   C + G  +   C+        D  C + +      +    ++ E +  +C  G CV+    + CQC  G     + R CI + T               I+ +  ++   C  G         C E     Y   C RG   S+ G   I  +      + C++    C  G C       + C C  GY+   D + C                        K + Y D C+   +   CRGG C++   S+RC C   +  + +G  C+   + E     L  K     LC+ G+CV+    Y C C  GY +T++   C  I++  +      + C   E                 ++C C  G+    D RSC    +D+C ++ +IC  G+C       ++C+C      S+D  +CL            C++  N   C SG C N +    C C  GY   +    C  + +      +    C           +++C C  G+I   NG  C   +       +C  + +   T          Y C C  G+  + D   C   D+ +CA N   C+ G+C ++  GY C C   +  T +G+      +C    I V  +  +I         + ++  +S   CT  +I E   P     G CV     Y C CP  F+ N     CV
Sbjct:  613 GLDGRTCVDTHMRSTCYGGYKRGQCIQPFFGAVTKSECCCAKVEYAFGEPCQPCPPETSAEFAALCPGGIGSTTDS-KDINECALNPDICQNGECENLLRTYKCNCNQGFEVDSTGKNC-IDIDECSVNRLLCD-NGMCRNTP-GSFTCHCPLGYIFQPDTDVCEDIDECASNPC--------VNADCKNTQGSFSCLCSTGSSLDNSGLQCIETSKGTCWLKIVNALCEVNINGATLKSQCCATLGAAWGSPCSP----CERDPVCPKGHSRVRGSICEDVNECEVFPGVCINGKCVNTLGSFICQCPTGMTVDASGRTCIDLRTEQCYLSHEDERCGAPISGRHRVDTCCCSVGVAWGPECDECPEKGTPEYNLLCPRGPGFSQRGDF-INGKPFLKDINECKMIHSLCTNGRCRNTI-GSFRCRCDSGYALDSDERNCTGESERKQPLHQCKKDKGDDCGLQKGQAYIDECERNPL--LCRGGDCINTEGSFRCQCPPGHEIAPDGSACLDINECE-----LSDK-----LCRNGQCVNMIGRYQCSCNTGYKSTQDLLSCVDIDECTILNGGCETTCTNSEG---------------SYECSCRRGYALMPDQRSCTD--IDECEDSPDICDGGQCTNI-PGEYQCLCFDGFMSSEDLKTCL--------DVDECEL--NPNICLSGKCENTKGSFICHCDLGYSVRKGTTGCTDVNECE----IGAHNCDRHATCTNTPGSFKCSCTPGWIG--NGIQCTDLDECSNGTHLCSSNADCMNT-------MGSYRCVCKEGF--SGDGFFCT--DSDECADNVNLCENGHCLNVAGGYRCECDMGFIPTPDGKACEDIDECTFADICVNGRCQNIPGLFRCECSIGFELDRSGGNCT--DINECADPTTCISGFCVNTPGSYFCNCPPDFQLNPTGVGCV 1478          

HSP 10 Score: 78.9518 bits (193), Expect = 3.035e-14
Identity = 196/850 (23.06%), Postives = 313/850 (36.82%), Query Frame = 1
Query:  532 YCPKGFTQKEN--RCDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGT---SEPLVSRYCSKSEYYSLCE----------GGSCVDLN-----------------NDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICEL-----YGHRCQTGVCYPIYPNEYICACLEGYSQ------SEDRKYCIKNEQYKDYCQNQEISKR--CRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLC----LPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVC-PYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
             C  GF   E+   C D+DEC+   +ICL+G+C N KGSF C C   + + + T  C    ++C++   +C     C  T  G + C C   +    NG  C   T+ + C+    LC    +C     SY C C  GF  S D   C   ++SD C   +    C  G C++   GYRC C+  +    + + C        ++  V+  C        CE          GG+C D+N                   Y+C C   F        C+ I   +  C L+  + +G   + LD +N       G   S+    C   +        C L     Y   C  G  +   P   I   LEG S+      S    + I    Y  +    E  +   C  GQC +   +Y C+C   Y+  N G  C+  +++      LC +  YYS                       AT +G     + K++      SY + + +   C    C    T  F  LC    +  +     G+  D   +D+C N   +C       +   ++RC C P Y  L K         V+T   + YC  + N   C  G C++     RC+C  GYK++     C   ++           C+          +Y C C  G+  S N   CI ++    ++ I       C+ G C+      ++C C  GY+ + D + C+ ++  +CA++   C  G C ++   Y CIC   + + ++           +  DI E +    Q+  FC           G C      ++C CP  F+ +     CV
Sbjct: 1215 LCFDGFMSSEDLKTCLDVDECELNPNICLSGKCENTKGSFICHCDLGYSVRKGTTGCT-DVNECEIGAHNCDRHATCTNTP-GSFKCSCTPGWI--GNGIQC---TDLDECSNGTHLCSSNADCMNTMGSYRCVCKEGF--SGDGFFC---TDSDECA--DNVNLCENGHCLNVAGGYRCECDMGFIPTPDGKACEDIDECTFADICVNGRCQNIPGLFRCECSIGFELDRSGGNCTDINECADPTTCISGFCVNTPGSYFCNCPPDFQLNPTGVGCVDIR--SGNCYLD-VRSRGDASESLDCSNE-----IGVGVSKASCCCSLGQGWGTPCEACPLLNSSEYKSLCPGGEGFRPNPITVI---LEGRSKALCGFCSVIYIFFIFLYSYASFSDINECQEPGICGPGQCYNTIGNYTCICPPDYMQVNGGNNCMDMRRS------LCYR-NYYS---------------------DNATCDGELTFNMTKKMCC---CSYNIGRAWNKPCE--PCPVSGTSEFAILCGSDRIGYYIDIYTGQVID---IDECQNGP-VCQQNAVCLNLPGSYRCDCKPGYLILIK-------YLVSTVNISVYC--VENPNVCNPGQCIDMVGSYRCLCPSGYKTTTAPAMCVDRDECEREQPCGNGTCKNTV------GSYSCLCYPGFQLSHN-IDCIDTDECATQRGI-------CRNGDCFNT-VGSFVCVCRQGYELSLDGRFCVDIN--ECALSPGTCGPGTCQNLDGSYRCICNTGHYLKDD-----------RCEDIDECA----QAPDFCIF---------GTCQNTPGSFKCICPEGFQLSSSGRRCV 1952          

HSP 11 Score: 74.7146 bits (182), Expect = 6.234e-13
Identity = 220/1005 (21.89%), Postives = 351/1005 (34.93%), Query Frame = 1
Query:  325 KGQCQNG----KCICESGYF----GEDCNTAIISTCYVKI--DRGLCKSTPENLQLSKEECCSIFQV--AWGNPC------------VFCDRNYCPKGFTQKENRCDDIDECQFKSICL-NGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAER---CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEG----GSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK------------NEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNN--------------------------GQECVRYKQTEPPAVRLCSKWEYYS---LCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLI---NYVTTEPTTKYCDI-LVNRLRCASGNCVND----------------------RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQP-GKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCP---YCFYGCFDENSISTCSCSENYENLFDTGLCI 3030
             GQC N      CIC   Y     G +C     S CY     D   C        ++K+ CC  + +  AW  PC            + C  +           +  DIDECQ   +C  N  C+N  GS+RC C P + +    +          +   +    G+C+    G Y C+C   Y  +     C+ +         ++     G C+    SY C C  GF  S          N D   + E A +   CR G C +    + C+C              R G    L  R+C      +L  G    G+C +L+  Y C C+ G Y  ++R  C  I+    +CA     C  G CQ    + ++C C  GF  S +GR C+     R S    +    RC          +   C+ + G    +  + C                +  D C+   I   C+ GQC++    +RC C   Y   ++                          G EC   +  EP  +  C      S   L     CV+T  +Y CKC  GY   E+ R C + + +  +E D+  C  +    + + G         + C+C  G+T   +G  C    +++C     IC  GRCE +  S +RC C      S     C      +  TE     C +   NR+      C  D                       C  GPGY +  DG++  + + + ++C   +            + +Y+C C +GY    +G  C+  +  +     C+         IC  + +  Y C+C  GY    D+KSC  +D  +C+  ++ C+   C + + G+ C C   +T                 +D +E +                  C P G C      + C+C   F  +     C  D ++C     C +GC +      C+C + Y   +    C+
Sbjct: 1597 PGQCYNTIGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYSDNATCDGE-LTFNMTKKMCCCSYNIGRAWNKPCEPCPVSGTSEFAILCGSDRIGYYIDIYTGQVIDIDECQNGPVCQQNAVCLNLPGSYRCDCKPGYLILIKYLVSTVNISVYCVENPNVCNPGQCIDMV-GSYRCLCPSGYKTTTAPAMCVDRDECE-----REQPCGNGTCKNTVGSYSCLCYPGFQLSH---------NIDCIDTDECATQRGICRNGDCFNTVGSFVCVC--------------RQGYELSLDGRFCVDINECALSPGTCGPGTCQNLDGSYRCICNTGHYLKDDR--CEDID----ECAQAPDFCIFGTCQNTPGS-FKCICPEGFQLSSSGRRCVDM---RVSFCYTKFENGRCVAPKPLNTTKSHCCCSMMPGQGWGDPCEICPNMTDVGVPYGTGDTPEDIDECKEPGI---CKNGQCINTDGGFRCECPTGYSLDSSRVNCTDTDECKDGNPCGNGTCNNVFGGFECTCDEGFEPGPMMTCEDINECSQNPLLCAFRCVNTYGSYECKCPTGYVLREDRRMC-KDQDECADEVDD--CQSRGMTCKNLIGT--------YMCICPQGYTRQPNGEGC--MDLNECTAKPGICENGRCENTVGS-YRCRCETGFEPSPTQTECYDIRRGFCFTEVLQTMCQMGSSNRVSVTKSECCCDGGRGWGASCELCPLPGTTHYKRMCPQGPGYTT--DGQDINECKVMGNLCQKGRCVNT--------EGSYKCVCNSGYTTDISGTICVDVDECVQAPKPCNF--------ICKNV-EGGYQCSCPRGYILQEDRKSCRDLD--ECSTKQHNCQF-LCVNTIGGFTCKCPPGFTQHH-----------TACIDNNECNTDP-------------GLCGPNGMCQNSPGSFNCECQRGFSLDQNGQHC-EDMDECDGNHRCQHGCQNLVGGYRCNCPQGYLQHYQWNQCV 2497          

HSP 12 Score: 63.1586 bits (152), Expect = 2.164e-9
Identity = 99/438 (22.60%), Postives = 165/438 (37.67%), Query Frame = 1
Query: 1927 CMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSES------------------ALIKKSICDLHREKCKTG----ICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC---PYCFYGCFDENSISTCSCSENYENLFDTGLCIIKSDEIS--YSLGDSTCRTKSLNRTLNIKFSGIFKFSTGSP 3147
            C  G+C+ +    + C C  GF + +    C  + +D+C+ N  IC  GRC  +  S F CVC     +S DG +C             C I   R  C +G C+ND    +CIC  GY     G+ C  +++  +                  + ++ C+C+ G     +GR+C+ +                      + KS C   + +   G     C P    ++   C  G    TD K     D  +CA+N   C+ G C +++  Y C C   + V   G++CI         DI E           C+   ++  C  G C      + C CP  +     D +   D ++C   P     C +     +C CS    +L ++GL  I++ + +    + ++ C       TL  +       + GSP
Sbjct:  477 CAHGQCM-NTAGSYYCQCPAGFQTTATRTEC--KDLDECVANGRICNNGRCVNTEGS-FHCVCNSGFEISPDGKNCQ--------DMDECQI---RNMCLNGMCINDDGSFKCICKSGYLLDGTGRYCIDVDECVNT-----------------EGSFRCECVAGLAVGLDGRTCVDTHMRSTCYGGYKRGQCIQPFFGAVTKSECCCAKVEYAFGEPCQPCPPETSAEFAALCPGGIGSTTDSK-----DINECALNPDICQNGECENLLRTYKCNCNQGFEVDSTGKNCI---------DIDE-----------CSVNRLL--CDNGMCRNTPGSFTCHCPLGYIFQ-PDTDVCEDIDECASNPCVNADCKNTQGSFSCLCSTG-SSLDNSGLQCIETSKGTCWLKIVNALCEVNINGATLKSQCCATLGAAWGSP 853          

HSP 13 Score: 54.6842 bits (130), Expect = 7.291e-7
Identity = 55/187 (29.41%), Postives = 80/187 (42.78%), Query Frame = 1
Query:  289 NNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYN 849
            N   LC++N        + +C+C+ G+ G+          +   D   C    +N+ L +   C    VA G  C  CD  + P   T     C+DIDEC F  IC+NG C N  G FRC+C     LD +  +C    D  +    +  I G CV T  G Y C C   + ++  G  C+   + N
Sbjct: 1320 NGTHLCSSNADCMNTMGSYRCVCKEGFSGDG---------FFCTDSDECA---DNVNLCENGHC--LNVAGGYRCE-CDMGFIP---TPDGKACEDIDECTFADICVNGRCQNIPGLFRCECSIGFELDRSGGNCT---DINECADPTTCISGFCVNTP-GSYFCNCPPDFQLNPTGVGCVDIRSGN 1484          
BLAST of Fibrillin-2 vs. Ensembl Cavefish
Match: fbn2a (fibrillin 2a [Source:ZFIN;Acc:ZDB-GENE-090112-4])

HSP 1 Score: 133.265 bits (334), Expect = 7.166e-31
Identity = 227/985 (23.05%), Postives = 348/985 (35.33%), Query Frame = 1
Query:  301 LCTNNCSNKG-QCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRN-YCPKGFTQKENR-CDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-----------------------QYRRDQC-----QLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNY---NVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI-----------------VNSNSDI-----------------CQSPEIAER----CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIE-------------------------------------TITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISS----NNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKS--ICDLHRE---KCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            LC NN  +   +C  G  +  +G     C  ++  TC++ I  G C+       L + ECC+    AWG+PC  C+ +  C +GF +     C+D++EC+ F  +C NG C+N +GSF+CQC     LD     C                       ++R D C       +G  C     C      +Y  +C +    +  G     +  Y   N C  F  +C  +G C+    S+ C C  GF    ++++C                  VN+                     C   +  ER    CRGGSC +    Y+C+C   +Q   +   C      E   +          LC  G CV++   Y+C CS G+ +T +R+ C  I+                                     T   +C      C GG+C  +    Y C C  GF  S   +SCI           CEL  + C  G C       +IC C  GYS  +    C   ++ +    N +     R   CV+   S+ C C   +I +    ++  EC+R      P                GECV+T  ++ C C  GY    +G  CS I++              +    C  G+C+ +    ++C C  GF S  D R+C  + +D+C   + IC  G CE    + FRCVC     L++ G +C              D  ++ + C +G+CVN      C C   ++ +  G  C                                  L    +   G +C       + +S   C L R     C+   C P+  +DY   C  G     +  + I+ D  +C      C+GG C +    + C C G Y +  + R C          DI E    NP              C PG C     +Y C CP  +
Sbjct:  718 LCKNNAGSFACECSPGSKVDPTGLI---CIDSLKGTCWLTIQEGRCEVNINGGTL-RSECCATLGAAWGSPCEPCEIDPVCQRGFARPRGTICEDVNECEVFPGVCPNGRCVNTRGSFKCQCSEGLTLDSTGRICVDIRLEHCYLTYDEDECVQPVSGRFRMDACCCTVGAAWGKECE---ACPEPGTREYEALCPRGPGFANRGDVLTGRPVYKDINECKVFPSICA-HGTCRNTIGSFRCRCNGGFALDAEERNCTDIDECKISPDLCGHGACVNTPGSFECDCLPGYESGFMMMKNCMDIDECERNPGLCRGGSCKNTEGSYQCVCPPGHQLSTDGDACEDVNECELSAT----------LCRNGECVNVAGTYHCSCSTGYQSTPDRKGCTDIDECTIENGGCDLLCTNSEGSYTCSCGQRYALMPDLRSCTDVDECEEEPDICDGGQCTNVP-GEYHCLCYDGFTSSMTTKSCIDVNE-------CELNSNICMFGECENTK-GSFICHCEVGYSVKKGSSGCTDIDECQIDAHNCD-----RNANCVNIPGSFSCTCMEGWIGNGVKCDDVDECIRGTHQCSPD---------------GECVNTPGSFRCACTEGYKG--DGFTCSDIDE------------CADSTHMCENGQCL-NIPGSYQCECEIGFISDPDSRTC--QDIDEC-TFQVICVFGLCENLPGA-FRCVCDEGYELNRSGINC-----------TDVDECLDPINCVNGHCVNTPGSYECNCPTDFELNPTGIGCVDPRVGFCF-------------------------LEAVPRGRGGLACSVEVGVGVSRSSCCCSLGRAWGNPCEG--CPPVNTSDYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCVNTFGSFQCDCPGGYYLNADSRIC---------EDIDECVV-NPG------------ICGPGTCYNTLGNYTCVCPQEY 1576          

HSP 2 Score: 117.472 bits (293), Expect = 4.691e-26
Identity = 236/1033 (22.85%), Postives = 368/1033 (35.62%), Query Frame = 1
Query:  340 NGKCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQV--AWGNPCVFCDR-----------NYCPKGF--TQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKT----NYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNN---------------------------------------NYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQ--YKDYC------------------QNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENIC-TPGRCERSGNSNFRCVCPYYASLSKDGHSCLI-NYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKK---------------SICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPG------KCVEKQE-------------------DYQCKCPHSFKTNYYDHECVRDSNKCP---YCFYGCFDENSISTCSCSENYENLFDTGLCIIKSD 3042
            N  C+C   Y     G +C     S C+   +   C++      ++   CC  + +  AW  PC  C R           N  P GF    +  +  DIDEC +   IC +G CIN+ GSFRC+CP     ++  + C+   D+C      C     C+  S G Y C C + + +S  G +CI +     N N+C++ K + +P G        Y C+C +GF  + ++K C+   + D C    + + C+ G+C +    Y CLCN  ++   N+Q       S P          Y  LC  G C++    + C C EG+  T + + CI +    ++C +    C  G CQ LD +                                       ++EC C  GF+ S+NGR C     TR S         +C     +        C+ +         + C K  +  ++D C                  +  E    C  G C++   S+RC C   Y  +  G  CV     E      C      ++  G EC    N           A E+  +C +              LL  +       RCI +   G++C C  G+T   DGR C  + +D+C+   + C T G   ++    F C+CP       D   C   N   T+P             C +G CVN      C CG G++      +C    +      + Q  CQ            +C C  G+        C    +A  KK                 C +  + CK G C       Y C C  GY  +    +C+ +D  +CA++   C    C +    Y C C   Y + E+ R C       K +D  +V   N Q     T      KC PG       C++  E                    + C+C   F  +     C  D N+C     C +GC +      C+C + Y   +    C+ +++
Sbjct: 1567 NYTCVCPQEYMQVNGGNNCMDMRKSLCFRNYNGTACENELA-FNITHRICCCAYNMGKAWNKPCQACPRPGTEGFRTLCGNIVP-GFEIDIETGKPVDIDECNEIPGICASGVCINQIGSFRCECPRGFSYNDVLLICE-DIDECSSSEILCQRNADCI-NSPGSYRCECSEGFKLSPIG-ACIDRNECLENPNLCSHGKCVDMPGG--------YICTCNTGFKATPNRKMCM---DIDEC----VRQPCKNGTCKNTVGSYNCLCNAGFELTLNNQCTDVDECSGP----------YSQLCRNGQCMNSVGSFQCLCDEGYELTLDGKNCIDV----NECLILPGTCAPGTCQNLDGSFRCLCPKGYTVQDDHCVDVNECEEDPNICLFGSCFNNPGSFECVCKPGFVLSDNGRRCYD---TRVSFCFTRFENGKCSIPQAFNTTKARCCCSAMPKEGWGYPCELCPKEHEAGFRDLCPFGVGIIPGIDDTSVDVNECVENPGICHNGHCINTDGSFRCECPMGYTLNYTGVHCVDVD--ECAVGNPCGNGTCTNVIGGFEC----NCEEGFEPGPMMACEDINECGQNP------------LLCAF-------RCI-NTFGGYECSCPSGYTLREDGRMC--QDLDECVEGLHDCDTRGMTCKNLIGTFMCICPPGMVRRMDDELCQDENECRTKPGI-----------CENGRCVNTIGSYMCECGEGFQPDPTHTQCLDYRQGFCFTEVLQTMCQMSSSSRTAITKSQCCCDGGHGWGNQCELCPLPGTAKYKKLCPHGHGYATDGTDIDECKVIPDVCKNGRCINT-MGSYRCHCNSGYTASIAGTACVDLD--ECAMSPKPCNF-ICKNTEGSYACSCPRGYILQEDSRSC-------KDLDECQVKRHNCQFMCVNTIGGFTCKCPPGFTQHHTACIDHNECAAEPSLCGAKGLCQNSPGSFSCECQRGFSLDTSGLHC-EDVNECDSNHRCQFGCENMLGGYRCNCPQGYTQHYQWNQCVDENE 2511          

HSP 3 Score: 112.849 bits (281), Expect = 1.376e-24
Identity = 213/891 (23.91%), Postives = 332/891 (37.26%), Query Frame = 1
Query:  535 CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERC-RGGSCVSEGKGYRCLCNGEYQGY----NNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGEC--VDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEE------------PDNSYCLL------QEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL--------INYVTTEPTTKYCDILVNRLRCAS---GNCVNDRC-------------ICG---PGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY---CFYG-CFDENSISTCSCSENYENLFDTGLCI 3030
            C  G+    +R  C DIDEC  ++   +  C N +GS+ C C   + L  +  SC    D+C+     C   G+C     G+Y C+C   ++ S   KSCI   + N C     +C+ +GEC+    S+ C C  G+   +    C     +DI +    A  C R  +CV+    + C C   + G     ++  EC+R GT +      CS          G CV+    + C C+EG+    +   C  I+    +CA +   C+ G+C  +  + Y+C+C  GFI   + R+C   +           +   C  G+C  + P  + C C EGY  +     C   ++  D          C  G CV+   SY C C   +  +  G  CV       P V  C   E     +GG    V+                  G  C       T +            P+    +L      QE    C GG C+   T+G F+C C  G+   +D R C  E +D+C+ N  IC PG C  +   N+ CVCP        G++C+         NY  T    +    + +R+ C +   G   N  C             +CG   PG++   +  +   I++ + I  +                ++ C+C  G+  ++    C   +     + +C  + +   +          Y C C  G+K  +   +CI  D  +C  N   C  G C D+  GY+C C   +  T N + C+         DI E           C R    + C+ G C      Y C C   F+    +     D    PY   C  G C +      C C E YE   D   CI
Sbjct: 1080 CSTGYQSTPDRKGCTDIDECTIENGGCDLLCTNSEGSYTCSCGQRYALMPDLRSCT-DVDECEEEPDICD-GGQCT-NVPGEYHCLCYDGFTSSMTTKSCI---DVNECELNSNICM-FGECENTKGSFICHCEVGYSVKKGSSGC-----TDIDECQIDAHNCDRNANCVNIPGSFSCTCMEGWIGNGVKCDDVDECIR-GTHQ------CSPD--------GECVNTPGSFRCACTEGYKG--DGFTCSDID----ECADSTHMCENGQCLNIPGS-YQCECEIGFISDPDSRTCQDIDEC--------TFQVICVFGLCENL-PGAFRCVCDEGYELNRSGINCTDVDECLD-------PINCVNGHCVNTPGSYECNCPTDFELNPTGIGCVD------PRVGFCF-LEAVPRGRGGLACSVEVGVGVSRSSCCCSLGRAWGNPCEGCPPVNTSDYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCV--NTFGSFQCDCPGGYYLNADSRIC--EDIDECVVNPGICGPGTCYNT-LGNYTCVCPQEYMQVNGGNNCMDMRKSLCFRNYNGTACENELAFNITHRICCCAYNMGKAWNKPCQACPRPGTEGFRTLCGNIVPGFEIDIETGKPVDIDECNEIPGICASGVCINQI-----GSFRCECPRGFSYNDVLLICEDIDECSSSEILCQRNADCINS-------PGSYRCECSEGFK-LSPIGACI--DRNECLENPNLCSHGKCVDMPGGYICTCNTGFKATPNRKMCM---------DIDE-----------CVR----QPCKNGTCKNTVGSYNCLCNAGFELTLNNQCTDVDECSGPYSQLCRNGQCMNSVGSFQCLCDEGYELTLDGKNCI 1869          

HSP 4 Score: 103.605 bits (257), Expect = 9.304e-22
Identity = 193/773 (24.97%), Postives = 290/773 (37.52%), Query Frame = 1
Query:  535 CPKGFTQKENR--CDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQ-YRRDQC--QLYGSSCGI----------------FGKCV---------PTSDGQYT-CICIKP-YSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKC--SRIEKQVTEEPDNSYCLLQEYLSRCMGGRC----IGDKTYGFKCLCLP---------------GFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGN-CVNDRC--ICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCIC 2682
            CP G+    +   C+DIDEC     IC  G C N  G++ C CP ++       +C   R+  C     G++C                   GK           P ++G  T C  I P + +        K  + + CN    +C   G C     S+ C CP GF  ++     ++  + D C S EI  + R   C++    YRC C+   +G+           +E L        E  +LC  G CVD+   Y C C+ GF AT NR+ C+ I+    Q       C+ G C+     +Y C C  GF  + N + C   +           Y   C+ G C       + C C EGY  + D K CI      D  +   +   C  G C +   S+RC+C   Y   ++   CV   + E          E  ++C  G C +   ++ C C  G+  ++NGR+C  +R+    T   +N  C + +  +     RC    +  + +G+ C   P               G     D  S D   V++C+ N  IC  G C  +  S FRC CP   +L+  G  C                 V+   CA GN C N  C  + G    + E+G E   +     I    Q               YEC C +GY   E+GR C   +  +     CD     CK  I        ++C C  G  +  D + C   D  +C      C+ G C + +  Y+C C
Sbjct: 1530 CPGGYYLNADSRICEDIDECVVNPGICGPGTCYNTLGNYTCVCPQEYMQVNGGNNCMDMRKSLCFRNYNGTACENELAFNITHRICCCAYNMGKAWNKPCQACPRPGTEGFRTLCGNIVPGFEIDIETG---KPVDIDECNEIPGICA-SGVCINQIGSFRCECPRGFSYND---VLLICEDIDECSSSEILCQ-RNADCINSPGSYRCECS---EGFKLSPIGACIDRNECL--------ENPNLCSHGKCVDMPGGYICTCNTGFKATPNRKMCMDIDECVRQ------PCKNGTCKNT-VGSYNCLCNAGFELTLNNQ-CTDVDECSGP------YSQLCRNGQCMNSV-GSFQCLCDEGYELTLDGKNCI------DVNECLILPGTCAPGTCQNLDGSFRCLCPKGYTVQDD--HCVDVNECE----------EDPNICLFGSCFNNPGSFECVCKPGFVLSDNGRRCYDTRVSFCFTRF-ENGKCSIPQAFNT-TKARCCCSAMPKEGWGYPCELCPKEHEAGFRDLCPFGVGIIPGIDDTSVD---VNECVENPGICHNGHCINTDGS-FRCECPMGYTLNYTGVHC-----------------VDVDECAVGNPCGNGTCTNVIGGFECNCEEGFEPGPMMACEDINECGQNPLLCAFRCINTFGGYECSCPSGYTLREDGRMCQDLDECVEGLHDCDTRGMTCKNLI------GTFMCICPPGMVRRMDDELC--QDENECRTKPGICENGRCVNTIGSYMCEC 2219          

HSP 5 Score: 102.449 bits (254), Expect = 1.862e-21
Identity = 192/820 (23.41%), Postives = 303/820 (36.95%), Query Frame = 1
Query:  535 CPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLD-----ENTMSCQYRR----DQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVC--NYFKKLCL-------------------PYGE-CQP----YGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICE-----------LYGHRCQT-GVCY--PIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ------------TEPPAVR---------LCSKW-------------EYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVC-PYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            C  GF +   +  C D DEC   ++CLNG CINE+GSF+C C     L      E  MS  +      D+C   G    + G+C+ T +G Y C C+   +V  +G+SC+     + C     K +C+                    +GE CQP        +   CPSG   + D         +DI +     + C  G+C +   GYRC+CN    GY  DQ    Y   E  V+R         LC+ G C ++   Y C C +G+   ++   C  +    S   +N      G C+  +  ++ C+C  G      G  CI + +     +I E           L    C T G  +  P  P E    C  G+++        +    +D  + +     C  G+CV+   S++C C       + G+ CV  +              +P + R         + + W             EY +LC  G                      GR    + K + E         + + S C  G C  +    F+C C  GF   ++ R+C    +D+C  + ++C  G C  +  S F C C P Y S    G   + N +  +   +      N   C  G+C N     +C+C PG++ S DG  C  + +     +L +               Y C C  GY  + + + C   +   I+   CDL              +  Y C+C   Y    D +SC  +D  +C      C GG C ++   Y C+C   +T +   + CI
Sbjct:  447 CHTGFHRPPGKQACFDHDECTSTNMCLNGMCINEEGSFKCVCKHGFTLASKKCFECYMSAIWLFFVYIDECLTPGIC--LHGRCINT-EGSYRCECLAGLAVGPDGRSCVDTHMRSTCYGAIKKGVCVRPFQAAVTRSACCCASASYSFGEPCQPCPTLDSAEFNALCPSGTGYAID--------GTDINECAMDPDICPNGACENLRGGYRCICN---IGYETDQSGRSY-VDECFVNRL--------LCDNGLCRNVPGSYTCTCPKGYSYRQDSETCEDVNECESSPCIN------GLCKN-NAGSFACECSPGSKVDPTGLICIDSLKGTCWLTIQEGRCEVNINGGTLRSECCATLGAAWGSPCEPCEIDPVCQRGFARP-------RGTICEDVNECEVFPGVCPNGRCVNTRGSFKCQCSEGLTLDSTGRICVDIRLEHCYLTYDEDECVQPVSGRFRMDACCCTVGAAWGKECEACPEPGTREYEALCPRGP-----------GFANRGDVLTGRP---VYKDINE--------CKVFPSICAHGTCR-NTIGSFRCRCNGGFALDAEERNCTD--IDECKISPDLCGHGACVNTPGS-FECDCLPGYES----GFMMMKNCMDIDECER------NPGLCRGGSCKNTEGSYQCVCPPGHQLSTDGDACEDVNECELSATLCRNGECVNVA-----GTYHCSCSTGYQSTPDRKGCTDIDECTIENGGCDLLCTN---------SEGSYTCSCGQRYALMPDLRSCTDVD--ECEEEPDICDGGQCTNVPGEYHCLCYDGFTSSMTTKSCI 1177          

HSP 6 Score: 100.908 bits (250), Expect = 5.359e-21
Identity = 244/1001 (24.38%), Postives = 358/1001 (35.76%), Query Frame = 1
Query:  310 NNCSNKGQCQNGKCICESGYFGEDC--------------NTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKC--VPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCR----GGS-----CVSEGKGYRCLCNGEYQGYNNDQECVR-YGTSEPLVSRYCSKSEYY-SLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKI---------------ETITSQCALNQFQCQGG--------RCQELDNNNYECQCLRGFIRSENG---------------------------RSCIKAER------------TRNSTSI--CELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEE-------------------------PDNSYCL----LQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            + C   G C +G+CI   G +  +C              +T + STCY  I +G+C    +        CC+    ++G PC  C           CP G T       DI+EC     IC NG C N +G +RC C   +  D++  S     D+C +    C   G C  VP   G YTC C K YS   + ++C    + N C     +    G C+    S+ C C  G         CI +S    C       RC     GG+     C + G  +   C    +    D  C R +      +    ++ E +  +C  G CV+    + CQCSEG       R C+ I               + ++ +  ++   C  G         C E     YE  C RG   +  G                           R+ I + R             RN T I  C++    C  G C    P  + C CL GY   E     +KN    D C+       CRGG C +   SY+CVC   +  S +G  C    + E  A          +LC+ GECV+    Y+C C  GY +T + + C+ I++   E                          PD   C      +E    C GG+C  +    + CLC  GFTS+   +SC    V++C  N NIC  G CE +  S F C C    S+ K    C  +    +     CD         + NCVN      C C  G+    +G +C  +++          QC   G       ++ C C  GY    +G +C   +        C      C+ G C  I    Y C C +G+    D ++C  +D       +  C  G C ++   + C+C   Y +  +G +C          D+ E    +P +            C  G CV     Y+C CP  F+ N     CV
Sbjct:  515 DECLTPGICLHGRCINTEGSYRCECLAGLAVGPDGRSCVDTHMRSTCYGAIKKGVCVRPFQAAVTRSACCCASASYSFGEPCQPCPTLDSAEFNALCPSG-TGYAIDGTDINECAMDPDICPNGACENLRGGYRCICNIGYETDQSGRS---YVDECFVNRLLCD-NGLCRNVP---GSYTCTCPKGYSYRQDSETC---EDVNECESSPCI---NGLCKNNAGSFACECSPGSKVDPTGLICI-DSLKGTCWLTIQEGRCEVNINGGTLRSECCATLGAAWGSPC----EPCEIDPVCQRGFARPRGTICEDVNECEVFPGVCPNGRCVNTRGSFKCQCSEGLTLDSTGRICVDIRLEHCYLTYDEDECVQPVSGRFRMDACCCTVGAAWGKECEACPEPGTREYEALCPRGPGFANRGDVLTGRPVYKDINECKVFPSICAHGTCRNTIGSFRCRCNGGFALDAEERNCTDIDECKISPDLCGHGACVNT-PGSFECDCLPGY---ESGFMMMKNCMDIDECERN--PGLCRGGSCKNTEGSYQCVCPPGHQLSTDGDACEDVNECELSA----------TLCRNGECVNVAGTYHCSCSTGYQSTPDRKGCTDIDECTIENGGCDLLCTNSEGSYTCSCGQRYALMPDLRSCTDVDECEEEPDICDGGQCT-NVPGEYHCLCYDGFTSSMTTKSCID--VNECELNSNICMFGECENTKGS-FICHCEVGYSVKKGSSGC-TDIDECQIDAHNCD--------RNANCVNIPGSFSCTCMEGWIG--NGVKCDDVDEC----IRGTHQCSPDGECVNTPGSFRCACTEGY--KGDGFTCSDIDE-------CADSTHMCENGQCLNI-PGSYQCECEIGFISDPDSRTCQDIDE---CTFQVICVFGLCENLPGAFRCVCDEGYELNRSGINC---------TDVDEC--LDPIN------------CVNGHCVNTPGSYECNCPTDFELNPTGIGCV 1425          

HSP 7 Score: 99.7525 bits (247), Expect = 1.313e-20
Identity = 246/1054 (23.34%), Postives = 369/1054 (35.01%), Query Frame = 1
Query:  307 TNNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKI---DRGLCKSTPENLQLSKE----------ECCSIFQVAWGNPCVF--CD------RNYCPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIE-------------------TITSQ---CALNQFQCQGGRCQELDNNNYEC------QCLRGF-IRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYC----------------------------LLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYP---------IGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKC------QPG--------------------KCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTCRTKSLNRT 3099
            T+ CS  G+C N     +C C  GY G+    + I  C       + G C + P + Q   E           C  I +  +   CVF  C+      R  C +G+    +   C D+DEC     C+NG C+N  GS+ C CP D  L+   + C   R            F + VP   G   C       V  +  SC        C+  +    P   C P   S Y +   G          I+  + D CQ  E+   C+GG+CV+    ++C C G Y  Y N    +     E +V+          +C  G+C +   +Y C C + +        C+ +                     IT +   CA N  +     CQ       E         + GF I  E G+     E        C      C +GVC       + C C  G+S ++    C    +  D C + EI  + R   C+++  SYRC C   +  S  G    R +  E P           +LC  G+CVD    Y C C  G+ AT N + C  I++ V +   N  C                                Y   C  G+C+ +    F+CLC  G+    DG++C    V++CL     C PG C+    S FRC+CP   ++ +D H   +N    +P             C  G+C N+     C+C PG+  S++G+ CY   +VS                              + + ENG+  I       K   C     K   G  YP          G  D +C   +G     D  S   +D  +C  N   C  G+C +    + C C   YT+   G  C         VD+ E +  NP     CT      +C      +PG                    +C+     Y+C CP  + T   D    +D ++C    + C  +    TC      +NL  T +CI     +   + D  C+ ++  RT
Sbjct: 1269 THQCSPDGECVNTPGSFRCACTEGYKGDGFTCSDIDECADSTHMCENGQCLNIPGSYQCECEIGFISDPDSRTCQDIDECTFQVICVFGLCENLPGAFRCVCDEGYELNRSGINCTDVDECLDPINCVNGHCVNTPGSYECNCPTDFELNPTGIGCVDPRVG--------FCFLEAVPRGRGGLACS--VEVGVGVSRSSC-------CCSLGRAWGNPCEGCPPVNTSDYNTLCPGGEGFRPNPITIILEDIDECQ--ELPGLCQGGNCVNTFGSFQCDCPGGY--YLNADSRICEDIDECVVNP--------GICGPGTCYNTLGNYTCVCPQEYMQVNGGNNCMDMRKSLCFRNYNGTACENELAFNITHRICCCAYNMGKAWNKPCQACPRPGTEGFRTLCGNIVPGFEIDIETGKPVDIDE--------CNEIPGICASGVCINQI-GSFRCECPRGFSYNDVLLIC----EDIDECSSSEILCQ-RNADCINSPGSYRCECSEGFKLSPIGACIDRNECLENP-----------NLCSHGKCVDMPGGYICTCNTGFKATPNRKMCMDIDECVRQPCKNGTCKNTVGSYNCLCNAGFELTLNNQCTDVDECSGPYSQLCRNGQCM-NSVGSFQCLCDEGYELTLDGKNCID--VNECLILPGTCAPGTCQNLDGS-FRCLCPKGYTV-QDDHCVDVNECEEDPNI-----------CLFGSCFNNPGSFECVCKPGFVLSDNGRRCYDT-RVSFC----------------------------FTRFENGKCSIPQAFNTTKARCCCSAMPK--EGWGYPCELCPKEHEAGFRD-LCPFGVGIIPGIDDTS---VDVNECVENPGICHNGHCINTDGSFRCECPMGYTLNYTGVHC---------VDVDECAVGNPCGNGTCTNVIGGFECNCEEGFEPGPMMACEDINECGQNPLLCAFRCINTFGGYECSCPSGY-TLREDGRMCQDLDECVEGLHDC--DTRGMTC------KNLIGTFMCICPPGMVR-RMDDELCQDENECRT 2198          

HSP 8 Score: 92.8189 bits (229), Expect = 1.627e-18
Identity = 203/902 (22.51%), Postives = 332/902 (36.81%), Query Frame = 1
Query:  322 NKGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENL-QLSKEECCSIFQVAWGNPCVFCDRNYCPKGF-TQKENRCDDIDECQ--FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTS----DGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSC--------IVNSNSDICQSPEIAERCRGGSCVS----EGKGYRC-LCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYY---SLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ--TEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKG-GYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            N   C +GKC+   G +   CNT   +T     +R +C    E + Q  K   C     ++           C  GF     N+C D+DEC   +  +C NG+C+N  GSF+C C   + L  +  +C    ++C +      + G C P +    DG + C+C K Y+V  +   C+   + N C     +CL +G C     S+ C C  GF  S++ + C             +  C  P+     +   C S    EG GY C LC  E++    D      G    +       +E      +C  G C++ +  + C+C  G+        C+ ++    +CA+    C  G C  +    +EC C  GF       +C        +  +C     RC            Y C+C  GY+  ED + C    Q  D C         RG  C +   ++ C+C    +   + + C    +  T+P             +C+ G CV+T  +Y C+CG G+       +C    +         +C  +   + C             +C C  G             + +QC           C   G + ++ +CP+       GH     Y T       C ++ +   C +G C+N     RC C  GY +S  G  C  +++ +                +  + +Y C C  GYI  E+ RSC   +        C + R  C+      IG   + C C  G+ Q     +CI  D+ +CA     C   G C +    + C C   +++  +G  C          D++E    +              +CQ G C      Y+C CP  +  +Y  ++CV D N+C
Sbjct: 1753 NPNLCSHGKCVDMPGGYICTCNTGFKAT----PNRKMCMDIDECVRQPCKNGTCKNTVGSY--------NCLCNAGFELTLNNQCTDVDECSGPYSQLCRNGQCMNSVGSFQCLCDEGYELTLDGKNC-IDVNECLI------LPGTCAPGTCQNLDGSFRCLCPKGYTVQDD--HCV---DVNECEEDPNICL-FGSCFNNPGSFECVCKPGFVLSDNGRRCYDTRVSFCFTRFENGKCSIPQAFNTTKARCCCSAMPKEGWGYPCELCPKEHEAGFRDLCPFGVGIIPGIDDTSVDVNECVENPGICHNGHCINTDGSFRCECPMGYTLNYTGVHCVDVD----ECAVGN-PCGNGTCTNVIGG-FECNCEEGF-EPGPMMACEDINECGQNPLLCAF---RCINTF------GGYECSCPSGYTLREDGRMC----QDLDECVEGLHDCDTRGMTCKNLIGTFMCICPPGMVRRMDDELCQDENECRTKP------------GICENGRCVNTIGSYMCECGEGFQPDPTHTQCLDYRQ--------GFCFTEVLQTMCQMSSSSRTAITKSQCCCDGGHG-----------WGNQCE---------LCPLPGTAKYKKLCPH-------GHG----YATDGTDIDECKVIPDV--CKNGRCINTMGSYRCHCNSGYTASIAGTACVDLDECA------MSPKPCNFICKNTEGSYACSCPRGYILQEDSRSCKDLDE-------CQVKRHNCQFMCVNTIG--GFTCKCPPGFTQ--HHTACI--DHNECAAEPSLCGAKGLCQNSPGSFSCECQRGFSLDTSGLHC---------EDVNECDSNH--------------RCQFG-CENMLGGYRCNCPQGYTQHYQWNQCV-DENEC 2512          

HSP 9 Score: 86.6557 bits (213), Expect = 1.273e-16
Identity = 191/866 (22.06%), Postives = 305/866 (35.22%), Query Frame = 1
Query:  526 RNYCPKGF-TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYF--------KKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVS--EGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGEC-VDTXXXXXXXXXXXXXATENGRKCSRIE-----KQVTEEPDNSYCL----LQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFR---CVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSED---GKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQA-TDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY----CFYGCFDENSISTCSCSENYENLFDTGLC 3027
            R  C  GF       C DIDEC     C NG+C+N  GSF C+C    +      +C +  D+C    ++  + G C+   +G + C+C   ++++   K C +     +  +F          +CL +G C     SY C C +G     D +SC+       C         + G CV   +    R  C      Y+  + C    T +         +E+ +LC  G+                YA +         T  ++CA++   C  G C+ L    Y C C  G+   ++GRS +           C +    C  G+C  + P  Y C C +GYS  +D + C           N+  S  C  G C +N  S+ C C         G  C+              K   +   Q G C V+ N                G  C   E     ++    P  + C      + +   C  GRC+  +   FKC C  G T  S GR C    ++ C    +      C +  +  FR   C C   A+  K+  +C       EP T+  + L  R               GPG+ +  D   G+  YK      +                   ++ C+C  G+      R+C   +        C +  + C  G C       + C C+ GY+      K+C+ +D  +C  N   C+GG C +    Y C+C   + ++ +G  C       + V+  E+S                  C+ G+CV     Y C C   +++   D +   D ++C      C   C +     TCSC + Y  + D   C
Sbjct:  405 RCECNAGFRVDSLGECSDIDEC-VSDPCTNGDCVNTAGSFYCKCHTGFHRPPGKQAC-FDHDECT--STNMCLNGMCI-NEEGSFKCVCKHGFTLA--SKKCFECYMSAIWLFFVYIDECLTPGICL-HGRCINTEGSYRCECLAGLAVGPDGRSCVDTHMRSTCYG-----AIKKGVCVRPFQAAVTRSACCCASASYSFGEPCQPCPTLD--------SAEFNALCPSGT---------------GYAIDG--------TDINECAMDPDICPNGACENL-RGGYRCICNIGYETDQSGRSYVDE---------CFVNRLLCDNGLCRNV-PGSYTCTCPKGYSYRQDSETCED--------VNECESSPCINGLCKNNAGSFACECSPGSKVDPTGLICIDSL-----------KGTCWLTIQEGRCEVNINGGTLRSECCATLGAAWGSPCEPCEIDPVCQRGFARPRGTICEDVNECEVFPGVCPNGRCVNTRG-SFKCQCSEGLTLDSTGRICVDIRLEHCYLTYD---EDECVQPVSGRFRMDACCCTVGAAWGKECEAC------PEPGTREYEALCPR---------------GPGFANRGDVLTGRPVYKDINECKVFPSICAHGTCRNTI----GSFRCRCNGGFALDAEERNCTDIDE-------CKISPDLCGHGACVNT-PGSFECDCLPGYESGFMMMKNCMDID--ECERNPGLCRGGSCKNTEGSYQCVCPPGHQLSTDGDAC-------EDVNECELS---------------ATLCRNGECVNVAGTYHCSCSTGYQSTP-DRKGCTDIDECTIENGGCDLLCTNSEGSYTCSCGQRYALMPDLRSC 1134          

HSP 10 Score: 80.4925 bits (197), Expect = 1.038e-14
Identity = 67/249 (26.91%), Postives = 101/249 (40.56%), Query Frame = 1
Query:  199 CDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY--CPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCI 831
            C   CG G C   N+C C    I + +C   + + C+  C N G C+   C C+ GY G  C   +                                    C+ ++   +C+     +  +K  CC+    AWG+PC  C      C +GF    +   C D+DECQ    +C  G C+N  GS+ C+CP  H L+E T  C+   D+C      C   G+C   S G ++C+C   Y +S +   C 
Sbjct:   26 CRNSCGDGFCSRPNMCTCTTGQIAS-SCTVKSTQQCSIRCMNGGLCEEDHCQCQKGYTGTYCGQPVCEKKCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFSQVVNQMCQGQVSGIVCTKTLCCATIGRAWGHPCEECPAQPQPCRRGFIPNIRTGACQDVDECQAVPGLCQGGNCVNTVGSYECKCPAGHRLNEVTNKCE-DVDECSTVQHVCE-GGQCT-NSVGSFSCVCPSGYVLSADKTRCF 270          

HSP 11 Score: 72.7886 bits (177), Expect = 2.155e-12
Identity = 207/900 (23.00%), Postives = 309/900 (34.33%), Query Frame = 1
Query:  538 PKGFTQKENRCDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDK-------KSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQ------------------GYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEG-GSCVDLNN-DYYCQCSEGF-YATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGEC-VDTXXXXXXXXXXXXXATENGRKCSRIE-----KQVTEEPDNSYC----LLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNEN-----------------ICTPG--------RCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDI---LVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIE--KVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTR----------------------------KEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            P+G     N  + I++C    ++CLNG CI    S RC+C     +D  ++      D+C    S     G CV T+ G + C C   +      ++C         N    +CL  G C     S+ C C  GF  +  K          +     D C +P I   C  G C++    YRC C                       G      CVR   +    S  C  S  YS  E    C  L++ ++   C  G  YA +         T  ++CA++   C  G C+ L    Y C C  G+   ++GRS +           C +    C  G+C  + P  Y C C +GYS  +D + C           N+  S  C  G C +N  S+ C C         G  C+              K   +   Q G C V+ N                G  C   E     ++    P  + C      + +   C  GRC+  +   FKC C  G T  S GR C    ++ C    +                  CT G         C   G   +  +CP     +  G     + +T  P  K  DI    V    CA G C N     RC C  G+    + + C  I+  K+S           G G       ++EC CL GY   E+G   +K+    +    C+ +   C+ G C    +  Y C C  G++ +TD  +C   D  +C ++   C+ G C ++   Y C C   Y  T + + C          DI E + +N      CT                             +E  + C  G+C     +Y C C   F ++     C+ D N+C
Sbjct:  371 PQGPVVSLN--ETINKCLLIPNLCLNGRCILVGSSHRCECNAGFRVD--SLGECSDIDECV---SDPCTNGDCVNTA-GSFYCKCHTGFHRPPGKQACFDHDECTSTN----MCL-NGMCINEEGSFKCVCKHGFTLASKKCFECYMSAIWLFFVYIDECLTPGI---CLHGRCINTEGSYRCECLAGLAVGPDGRSCVDTHMRSTCYGAIKKGVCVRPFQAAVTRSACCCASASYSFGEPCQPCPTLDSAEFNALCPSGTGYAIDG--------TDINECAMDPDICPNGACENL-RGGYRCICNIGYETDQSGRSYVDE---------CFVNRLLCDNGLCRNV-PGSYTCTCPKGYSYRQDSETCED--------VNECESSPCINGLCKNNAGSFACECSPGSKVDPTGLICIDSL-----------KGTCWLTIQEGRCEVNINGGTLRSECCATLGAAWGSPCEPCEIDPVCQRGFARPRGTICEDVNECEVFPGVCPNGRCVNTRG-SFKCQCSEGLTLDSTGRICVDIRLEHCYLTYDEDECVQPVSGRFRMDACCCTVGAAWGKECEACPEPGTREYEALCPRGPGFANRG-----DVLTGRPVYK--DINECKVFPSICAHGTCRNTIGSFRCRCNGGFALDAEERNCTDIDECKISP-------DLCGHGACVNTPGSFECDCLPGY---ESGFMMMKN---CMDIDECERNPGLCRGGSCKNT-EGSYQCVCPPGHQLSTDGDAC--EDVNECELSATLCRNGECVNVAGTYHCSCSTGYQSTPDRKGC---------TDIDECTIENGGCDLLCTNSEGSYTCSCGQRYALMPDLRSCTDVDECEEEPDICDGGQCTNVPGEYHCLCYDGFTSSMTTKSCI-DVNEC 1182          

HSP 12 Score: 60.8474 bits (146), Expect = 8.628e-9
Identity = 92/360 (25.56%), Postives = 141/360 (39.17%), Query Frame = 1
Query:  229 VGLNVCECYDKTIRTETCPQNNQKLCT--NNCSNK-GQCQNGKCI---------CESGYFGEDCNTAII----STCYVKIDRGLCK-STPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCPKGFTQKENRCDDIDECQ-FKSICLNGECINE-----------------------------------------KGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECV 1110
            +G  +C C    +R     + + +LC   N C  K G C+NG+C+         C  G+  +  +T  +      C+ ++ + +C+ S+     ++K +CC      WGN C  C        +  CP G     +   DIDEC+    +C NG CIN                                          +GS+ C CP  + L E++ SC+   D+CQ+   +C     CV T  G +TC C  P   + +  +CI   ++N C     LC   G CQ    S+ C C  GF        C    + + C S     RC+ G C +   GYRC C   Y  +    +CV
Sbjct: 2170 IGTFMCICPPGMVR-----RMDDELCQDENECRTKPGICENGRCVNTIGSYMCECGEGFQPDPTHTQCLDYRQGFCFTEVLQTMCQMSSSSRTAITKSQCCCDGGHGWGNQCELCPLPGTAKYKKLCPHGHGYATDG-TDIDECKVIPDVCKNGRCINTMGSYRCHCNSGYTASIAGTACVDLDECAMSPKPCNFICKNTEGSYACSCPRGYILQEDSRSCK-DLDECQVKRHNCQFM--CVNTIGG-FTCKC--PPGFTQHHTACI---DHNECAAEPSLCGAKGLCQNSPGSFSCECQRGFSLDTSGLHC---EDVNECDS---NHRCQFG-CENMLGGYRCNCPQGYTQHYQWNQCV 2507          
BLAST of Fibrillin-2 vs. Ensembl Cavefish
Match: LTBP3 (latent transforming growth factor beta binding protein 3 [Source:HGNC Symbol;Acc:HGNC:6716])

HSP 1 Score: 93.2041 bits (230), Expect = 1.094e-18
Identity = 113/443 (25.51%), Postives = 180/443 (40.63%), Query Frame = 1
Query:  526 RNYCPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQ-----YRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSC--------------IVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLC---------NGEY-------QGYNNDQECVRYGTSEPLVSRYCSKSEYYS--LCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQ--YKDYCQNQEISK-----RCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQT 1716
            R  C +GF  + +   C DI+ECQ   +C NG CIN +GSF+CQC P +   +    C+      R   CQ         G+C+ T  G Y C C K Y +  +G+ C    + + C   + LC P+G C+     Y C C  GF  SEDK SC              +   ++  C S       +   C S G G+   C         + EY       +G+ + +    YG     V R   +   ++  +C+GG C++    + C C +GFY   N   CI ++        ++  C  G C     + Y C C   +      + C+    T  S + C+   + C+ G C     + Y C C   +  + DR  C+  E+          ++++      CR G+CV+   S+ C+C      S   ++CV   +T
Sbjct:  658 RCLCNEGFLPEADSKGCRDINECQDNRLCANGHCINTEGSFQCQCYPGYQPTQEGSHCEDINECERASNCQR--------GRCINTM-GSYLCECQKGYML-VSGRRC---QDIDECEVDRSLCQPHGVCENRQGGYVCVCNDGFILSEDKHSCEEMEMDLNYKKECYLNLDDTVFCDSVLATNVTKQECCCSVGVGWGDHCEIYPCPVYHSAEYHSLCPIGRGFYHQEGVTEYGLP---VHRDIDECVLFNNEICKGGRCMNTQPGFECYCQQGFYYDSNLLECIDVDE-----CHDESLCTNGHCVNTRGSFY-CTCNAPWTPDATNKKCVYP--TVTSINECQDPSN-CKNGHCVDTQ-DSYYCICTPPWILATDRNSCVTPEEQAVMSVVTVSDVNECLDPSYCRNGRCVNTPGSFHCICAQPLTFSAALKQCVYDDRT 1074          

HSP 2 Score: 82.0333 bits (201), Expect = 2.988e-15
Identity = 195/825 (23.64%), Postives = 296/825 (35.88%), Query Frame = 1
Query:  559 ENRCDDIDECQFKSIC-LNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYC---SKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICEL----------------------------YGHRCQTGVCYPIYPNEYICACLEG---YSQSEDRKYCIKNEQYKDYCQ--NQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSC-DPEY-----------VDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            + RC DI+EC    IC + G C+N  GS++C C P  +  +    C+   D+C L   SC   G+C  T  G Y CI  +P      G        Y+V    K+     G C+    +Y C C  GF    D K C    + + CQ   +   C  G C++    ++C C   Y GY   QE             +C   ++ E  S C+ G C++    Y C+C +G+     RR C  I+    +C +++  CQ     E     Y C C  GFI SE+  SC + E   N    C L                            +G  C+   C   +  EY   C  G   Y Q    +Y +   +  D C   N EI   C+GG+C++    + C C   +   +N  EC+   +               SLC  G CV+T  ++YC C   +      +KC         E  +         S C  G C+ D    + C+C P +  A+D  SC  PE            V++CL+  + C  GRC  +  S F C+C    + S     C    V  + T  + D+            V++  IC                    SI                     EC C  G       R+C +  S +  + +C++H E          G+ D++ A    Y    D       D+ +C+     C  G C     G +C C   + +  +   CI         D+ E           C  + +   C+  +CV     ++C C H F
Sbjct:  549 KRRCADINECFKPDICGVGGVCVNLPGSYKCDCMPG-FRSKTRRQCE-DIDEC-LDPKSCPD-GQCENTI-GSYECIPCQP------GHQAQGGVCYDVNECQKRGVCLNGRCENLPGTYRCLCNEGFLPEADSKGC---RDINECQDNRL---CANGHCINTEGSFQCQC---YPGYQPTQE-----------GSHCEDINECERASNCQRGRCINTMGSYLCECQKGYMLVSGRR-CQDID----ECEVDRSLCQPHGVCENRQGGYVCVCNDGFILSEDKHSCEEMEMDLNYKKECYLNLDDTVFCDSVLATNVTKQECCCSVGVGWGDHCEIYPCPVYHSAEYHSLCPIGRGFYHQEGVTEYGLPVHRDIDECVLFNNEI---CKGGRCMNTQPGFECYCQQGFYYDSNLLECIDVDECHD-----------ESLCTNGHCVNTRGSFYCTCNAPWTPDATNKKCVYPTVTSINECQDP--------SNCKNGHCV-DTQDSYYCICTPPWILATDRNSCVTPEEQAVMSVVTVSDVNECLD-PSYCRNGRCVNTPGS-FHCICAQPLTFSAALKQC----VYDDRTAAHKDVCFQE--------VDEDLIC--------------------SIPRNGLTVTYS-----------ECCCHYGRGWGPECRTCPQRNSVIFNR-LCEMHLET------ESDGELDFLAA-FSNYNPEGDSSE---EDSDECS-----CANGRCVRSYLGTMCECNSGFRMDHSRTRCI---------DVDE-----------CVERRV-NLCKNARCVNTMGSFKCSCKHGF 1232          

HSP 3 Score: 72.7886 bits (177), Expect = 2.032e-12
Identity = 150/668 (22.46%), Postives = 231/668 (34.58%), Query Frame = 1
Query:  547 FTQKENRCDDIDECQF-KSICLNGECINEKGSFRCQCPPDHY-------------------------------------LDENTMSCQYRRDQCQ-----LYGSSCGIFGKCVPTSDGQYTCICIKPYSVS-----------FNGKSCIKKTNYNVCNYFK------------KLCLPYGECQPYGL-----------SYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYC---SKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICEL----------------------------YGHRCQTGVCYPIYPNEYICACLEG---YSQSEDRKYCIKNEQYKDYCQ--NQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSC-DPEY-----------VDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTT 2175
                + +   +DEC+  ++IC +GEC+N +  F C C   +                                      L  N +   + + +C           CG+ G CV    G Y C C+  +               + KSC      N    ++             +C    ECQ  G+           +Y C C  GF    D K C    + + CQ   +   C  G C++    ++C C   Y GY   QE             +C   ++ E  S C+ G C++    Y C+C +G+      RRC  I+    +C +++  CQ     E     Y C C  GFI SE+  SC + E   N    C L                            +G  C+   C   +  EY   C  G   Y Q    +Y +   +  D C   N EI   C+GG+C++    + C C   +   +N  EC+   +               SLC  G CV+T  ++YC C   +      +KC         E  +         S C  G C+ D    + C+C P +  A+D  SC  PE            V++CL + + C  GRC  +  S F C+C    + S     C+ +  T 
Sbjct:  459 LEAAQTQASQMDECRLNRNICGHGECVNTQTGFTCHCDAGYRPHTQRKNCVDENECEWEPCGQGRGTCINTVGSYHCNCLPGNKLMVHHGKRRCADINECFKPDICGVGGVCV-NLPGSYKCDCMPGFRSKTRRQCEDIDECLDPKSCPDGQCENTIGSYECIPCQPGHQAQGGVCYDVNECQKRGVCLNGRCENLPGTYRCLCNEGFLPEADSKGC---RDINECQDNRL---CANGHCINTEGSFQCQC---YPGYQPTQE-----------GSHCEDINECERASNCQRGRCINTMGSYLCECQKGYMLVSG-RRCQDID----ECEVDRSLCQPHGVCENRQGGYVCVCNDGFILSEDKHSCEEMEMDLNYKKECYLNLDDTVFCDSVLATNVTKQECCCSVGVGWGDHCEIYPCPVYHSAEYHSLCPIGRGFYHQEGVTEYGLPVHRDIDECVLFNNEI---CKGGRCMNTQPGFECYCQQGFYYDSNLLECIDVDECHD-----------ESLCTNGHCVNTRGSFYCTCNAPWTPDATNKKCVYPTVTSINECQDP--------SNCKNGHCV-DTQDSYYCICTPPWILATDRNSCVTPEEQAVMSVVTVSDVNECL-DPSYCRNGRCVNTPGS-FHCICAQPLTFSAALKQCVYDDRTA 1075          

HSP 4 Score: 71.633 bits (174), Expect = 4.073e-12
Identity = 157/681 (23.05%), Postives = 250/681 (36.71%), Query Frame = 1
Query: 1018 CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEG-GSCVDLNNDYYCQCSEG--FYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTP-GRCERSGNSNFRCVCPYYASLSKDGHSCL-----INY----VTTEPTTKYCD-ILVNRLR-----CASGNCVNDRCICG--PGYKSSE------DGKECYKIEKVSSIXXXXXXXXXXXXXXXXD----------DNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREK-CKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNE----YRCKGGYCYDIVDGYLCICVGNYTVTENGRDCIL--KIIAVKSVDISEVSYQNPQSQSFCTRKEIIEK--CQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRD 2922
            C  G CV+   G+ C C+  Y+ +   + CV             ++ E+    +G G+C++    Y+C C  G        +RRC  I    ++C        GG C  L  + Y+C C+ GF RS+  R C   +   +  S        C  G C     +     C  G+       Y +   Q +  C N         G+C +   +YRC+C+  ++   + + C           R  ++ +   LC  G C++T  ++ C+C  GY  T+ G  C  I +              E  S C  GRCI +    + C C  G+   S GR C  + +D+C  + ++C P G CE      + CVC     LS+D HSC      +NY          T +CD +L   +      C+ G    D C     P Y S+E       G+  Y  E V+                  +             +EC C  G+    N   CI  +         + H E  C  G C    +  + C C   +      K C+       ++NE      CK G+C D  D Y CIC   + +  +   C+   +   +  V +S+V+             E ++   C+ G+CV     + C C      +    +CV D
Sbjct:  479 CGHGECVNTQTGFTCHCDAGYRPHTQRKNCVDE-----------NECEWEPCGQGRGTCINTVGSYHCNCLPGNKLMVHHGKRRCADI----NECFKPDICGVGGVCVNLPGS-YKCDCMPGF-RSKTRRQCEDIDECLDPKS--------CPDGQCENTIGSYECIPCQPGHQAQGGVCYDVNECQKRGVCLN---------GRCENLPGTYRCLCNEGFLPEADSKGC-----------RDINECQDNRLCANGHCINTEGSFQCQCYPGYQPTQEGSHCEDINEC-------------ERASNCQRGRCI-NTMGSYLCECQKGYMLVS-GRRC--QDIDECEVDRSLCQPHGVCENR-QGGYVCVCNDGFILSEDKHSCEEMEMDLNYKKECYLNLDDTVFCDSVLATNVTKQECCCSVGVGWGDHCEIYPCPVYHSAEYHSLCPIGRGFYHQEGVTEYGLPVHRDIDECVLFNNEICKGGRCMNTQPGFECYCQQGFYYDSNLLECIDVD---------ECHDESLCTNGHCVNT-RGSFYCTCNAPWTPDATNKKCVYPT--VTSINECQDPSNCKNGHCVDTQDSYYCICTPPWILATDRNSCVTPEEQAVMSVVTVSDVN-------------ECLDPSYCRNGRCVNTPGSFHCICAQPLTFSAALKQCVYD 1071          

HSP 5 Score: 55.4546 bits (132), Expect = 3.352e-7
Identity = 33/101 (32.67%), Postives = 50/101 (49.50%), Query Frame = 1
Query:  433 CKSTPENLQLSKEECCSIFQVAWG-NPCVFCDR---------------NYCPKGFTQ-KENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENT 684
            C S P     ++E+CC     +WG + C  C +               + CP+G+ +     C DI+EC  + +C NGEC+N +GSFRC C P + L + T
Sbjct:  224 CSSNPLPGLTNQEDCCGSVGNSWGQHKCYKCPKLPYAGKLQTIIEEFGSTCPQGYKRLNRTHCQDINECMMQGVCQNGECLNTQGSFRCTCKPGYVLADRT 324          
BLAST of Fibrillin-2 vs. Ensembl Cavefish
Match: LTBP3 (latent transforming growth factor beta binding protein 3 [Source:HGNC Symbol;Acc:HGNC:6716])

HSP 1 Score: 93.2041 bits (230), Expect = 1.186e-18
Identity = 113/443 (25.51%), Postives = 180/443 (40.63%), Query Frame = 1
Query:  526 RNYCPKGFTQKENR--CDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQ-----YRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSC--------------IVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLC---------NGEY-------QGYNNDQECVRYGTSEPLVSRYCSKSEYYS--LCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQ--YKDYCQNQEISK-----RCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQT 1716
            R  C +GF  + +   C DI+ECQ   +C NG CIN +GSF+CQC P +   +    C+      R   CQ         G+C+ T  G Y C C K Y +  +G+ C    + + C   + LC P+G C+     Y C C  GF  SEDK SC              +   ++  C S       +   C S G G+   C         + EY       +G+ + +    YG     V R   +   ++  +C+GG C++    + C C +GFY   N   CI ++        ++  C  G C     + Y C C   +      + C+    T  S + C+   + C+ G C     + Y C C   +  + DR  C+  E+          ++++      CR G+CV+   S+ C+C      S   ++CV   +T
Sbjct:  646 RCLCNEGFLPEADSKGCRDINECQDNRLCANGHCINTEGSFQCQCYPGYQPTQEGSHCEDINECERASNCQR--------GRCINTM-GSYLCECQKGYML-VSGRRC---QDIDECEVDRSLCQPHGVCENRQGGYVCVCNDGFILSEDKHSCEEMEMDLNYKKECYLNLDDTVFCDSVLATNVTKQECCCSVGVGWGDHCEIYPCPVYHSAEYHSLCPIGRGFYHQEGVTEYGLP---VHRDIDECVLFNNEICKGGRCMNTQPGFECYCQQGFYYDSNLLECIDVDE-----CHDESLCTNGHCVNTRGSFY-CTCNAPWTPDATNKKCVYP--TVTSINECQDPSN-CKNGHCVDTQ-DSYYCICTPPWILATDRNSCVTPEEQAVMSVVTVSDVNECLDPSYCRNGRCVNTPGSFHCICAQPLTFSAALKQCVYDDRT 1062          

HSP 2 Score: 86.2705 bits (212), Expect = 1.463e-16
Identity = 211/941 (22.42%), Postives = 339/941 (36.03%), Query Frame = 1
Query:  433 CKSTPENLQLSKEECCSIFQVAWG-NPCVFCDR---------------NYCPKGFTQ-KENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLV-------SRYCSKSEYYSL---------CEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDN-NNYECQCLRG--FIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGY-----SQSEDRKYCIKNEQYKD-YCQN------------------------QEISKR--CRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTP-GRCERSGNSNFRCVCPYYASLSKDGHSCL-----INY----VTTEPTTKYCD-ILVNRLR-----CASGNCVNDRCICG--PGYKSSE------DGKECYKIEKVSSIXXXXXXXXXXXXXXXXD----------DNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREK-CKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNE----YRCKGGYCYDIVDGYLCICVGNYTVTENGRDCIL--KIIAVKSVDISEVSYQNPQSQSFCTRKEIIEK--CQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRD 2922
            C S P     ++E+CC     +WG + C  C +               + CP+G+ +     C DI+EC  + +C NGEC+N +GSFRC C P + L + T      +  C    +  G     +PT+  Q  C C    +   N + C +    +    F +LC P G+     L Y+ +      Q+  ++S I+       Q+  +         +S       L              V   T+ P++       S   ++++   +         C  G CV+    + C C  G+     R+ C+      ++C      C  GR   ++   +Y C CL G   +     R C           IC +       GVC  + P  Y C C+ G+      Q ED   C+  +   D  C+N                         E  KR  C  G+C +   +YRC+C+  ++   + + C           R  ++ +   LC  G C++T  ++ C+C  GY  T+ G  C  I +              E  S C  GRCI +    + C C  G+   S GR C  + +D+C  + ++C P G CE      + CVC     LS+D HSC      +NY          T +CD +L   +      C+ G    D C     P Y S+E       G+  Y  E V+                  +             +EC C  G+    N   CI  +         + H E  C  G C    +  + C C   +      K C+       ++NE      CK G+C D  D Y CIC   + +  +   C+   +   +  V +S+V+             E ++   C+ G+CV     + C C      +    +CV D
Sbjct:  210 CSSNPLPGLTNQEDCCGSVGNSWGQHKCYKCPKLPYAGKLQTIIEEFGSTCPQGYKRLNRTHCQDINECMMQGVCQNGECLNTQGSFRCTCKPGYVLADRTRCVLEVQGPCYRMLTQAGRCELALPTNLPQKLCCCTVGKAWGRNCEKCPQDGTAS----FNELC-PAGKGMSV-LHYHGTLAIQPFQTSIEQSPILTKPE---QAKPLPLSLTFSLSLSFSLFSLVL--------------VPSPTTRPIIRVPPERDSLEAAQTQASQMDECRLNRNICGHGECVNTQTGFTCHCDAGYRPHTQRKNCVD----ENECEWE--PCGQGRGTCINTVGSYHCNCLPGNKLMVHHGKRRCADINECFKP-DICGV------GGVCVNL-PGSYKCDCMPGFRSKTRRQCEDIDECLDPKSCPDGQCENTIGSYECIPCQPGHQAQGGVCYDVNECQKRGVCLNGRCENLPGTYRCLCNEGFLPEADSKGC-----------RDINECQDNRLCANGHCINTEGSFQCQCYPGYQPTQEGSHCEDINE-------------CERASNCQRGRCI-NTMGSYLCECQKGYMLVS-GRRC--QDIDECEVDRSLCQPHGVCENR-QGGYVCVCNDGFILSEDKHSCEEMEMDLNYKKECYLNLDDTVFCDSVLATNVTKQECCCSVGVGWGDHCEIYPCPVYHSAEYHSLCPIGRGFYHQEGVTEYGLPVHRDIDECVLFNNEICKGGRCMNTQPGFECYCQQGFYYDSNLLECIDVD---------ECHDESLCTNGHCVNT-RGSFYCTCNAPWTPDATNKKCVYPT--VTSINECQDPSNCKNGHCVDTQDSYYCICTPPWILATDRNSCVTPEEQAVMSVVTVSDVN-------------ECLDPSYCRNGRCVNTPGSFHCICAQPLTFSAALKQCVYD 1059          

HSP 3 Score: 82.0333 bits (201), Expect = 3.106e-15
Identity = 195/825 (23.64%), Postives = 296/825 (35.88%), Query Frame = 1
Query:  559 ENRCDDIDECQFKSIC-LNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYC---SKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICEL----------------------------YGHRCQTGVCYPIYPNEYICACLEG---YSQSEDRKYCIKNEQYKDYCQ--NQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSC-DPEY-----------VDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
            + RC DI+EC    IC + G C+N  GS++C C P  +  +    C+   D+C L   SC   G+C  T  G Y CI  +P      G        Y+V    K+     G C+    +Y C C  GF    D K C    + + CQ   +   C  G C++    ++C C   Y GY   QE             +C   ++ E  S C+ G C++    Y C+C +G+     RR C  I+    +C +++  CQ     E     Y C C  GFI SE+  SC + E   N    C L                            +G  C+   C   +  EY   C  G   Y Q    +Y +   +  D C   N EI   C+GG+C++    + C C   +   +N  EC+   +               SLC  G CV+T  ++YC C   +      +KC         E  +         S C  G C+ D    + C+C P +  A+D  SC  PE            V++CL+  + C  GRC  +  S F C+C    + S     C    V  + T  + D+            V++  IC                    SI                     EC C  G       R+C +  S +  + +C++H E          G+ D++ A    Y    D       D+ +C+     C  G C     G +C C   + +  +   CI         D+ E           C  + +   C+  +CV     ++C C H F
Sbjct:  537 KRRCADINECFKPDICGVGGVCVNLPGSYKCDCMPG-FRSKTRRQCE-DIDEC-LDPKSCPD-GQCENTI-GSYECIPCQP------GHQAQGGVCYDVNECQKRGVCLNGRCENLPGTYRCLCNEGFLPEADSKGC---RDINECQDNRL---CANGHCINTEGSFQCQC---YPGYQPTQE-----------GSHCEDINECERASNCQRGRCINTMGSYLCECQKGYMLVSGRR-CQDID----ECEVDRSLCQPHGVCENRQGGYVCVCNDGFILSEDKHSCEEMEMDLNYKKECYLNLDDTVFCDSVLATNVTKQECCCSVGVGWGDHCEIYPCPVYHSAEYHSLCPIGRGFYHQEGVTEYGLPVHRDIDECVLFNNEI---CKGGRCMNTQPGFECYCQQGFYYDSNLLECIDVDECHD-----------ESLCTNGHCVNTRGSFYCTCNAPWTPDATNKKCVYPTVTSINECQDP--------SNCKNGHCV-DTQDSYYCICTPPWILATDRNSCVTPEEQAVMSVVTVSDVNECLD-PSYCRNGRCVNTPGS-FHCICAQPLTFSAALKQC----VYDDRTAAHKDVCFQE--------VDEDLIC--------------------SIPRNGLTVTYS-----------ECCCHYGRGWGPECRTCPQRNSVIFNR-LCEMHLET------ESDGELDFLAA-FSNYNPEGDSSE---EDSDECS-----CANGRCVRSYLGTMCECNSGFRMDHSRTRCI---------DVDE-----------CVERRV-NLCKNARCVNTMGSFKCSCKHGF 1220          

HSP 4 Score: 72.7886 bits (177), Expect = 2.150e-12
Identity = 150/668 (22.46%), Postives = 231/668 (34.58%), Query Frame = 1
Query:  547 FTQKENRCDDIDECQF-KSICLNGECINEKGSFRCQCPPDHY-------------------------------------LDENTMSCQYRRDQCQ-----LYGSSCGIFGKCVPTSDGQYTCICIKPYSVS-----------FNGKSCIKKTNYNVCNYFK------------KLCLPYGECQPYGL-----------SYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYC---SKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICEL----------------------------YGHRCQTGVCYPIYPNEYICACLEG---YSQSEDRKYCIKNEQYKDYCQ--NQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSC-DPEY-----------VDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTT 2175
                + +   +DEC+  ++IC +GEC+N +  F C C   +                                      L  N +   + + +C           CG+ G CV    G Y C C+  +               + KSC      N    ++             +C    ECQ  G+           +Y C C  GF    D K C    + + CQ   +   C  G C++    ++C C   Y GY   QE             +C   ++ E  S C+ G C++    Y C+C +G+      RRC  I+    +C +++  CQ     E     Y C C  GFI SE+  SC + E   N    C L                            +G  C+   C   +  EY   C  G   Y Q    +Y +   +  D C   N EI   C+GG+C++    + C C   +   +N  EC+   +               SLC  G CV+T  ++YC C   +      +KC         E  +         S C  G C+ D    + C+C P +  A+D  SC  PE            V++CL + + C  GRC  +  S F C+C    + S     C+ +  T 
Sbjct:  447 LEAAQTQASQMDECRLNRNICGHGECVNTQTGFTCHCDAGYRPHTQRKNCVDENECEWEPCGQGRGTCINTVGSYHCNCLPGNKLMVHHGKRRCADINECFKPDICGVGGVCV-NLPGSYKCDCMPGFRSKTRRQCEDIDECLDPKSCPDGQCENTIGSYECIPCQPGHQAQGGVCYDVNECQKRGVCLNGRCENLPGTYRCLCNEGFLPEADSKGC---RDINECQDNRL---CANGHCINTEGSFQCQC---YPGYQPTQE-----------GSHCEDINECERASNCQRGRCINTMGSYLCECQKGYMLVSG-RRCQDID----ECEVDRSLCQPHGVCENRQGGYVCVCNDGFILSEDKHSCEEMEMDLNYKKECYLNLDDTVFCDSVLATNVTKQECCCSVGVGWGDHCEIYPCPVYHSAEYHSLCPIGRGFYHQEGVTEYGLPVHRDIDECVLFNNEI---CKGGRCMNTQPGFECYCQQGFYYDSNLLECIDVDECHD-----------ESLCTNGHCVNTRGSFYCTCNAPWTPDATNKKCVYPTVTSINECQDP--------SNCKNGHCV-DTQDSYYCICTPPWILATDRNSCVTPEEQAVMSVVTVSDVNECL-DPSYCRNGRCVNTPGS-FHCICAQPLTFSAALKQCVYDDRTA 1063          
BLAST of Fibrillin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002704.1 (pep scaffold:Pmarinus_7.0:GL476354:513769:588114:-1 gene:ENSPMAG00000002318.1 transcript:ENSPMAT00000002704.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.265 bits (334), Expect = 1.722e-31
Identity = 196/848 (23.11%), Postives = 318/848 (37.50%), Query Frame = 1
Query:  322 NKGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCV---PTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGV-----------------CYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYK------------QTEPPAVRL------CSKWEYYSL-CQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDC 2721
            N   C+NG+C+   G F   CN                + T +       + CS   +     C+  D ++   C  GF        C DIDECQ   IC+NG CIN +GSF+C+CPP   +  +   C     +   YG    + GKC+   P ++ +  C C  P              N+     F + CLP            C  P   +  +D   C +N        PEI   C  G C ++   YRC+CN  Y+     ++CV     E ++  +        LC+ GSC +    Y C C  G+        C  ++   S   +N      G CQ     ++ C CL      +    CI++ +    T    +  +RC+  V                   P  P E    C +G+S++       K  Q +D  + +  +  C   +C++   S++C C   +   + G+ C+  +              EP AVRL      CS  + +   C+G     ++   +       Y+           K + E         + +   C  G+C  +    FKC C  GF   ++G++C    +D+C  + +IC  G C  +  S F C C       + G   + N +  +   +      N L C  G CVN     +C+C PG+  +EDG  C  +++ S   +L +              +Y+C C  GY  + + + C+  +   I    CD H                Y C+C  GY    D +SC  +D  +C  N Y C GG C ++   Y C+C   +  + + + C
Sbjct:  479 NGQVCKNGRCVNTEGSFQCICNAGF-------------ELTADGRNCLDHDECSTTNMCLNGMCINEDGSFKCICKPGFYLVPSGRYCLDIDECQTHGICMNGRCINTEGSFKCECPPGMIVSMDGRLCIDTHMRSTCYGDY--MMGKCLTPFPGANTKSECCCANP--------------NF----AFGEPCLPCPAVNSDDYKMLCPTPGFDNGGKDINECALN--------PEI---CTNGQCENQLGTYRCVCNIGYESDITGKKCVD--VDECMLRAH--------LCDNGSCRNTPGSYTCACPAGYLFKHETEMCEDVDECESNPCIN------GNCQNT-VGSFTCVCLPTSKLDQTKTICIESTK---GTCWLNIIDNRCEVNVNGATLKSECCSTLGAAWGSPCEPCELDTICPKGFSRA-------KGTQCEDVNECEVFAGICVNSRCINTAGSFKCECPPGHTLESTGRTCIDLRLENCYLSYEEEECEEPLAVRLRSDVCCCSLGKAWGPECEGCPEKGSSEYAFLCPRGPGYSNRGDPVGRHFFKDINE--------CKVFPQMCSNGKCR-NTIGSFKCNCENGFVLDAEGKNCTD--IDECKISHDICGMGTCVNTPGS-FDCEC---MEGFESGFMMMKNCMDIDECER------NPLLCRGGTCVNTEGSFKCLCPPGHDLNEDGTVCLDVDECSLSGNLCRNGRCVNMI-----GSYQCSCNTGYSATPDRQGCVDIDECTIMNGGCDTHCSN---------SDGSYECSCERGYALLPDTRSCSDID--ECEDNPYLCDGGQCTNVPGEYRCLCYDGFISSVDMKTC 1218          

HSP 2 Score: 120.939 bits (302), Expect = 1.015e-27
Identity = 242/1035 (23.38%), Postives = 382/1035 (36.91%), Query Frame = 1
Query:  340 NGKCICESGYF----GEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQV--AWGNPCVFCDR----------NYCPKGFTQKENRCD--DIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI-------------------------------VNSNSDICQSPE----IAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQT---------GVCYPIYPNE-YICACLEGYSQSEDRKYCI-----------KNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVC--------------------------HGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQ---GGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG-FKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLIN---YVTTEPTTKYCDI------LVNRLRC--ASGNCVNDRC-IC--------------GPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCP---YCFYGCFDENSISTCSCSENYENLFDTGLCIIKSD 3042
            N  C+C   Y     G +C     S CY   D   C +   +  L+++ECC  + V  AW  PCV C               P G+    N  +  DIDEC + + IC NG C+N  GSFRC+CP     ++  + C+   ++C      C    +C+  S G Y C C   Y+ +  G  CI +   + C+   ++C P G CQ    SY C CP+G+  +ED+  C+                               +++N+D     E     A  C+ GSC++    ++CLCN  ++   + + C      +          ++  +C  G+C +L   + C C  G+   E    C  I+    +C+  +  C  G C      ++EC+C  GFI SE GR C      R +    E    +C T         G C  + P + +   C     Q+E+  Y +           +++  +D  +       C  G+C++   S+RC C                          +G  ++   G EC      EP  +  C      SL        CV+   +Y C C  GY   E+ R C           D   C  +E L  C     I     G + C+C PG+T   DG  C  E  ++C     IC  GRC  +  S ++CVC    +L++D   C+ +   +  TE     C +      LV +  C    G     +C IC              GPGY +  DG++  +   +  +C   Q            + +Y C C NGY        C+  +        C+         IC    +  Y CAC  GY    D ++C  +D  +CA  ++ C+   C + + G+ C C   +T                 +D +E   Q       C  K        G C      + C+C   F  +     C  D ++C     C +GC +      C C   Y   F    C+ +++
Sbjct: 1611 NYTCVCPPDYMQVNGGNNCMDMRKSFCYKTYDAAGCDNE-LSFNLTEKECCCSYNVGKAWNRPCVPCPTISTKAHNQLCGGVPPGYEIDINTGERIDIDECSKIQGICTNGMCVNLPGSFRCECPMGFLYNDIQIICE-DINECASAEKMCQRNAECI-NSVGSYRCECSPGYTQTPFGL-CIDR---DECSEKPEICSP-GRCQDTEGSYRCMCPNGYKATEDQNMCMDVDECERQPCGNGTCRNTVGSFNCLCFPGFEISANNDCMDKDECVSLAAHVCKFGSCINNVGSFKCLCNEGFELTADKKNCRDINECQ----------QFRGMCAPGTCQNLEGSFRCMCPPGYEVKE--EACTDID----ECSSEEDLCMMGSCLNT-FGSFECRCPSGFILSETGRKCYDV---RVNYCFSEFAQGKCSTPKPFNTSKAGCCCSMMPGDGWGDPCEPCPKQNEEEAYRLLCPYGPGTVVGRDDSREDLDECLANPGICANGRCINTDGSFRCDCPMGYNLEAAGFKCVDANECSIGNPCGNGTCLNVPGGFECTCDDGFEPGPMMTCEDLNECSLNPLLCAFRCVNNFGSYECMCPTGYVLREDRRMCK----------DQDEC--EEGLDNCASRNMICKNLIGTYMCICPPGYTRRPDGEGCIDE--NECRLKPGICENGRCINNVGS-YKCVCNEGFTLNQDETECVDSRRGFCFTEVIQSLCQMVSSSRNLVTKSECCCDGGRGWGQQCDICPLPGTAQYKKLCPHGPGYTT--DGRDIDECTVMPGMCHHGQCINS--------EGSYHCMCNNGYTTDITRTGCVDLDECAQSPKPCNF--------ICKNT-EGSYQCACPRGYIMQEDGRTCRDLD--ECASKQHNCQF-LCVNTIGGFTCKCPPGFTQHH-----------TACIDNNECVSQ----PGTCGSK--------GVCQNSPGSFSCECQKGFSLDNSGSNC-EDMDECSGNHRCQHGCQNMLGGYRCGCPSGYLQHFQWNQCVDENE 2556          

HSP 3 Score: 114.775 bits (286), Expect = 7.192e-26
Identity = 212/958 (22.13%), Postives = 356/958 (37.16%), Query Frame = 1
Query:  289 NNQKLCTNNCSNKGQCQNG----KCICESGYF--GEDCNTAIISTCYVKID---RGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSI-CLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLL-------------QEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGR--------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSI-------------------CDLHREKCKTGICYP-----IGQNDYICACV-LGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYT-------------------VTENGRDCILKIIAVK---SVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            N  K+    CSN G+C+N     KC CE+G+    E  N   I  C +  D    G C +TP +      EC   F+                 GF   +N C DIDEC+   + C  G C+N +GSF+C CPP H L+E+   C    D+C L G+ C   G+CV    G Y C C   YS + + + C+   + + C      C  +  C     SY CSC  G+    D +SC     SDI +  +    C GG C +    YRCLC   +    + + C      E             ++C  G C +    + C C  GF   +    C  ++    +C +    C           +++C C+ G+    +G  C   +   N T       H C         P  + C C +G+S   D + C+  ++        E    C  GQC+++   YRC C   ++ + +G+ C    +             + ++C  G+C +    + C C  GY   E G  C+  +K    +P N +  +              +Y     G  C+G      KC  L          SC+ E       +   C+ GR        C     + +R +CP       + ++ ++  +        C  L     C  GNC N     +C+C PG++ +ED ++C  I++ ++  ++                NY C C   Y++   G +C+    +   K+                    C  +  K     C P        ++ +C  V  GY+   +    I +D  +C+  +  C  G C ++   + C C   +                    + +   +CI  + + +   S   ++  +     +  C+ K   E C PG+C + +  Y+C CP+ +K     + C+
Sbjct:  970 NECKVFPQMCSN-GKCRNTIGSFKCNCENGFVLDAEGKNCTDIDECKISHDICGMGTCVNTPGSFDC---ECMEGFE----------------SGFMMMKN-CMDIDECERNPLLCRGGTCVNTEGSFKCLCPPGHDLNEDGTVC-LDVDECSLSGNLC-RNGRCV-NMIGSYQCSCNTGYSATPDRQGCV---DIDECTIMNGGCDTH--CSNSDGSYECSCERGYALLPDTRSC-----SDIDECEDNPYLCDGGQCTNVPGEYRCLCYDGFISSVDMKTCSDVNECE----------LNPNICIHGKCENTRGSFICHCKVGFTVKKGSTGCTDVD----ECEIGAHNCDMHATCANVQGSFKCTCIEGYFG--DGVKCQDVDECANGT-------HNCIPEAKCVNIPGTFTCVCRDGFSG--DGQTCVDMDECA------ENVNLCEFGQCLNSAGGYRCECEMGFVPTVDGRSCKDIDEC-----------MFDNICVFGKCENVPGMFRCVCDPGYEIDETGGNCT--DKDECADPSNCFNGICTNTQGSFLCTCPADYQMSPSGQGCVGTDYRVGKCF-LESTERGDGTLSCNVEIGIGISRSSCCCSLGRAWGAPCELCPVVNTTEYRILCPGGEGFRPNPYTVILEDI------DECTELPG--LCQGGNCQNTFGSFKCVCQPGFRFNEDNRQCEDIDECANFPTVCGPGTCYNIV-----GNYTCVCPPDYMQVNGGNNCMDMRKSFCYKTYDAAGCDNELSFNLTEKECCCSYNVGKAWNRPCVPCPTISTKAHNQLCGGVPPGYEIDINTGERIDID--ECSKIQGICTNGMCVNLPGSFRCECPMGFLYNDIQIICEDINECASAEKMCQRNAECINSVGSYRCECSPGYTQTPFGLCIDRDECSEKP--EICSPGRCQDTEGSYRCMCPNGYKATEDQNMCM 1831          

HSP 4 Score: 113.235 bits (282), Expect = 2.236e-25
Identity = 230/1021 (22.53%), Postives = 373/1021 (36.53%), Query Frame = 1
Query:  283 PQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAII--------------STCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCD-------RNYCP-KGFT-------------------QKEN--------------------RCDDIDECQFKS-ICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKT---------------NYNVCNYFKKLCLPYGE-----CQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRY------------GTSEPLVSRY------CSKSEYYSL-CEGGSCVDL-NNDYYCQCSEG-FYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEP-----------------DNSYCLLQEYLS------------RCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFY 2949
            P     L  + C   G C NG+CI   G F  +C   +I              STCY     G C +         E CC+    A+G PC+ C        +  CP  GF                    Q EN                    +C D+DEC  ++ +C NG C N  GS+ C CP  +     T  C+   D+C+   S+  I G C  T  G +TC+C+    +      CI+ T               N N      + C   G      C+P  L     CP GF +++  +        D+ +    A  C    C++    ++C C   +   +  + C+                 EPL  R       CS  + +   CEG  C +  +++Y   C  G  Y+              ++C +    C  G+C+     +++C C  GF+    G++C   +  + S  IC +       G C    P  + C C+EG+   E     +KN    D C+   +   CRGG CV+   S++C+C   +  + +G  C+   +               +LC+ G CV+   +Y C C  GY AT + + C  I++                       +  Y LL +  S             C GG+C  +    ++CLC  GF S+ D ++C    V++C  N NIC  G+CE +  S F C C    ++ K    C  +    E     CD+      CA+    + +C C  GY    DG +C  +++ ++       + +           + C C +G+  S +G++C+  +      ++C+  +     G         Y C C +G+    D +SC  +D  +C  +   C  G C ++   + C+C   Y + E G +C  K    +  D S                     C  G C   Q  + C CP  ++ +     CV    +   CF 
Sbjct:  548 PSGRYCLDIDECQTHGICMNGRCINTEGSFKCECPPGMIVSMDGRLCIDTHMRSTCYGDYMMGKCLTPFPGANTKSECCCANPNFAFGEPCLPCPAVNSDDYKMLCPTPGFDNGGKDINECALNPEICTNGQCENQLGTYRCVCNIGYESDITGKKCVDVDECMLRAHLCDNGSCRNTPGSYTCACPAGYLFKHETEMCE-DVDECE---SNPCINGNCQNTV-GSFTCVCLPTSKLDQTKTICIESTKGTCWLNIIDNRCEVNVNGATLKSECCSTLGAAWGSPCEPCELDTI--CPKGFSRAKGTQC------EDVNECEVFAGICVNSRCINTAGSFKCECPPGHTLESTGRTCIDLRLENCYLSYEEEECEEPLAVRLRSDVCCCSLGKAWGPECEG--CPEKGSSEYAFLCPRGPGYSNRGDPVGRHFFKDINECKVFPQMCSNGKCRNTI-GSFKCNCENGFVLDAEGKNCTDIDECKISHDICGM-------GTCVNT-PGSFDCECMEGF---ESGFMMMKNCMDIDECERNPL--LCRGGTCVNTEGSFKCLCPPGHDLNEDGTVCLDVDECSLSG----------NLCRNGRCVNMIGSYQCSCNTGYSATPDRQGCVDIDECTIMNGGCDTHCSNSDGSYECSCERGYALLPDTRSCSDIDECEDNPYLCDGGQCT-NVPGEYRCLCYDGFISSVDMKTCSD--VNECELNPNICIHGKCENTRGS-FICHCKVGFTVKKGSTGC-TDVDECEIGAHNCDM---HATCANVQ-GSFKCTCIEGYFG--DGVKCQDVDECANGTHNCIPEAKCVNI----PGTFTCVCRDGF--SGDGQTCVDMDECAENVNLCEFGQCLNSAG--------GYRCECEMGFVPTVDGRSCKDID--ECMFDNI-CVFGKCENVPGMFRCVCDPGYEIDETGGNCTDKD---ECADPS--------------------NCFNGICTNTQGSFLCTCPADYQMSPSGQGCVGTDYRVGKCFL 1478          

HSP 5 Score: 108.612 bits (270), Expect = 4.789e-24
Identity = 198/858 (23.08%), Postives = 296/858 (34.50%), Query Frame = 1
Query:  547 FTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQ------------------------CQLYGSSCGIFGKCVP-----TSDGQYTCICIKP-YSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERC-RGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASD-------------------------GRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGN-CVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCF 2946
            F +   +C+DIDEC  F ++C  G C N  G++ C CPPD+       +C   R                          C  Y         CVP     T      C  + P Y +  N     ++ + + C+  + +C   G C     S+ C CP GF  ++ +  C      DI +     + C R   C++    YRC C+  Y             T   L       SE   +C  G C D    Y C C  G+ ATE++  C+ ++    Q       C  G C+     ++ C C  GF  S N     K E          L  H C+ G C       + C C EG+  + D+K C      +D  + Q+    C  G C +   S+RC+C   Y            K+     +  CS  E   LC  G C++T  ++ C+C +G+  +E GRKC  +          +YC  +    +C   +       G  C  +PG                               GR    E +D+CL N  IC  GRC  +  S FRC CP   +L   G  C                 V+   C+ GN C N  C+  PG                                       +EC C +G+       +C       +   +C     +C            Y C C  GY    D++ C   D  +  ++    +   C +++  Y+CIC   YT   +G  CI                     ++ C  K  I  C+ G+C+     Y+C C   F  N  + ECV DS +  +CF
Sbjct: 1580 FNEDNRQCEDIDECANFPTVCGPGTCYNIVGNYTCVCPPDYMQVNGGNNCMDMRKSFCYKTYDAAGCDNELSFNLTEKECCCSYNVGKAWNRPCVPCPTISTKAHNQLCGGVPPGYEIDINTG---ERIDIDECSKIQGICT-NGMCVNLPGSFRCECPMGFLYNDIQIIC-----EDINECASAEKMCQRNAECINSVGSYRCECSPGYTQ-----------TPFGLCIDRDECSEKPEICSPGRCQDTEGSYRCMCPNGYKATEDQNMCMDVDECERQ------PCGNGTCRNT-VGSFNCLCFPGFEISANNDCMDKDECV-------SLAAHVCKFGSCINNV-GSFKCLCNEGFELTADKKNC------RDINECQQFRGMCAPGTCQNLEGSFRCMCPPGY----------EVKEEACTDIDECSSEE--DLCMMGSCLNTFGSFECRCPSGFILSETGRKCYDVRV--------NYCFSEFAQGKCSTPKPFNTSKAGCCCSMMPGDGWGDPCEPCPKQNEEEAYRLLCPYGPGTVVGRDDSREDLDECLANPGICANGRCINTDGS-FRCDCPMGYNLEAAGFKC-----------------VDANECSIGNPCGNGTCLNVPG--------------------------------------GFECTCDDGFEPGPM-MTCEDLNECSLNPLLCAF---RCVNNF------GSYECMCPTGYVLREDRRMCKDQDECEEGLDNCASRNMICKNLIGTYMCICPPGYTRRPDGEGCI--------------------DENECRLKPGI--CENGRCINNVGSYKCVCNEGFTLNQDETECV-DSRR-GFCF 2286          

HSP 6 Score: 107.071 bits (266), Expect = 1.793e-23
Identity = 215/960 (22.40%), Postives = 333/960 (34.69%), Query Frame = 1
Query:  442 TPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQEC----VRYGTSEPLVSRYCSKSEYYSLCEGGSCVDL------------------NNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQS-----EDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSK--------WEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLN-------------------NENICTPGR--------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDL-------------------HREKC--------KTGICYPIG-----QNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY----CFYGCFDENSISTCSCSENY 3000
            TP  L + ++EC    ++     C   + +Y   CP G+  T+ +N C D+DEC+ +  C NG C N  GSF C C P   +  N       +D+C    +    FG C+  + G + C+C + + ++ + K+C    + N C  F+ +C P G CQ    S+ C CP G+   E+  + I     D C S E  + C  GSC++    + C C   +      ++C    V Y  SE      CS  + ++  + G C  +                     Y   C  G      R           +C  N   C  GRC   D + + C C  G+     G  C+ A    N  SI    G+ C  G C  + P  + C C +G+        ED   C  N     +             +CV+N  SY C+C   Y+   + + C    + E       S+          Y  +C  G                Y    +G  C           D + C L+  +  C  GRCI +    +KC+C  GFT   D   C       C                     +E  C  GR        C   G + ++ +CP+    + DG    I+  T  P             C  G C+N      C+C  GY +      C  +++ +                +  + +Y+C C  GYI  E+GR+C   +    K+  C                     H   C        + G C   G        + C C  G+       +C  MD  +C+ N +RC+ G C +++ GY C C   Y        C           + E    NPQ             C    C      ++C CP+ +  + +   C  D N+C +    C +GC +      C C   Y
Sbjct: 1783 TPFGLCIDRDECSEKPEICSPGRCQDTEGSYRCMCPNGYKATEDQNMCMDVDECE-RQPCGNGTCRNTVGSFNCLCFPGFEISANNDC--MDKDECVSLAAHVCKFGSCI-NNVGSFKCLCNEGFELTADKKNC---RDINECQQFRGMCAP-GTCQNLEGSFRCMCPPGYEVKEEACTDI-----DECSSEE--DLCMMGSCLNTFGSFECRCPSGFILSETGRKCYDVRVNYCFSE-FAQGKCSTPKPFNTSKAGCCCSMMPGDGWGDPCEPCPKQNEEEAYRLLCPYGPGTVVGRD---DSREDLDECLANPGICANGRCINTDGS-FRCDCPMGYNLEAAGFKCVDA----NECSI----GNPCGNGTCLNV-PGGFECTCDDGFEPGPMMTCEDLNECSLNPLLCAF-------------RCVNNFGSYECMCPTGYVLREDRRMCKDQDECEEGLDNCASRNMICKNLIGTYMCICPPG----------------YTRRPDGEGCI----------DENECRLKPGI--CENGRCI-NNVGSYKCVCNEGFTLNQDETECVDSRRGFCFTEVIQSLCQMVSSSRNLVTKSECCCDGGRGWGQQCDICPLPGTAQYKKLCPHGPGYTTDGRD--IDECTVMPGM-----------CHHGQCINSEGSYHCMCNNGYTTDITRTGCVDLDECAQ------SPKPCNFICKNTEGSYQCACPRGYIMQEDGRTCRDLDECASKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNNECVSQPGTCGSKGVCQNSPGSFSCECQKGFSLDNSGSNCEDMD--ECSGN-HRCQHG-CQNMLGGYRCGCPSGYLQHFQWNQC-----------VDENECTNPQV------------CGSASCYNTLGSFKCACPNGYNFDQFSGGC-NDVNECSHSKAPCNFGCSNTEGGYLCGCPPGY 2624          

HSP 7 Score: 86.2705 bits (212), Expect = 3.993e-17
Identity = 74/269 (27.51%), Postives = 107/269 (39.78%), Query Frame = 1
Query:  148 CCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAIIST---------------------------------CYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKK 837
            CC GW     G+ C+   C + CG G C   N+C C    I + TC   +   C   C N G C +  C C  GY G  C   +  T                                 C+ ++   +C+     +  +K  CC+    AWG+PC  C    + C +GF    +   C D+DECQ    +C  G C+N  GS+ C+CP  H   E +  C+   D+C+     C   G+C  T  G Y C C   +S   +  SC  +
Sbjct:   12 CCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCSSGQI-SSTCGSKSISQCNIRCMNGGSCADDHCSCGKGYTGTHCGQPVCDTGCQNGGRCIGPNRCACVYGFTGPHCERDYRTGPCFTQVSNQMCQGQVSGIVCTKGLCCATIGRAWGHPCEVCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGMCKGGTCVNTVGSYECKCPLGHKQSELSQQCE-DIDECETIPGICN-GGECKNTI-GSYFCNCPAGFSTPPDRSSCFDQ 276          

HSP 8 Score: 84.7297 bits (208), Expect = 9.776e-17
Identity = 169/702 (24.07%), Postives = 266/702 (37.89%), Query Frame = 1
Query:  526 RNYCPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNV----------------CNYFKKLCLPYGEC-----QPYGLS-----------YYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNND-------QECVRY------GTSEPLVSRY--CSKSEYYSLCEGGSCVDLNNDY--------YCQCSEGFYATENR------------RRCIKIETITS---------------------------QCALNQFQCQGGRCQELDNNNYECQCLRGFIRS------ENGRSCIKAERT--RNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKI 2307
            R  C  GF  T     C DIDEC F +IC+ G+C N  G FRC C P + +DE   +C   +D+C    S+C  F      + G + C C   Y +S +G+ C+  T+Y V                CN    + +    C     + +G             Y   CP G     +  + I+    DI +  E+   C+GG+C +    ++C+C   ++ +N D        EC  +      GT   +V  Y      +Y  +  G +C+D+   +         C     F  TE              R C+   TI++                           +C+  Q  C  G C  L   ++ C+C  GF+ +      E+   C  AE+   RN+  I  +  +RC+               C  GY+Q+     CI     +D C   E  + C  G+C     SYRC+C   Y ++ +   C+   + E               C  G C +T  ++ C C  G+  + N   C   ++ V+         L  ++  C  G CI +    FKCLC  GF   +D ++C    +++C     +C PG C+    S FRC+CP        G+      V  E  T   +       C  G+C+N      C C  G+  SE G++CY +
Sbjct: 1368 RCECEMGFVPTVDGRSCKDIDECMFDNICVFGKCENVPGMFRCVCDPGYEIDETGGNCT-DKDECA-DPSNC--FNGICTNTQGSFLCTCPADYQMSPSGQGCV-GTDYRVGKCFLESTERGDGTLSCNVEIGIGISRSSCCCSLGRAWGAPCELCPVVNTTEYRILCPGGEGFRPNPYTVIL---EDIDECTELPGLCQGGNCQNTFGSFKCVCQPGFR-FNEDNRQCEDIDECANFPTVCGPGTCYNIVGNYTCVCPPDYMQVNGGNNCMDMRKSFCYKTYDAAGCDNELSFNLTEKECCCSYNVGKAWNRPCVPCPTISTKAHNQLCGGVPPGYEIDINTGERIDIDECSKIQGICTNGMCVNLP-GSFRCECPMGFLYNDIQIICEDINECASAEKMCQRNAECINSVGSYRCE---------------CSPGYTQTP-FGLCID----RDEC--SEKPEICSPGRCQDTEGSYRCMCPNGYKATEDQNMCMDVDECE------------RQPCGNGTCRNTVGSFNCLCFPGFEISAN-NDCMDKDECVS---------LAAHV--CKFGSCI-NNVGSFKCLCNEGFELTADKKNC--RDINECQQFRGMCAPGTCQNLEGS-FRCMCP-------PGYE-----VKEEACTDIDECSSEEDLCMMGSCLNTFGSFECRCPSGFILSETGRKCYDV 1997          

HSP 9 Score: 81.2629 bits (199), Expect = 1.132e-15
Identity = 147/628 (23.41%), Postives = 219/628 (34.87%), Query Frame = 1
Query:  319 SNKGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGF---------TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGY----RCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYS--------------LCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQ---------YKDYCQNQ--EISKRCRGGQCVSNGNS------------------------YRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRI-EKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGR 2013
            +N G C NG+CI   G F  DC                      NL+ +  +C    + + GNPC        P GF               C+D++EC    +     C+N  GS+ C CP  + L E+   C+  +D+C+    +C           G Y CIC   Y+   +G+ CI +   N C     +C   G C     SY C C  GF  ++D+  C V+S    C +  I   C+    VS  +       C C+G          C   GT++    + C     Y+              +C  G C++    Y+C C+ G+     R  C+ ++          F C+          +Y+C C RG+I  E+GR+C   +        C    H CQ      I    + C C  G++Q      CI N +          K  CQN     S  C+ G  + N  S                        YRC C   Y+      +CV   +   P V           C    C +T  ++ C C NGY   +    C+ + E   ++ P N  C   E                G+ C C PG+  A  G 
Sbjct: 2076 ANPGICANGRCINTDGSFRCDCPMGY------------------NLEAAGFKCVDANECSIGNPCGNGTCLNVPGGFECTCDDGFEPGPMMTCEDLNECSLNPLLCAFRCVNNFGSYECMCPTGYVLREDRRMCK-DQDECEEGLDNCASRNMICKNLIGTYMCICPPGYTRRPDGEGCIDE---NECRLKPGIC-ENGRCINNVGSYKCVCNEGFTLNQDETEC-VDSRRGFCFTEVIQSLCQ---MVSSSRNLVTKSECCCDGGRGWGQQCDICPLPGTAQ--YKKLCPHGPGYTTDGRDIDECTVMPGMCHHGQCINSEGSYHCMCNNGYTTDITRTGCVDLDECAQSPKPCNFICKN------TEGSYQCACPRGYIMQEDGRTCRDLDE-------CASKQHNCQFLCVNTI--GGFTCKCPPGFTQH--HTACIDNNECVSQPGTCGSKGVCQNSPGSFSCECQKGFSLDNSGSNCEDMDECSGNHRCQHGCQNMLGGYRCGCPSGYLQHFQWNQCVDENECTNPQV-----------CGSASCYNTLGSFKCACPNGYNFDQFSGGCNDVNECSHSKAPCNFGCSNTEG---------------GYLCGCPPGYFRAGQGH 2631          
BLAST of Fibrillin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010139.1 (pep scaffold:Pmarinus_7.0:GL476784:79088:131893:1 gene:ENSPMAG00000009155.1 transcript:ENSPMAT00000010139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.5741 bits (205), Expect = 2.152e-16
Identity = 155/701 (22.11%), Postives = 265/701 (37.80%), Query Frame = 1
Query:  535 CPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEI-AERCRGGSCVSEGKGYRCL--CNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKI---ETITSQCALN-------------------QFQCQGGRCQE----LDNNNYECQCLRGFIRSENGRSC---IKAERTRNS--TSICELYGHRCQTGVCYPIYPNEY--ICACLEGYSQSEDRKYCIKNEQYKDYCQ----NQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGG------RCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLR------------CASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIK 2445
            C  GF    N   C+DIDECQ   +C  G+C+N +GSF+C+C P ++L      C+   ++C L  S C   G C+ T DG + C+C   Y  S NG+ C    + + C+  ++   P G+C     S+ C C  G   +    +C+     DI +  E  + RC    C +    YRC+  C+  Y+  ++  EC      E L    C ++        G C +    + C C +G++  ++ + CI +   E  +S C  +                   +F    G+C +    +D+     +    ++   +   C   +    TR+    ++   +G  C+   C  +   E+  +C   +G+  +ED  Y    + +KD  +     QEI KR   G C +  + Y+C C   +       EC+   +          +W     C+GG CV+T+ ++ C C        NG++C      +    +    +L     R MG         +G +T   +C C  G     D   C     D      NI       R G+ + R V     ++  D     +++V       +   L +               C +G CV       C C  GY+       C  + +   +     L             +Y C CL G++ S+    C+K
Sbjct:  895 CGTGFRLTSNGKACEDIDECQNGIVCGGGDCVNTRGSFQCECQPGYHLSSGGDQCE-DINEC-LSESVCEPHGDCLNT-DGSFYCVCHHGYKSSANGRFC---KDVDECSEGQQ--CPGGQCVNTEGSFTCECEPGLRLNPGTHTCV-----DIDECAEFDSSRCGSWRCENTHGSYRCVQACDRGYR-LSSTAEC--QDIDECLDDTVCGRN--------GFCENTEGSFRCLCDQGYHDLQDGQECIDVNECEMFSSVCGDDALCENVEGSFLCICQQHNKEFDTMSGKCVDRHSIVDSRAPGVETKECYVNLNDANFCDNVLAVNLTRHECCCTLGAGWGDNCEIYPCPVLGSVEFKNLCPHGKGFIPNEDIVYDTIPQDFKDADECILFGQEICKR---GTCHNTEHGYKCFCKSGFYYDRQKLECLDVDECT-------DEWS----CEGGSCVNTDGSFDCFCRPPLILDSNGKRCVNSSGLLERHEEEDAEMLMSMCWRAMGNDFMCSQLILGKETTYTECCCQYGEAWGPDCALCPERNTDDFAQLCNI------PRGGDPDMRRVSGQRGTIVSD---VSMHFVKHTEQITFSSGLFDSFEGLQAQECGILNGCENGRCVRVPEGYTCDCYDGYQLDLSRMVCTDVNECEELNERMSLCRNAKCMNT--QGSYRCACLPGFVPSQQPNFCVK 1546          

HSP 2 Score: 80.8777 bits (198), Expect = 1.274e-15
Identity = 198/863 (22.94%), Postives = 310/863 (35.92%), Query Frame = 1
Query:  547 FTQKENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTC-ICIKPYSVSFNGK--SCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYC-SCPSGFHQSE----DKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCV--CHGKYISSNNGQ-----ECVRY---------KQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSR--CMGGRCIGDKTYGFKCLCLPG------FTSASDGRSCDPEYVDQCLNNENICTPGR----------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCD--ILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMD---NPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKE---------------IIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            + ++  RCDDIDEC     +C NG C N  GSFRC C P    D++   CQ   ++C L  + C I G+C+    G Y C  C   + ++  G+     +  N N C        P  +C     SY C  CPSGF        D   C   ++ ++C +   A      SC   G G+R   NG  +   +  EC                 +   +C GG CV+    + C+C  G++ +    +C  I    S+          G C   D + Y C C  G+  S NGR C   +            G +C  G C       + C C  G   +     C+  ++  ++      S RC   +C +   SYRCV  C   Y  S+  +     EC+           + TE     LC +  Y+ L  G EC+D N         G  A      C  +E           C+ Q++      M G+C+    +       PG      + + +D   CD         +E  CT G           C   G+  F+ +CP+      +     I Y T     K  D  IL  +  C  G C N     +C C  G+       EC  +++ +            GG     D +++C C    I   NG+ C+ S   L +    D    +    +C+    ND++C+ ++  K+ T  + C        P CA+   R          D +  +C     +   G   + ++   +   +S+VS    +     T                  I+  C+ G+CV   E Y C C   ++ +     C  D N+C
Sbjct:  736 YNEQLGRCDDIDECSTVPRLCANGRCENVIGSFRCICRPGFIFDDSGAECQ-DINEC-LKVNKC-IGGRCI-NLPGSYRCEFCDAGHVMNTRGQCEDVNECRNPNTC--------PTAKCVNTPGSYECVRCPSGFEGRNGHCIDVDEC---ADGNVCSNGICANTEGSYSCTPCGTGFRLTSNG--KACEDIDEC-----------------QNGIVCGGGDCVNTRGSFQCECQPGYHLSSGGDQCEDINECLSESVCEPH----GDCLNTDGSFY-CVCHHGYKSSANGRFCKDVDECSE--------GQQCPGGQCVNTE-GSFTCECEPGLRLNPGTHTCVDIDECAEF-----DSSRCGSWRCENTHGSYRCVQACDRGYRLSSTAECQDIDECLDDTVCGRNGFCENTEGSFRCLCDQG-YHDLQDGQECIDVNECEMFSSVCGDDAL-----CENVEGSF-------LCICQQHNKEFDTMSGKCV--DRHSIVDSRAPGVETKECYVNLNDANFCDNVLAVNLTRHECCCTLGAGWGDNCEIYPCPVLGSVEFKNLCPHGKGFIPNED---IVYDTIPQDFKDADECILFGQEICKRGTCHNTEHGYKCFCKSGFYYDRQKLECLDVDECTD------EWSCEGGSCVNTDGSFDCFCRPPLILDSNGKRCVNSSGLLERHEEEDA---EMLMSMCWRAMGNDFMCSQLILGKETTYTECCCQYGEAWGPDCALCPER--------NTDDFAQLC----NIPRGGDPDMRRVSGQRGTIVSDVSMHFVKHTEQITFSSGLFDSFEGLQAQECGILNGCENGRCVRVPEGYTCDCYDGYQLDLSRMVCT-DVNEC 1505          

HSP 3 Score: 65.855 bits (159), Expect = 6.085e-11
Identity = 98/407 (24.08%), Postives = 146/407 (35.87%), Query Frame = 1
Query:  337 QNGKCICESGYFGEDCNTAIISTCYVKI-DRGLCKSTPENLQLSKEECCSIFQVAWGN-----PCVFCD----RNYCP--KGFTQKENRC--------DDIDECQF--KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGEC-QPYGLSYYCS--------------CPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSC----VSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKI---ETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTR 1425
             +GKC+                 CYV + D   C +    + L++ ECC      WG+     PC        +N CP  KGF   E+           D DEC    + IC  G C N +  ++C C    Y D   + C    D+C    S  G  G CV T DG + C C  P  +  NGK C+  +     +  +   +    C +  G  + CS              C  G     D   C   +  D  Q   I    RGG      VS  +G        +   + +Q     G  +        +    + CE G CV +   Y C C +G+    +R  C  +   E +  + +L    C+  +C      +Y C CL GF+ S+    C+K +  R
Sbjct: 1158 MSGKCVDRHSIVDSRAPGVETKECYVNLNDANFCDNV-LAVNLTRHECCCTLGAGWGDNCEIYPCPVLGSVEFKNLCPHGKGFIPNEDIVYDTIPQDFKDADECILFGQEICKRGTCHNTEHGYKCFCKSGFYYDRQKLEC-LDVDECTDEWSCEG--GSCVNT-DGSFDCFCRPPLILDSNGKRCVNSSGLLERHEEEDAEMLMSMCWRAMGNDFMCSQLILGKETTYTECCCQYGEAWGPDCALCPERNTDDFAQLCNIP---RGGDPDMRRVSGQRGTIVSDVSMHFVKHTEQITFSSGLFDSFEGLQAQECGILNGCENGRCVRVPEGYTCDCYDGYQLDLSRMVCTDVNECEELNERMSL----CRNAKCMNT-QGSYRCACLPGFVPSQQPNFCVKIQNER 1551          

HSP 4 Score: 61.6178 bits (148), Expect = 1.035e-9
Identity = 121/510 (23.73%), Postives = 198/510 (38.82%), Query Frame = 1
Query:  847 NVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYEC-QCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQ------ECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLN-NENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINY-VTTEPTTKYCDILVNRLRCA-SGNCVND----RCICGPGYKSSEDGKECYKI---EKVSSI 2325
            ++C     +C P G+C    + Y C+C  G+  +E    C      DI +   +   C  G C +    +RC+C   +   ++  EC             C K    + C GG C++L   Y C+  +  +    R +C  +    ++C  N   C   +C      +YEC +C  GF    NG  CI  +   +        G+ C  G+C     +     C  G+  + + K C    +  D CQN  +   C GG CV+   S++C C   Y  S+ G       EC+     EP    L +   +Y +C  G                Y ++ NGR C  +++    +             +C GG+C+ +    F C C PG        +C    +D+C   + + C   RCE +  S +RCV            +C   Y +++    +  D  ++   C  +G C N     RC+C  GY   +DG+EC  +   E  SS+
Sbjct:  705 DICLLRPNICGP-GQCYNLDVGYTCTCHFGYQYNEQLGRC-----DDIDECSTVPRLCANGRCENVIGSFRCICRPGFIFDDSGAECQDI--------NECLK---VNKCIGGRCINLPGSYRCEFCDAGHVMNTRGQCEDV----NECR-NPNTCPTAKCVNTP-GSYECVRCPSGF-EGRNGH-CIDVDECAD--------GNVCSNGICANTEGSYSCTPCGTGFRLTSNGKAC----EDIDECQNGIV---CGGGDCVNTRGSFQCECQPGYHLSSGGDQCEDINECLSESVCEPHGDCLNTDGSFYCVCHHG----------------YKSSANGRFCKDVDECSEGQ-------------QCPGGQCV-NTEGSFTCECEPGLRLNPGTHTC--VDIDECAEFDSSRCGSWRCENTHGS-YRCV-----------QACDRGYRLSSTAECQDIDECLDDTVCGRNGFCENTEGSFRCLCDQGYHDLQDGQECIDVNECEMFSSV 1130          

HSP 5 Score: 58.5362 bits (140), Expect = 1.023e-8
Identity = 161/726 (22.18%), Postives = 256/726 (35.26%), Query Frame = 1
Query:  598 SICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCL-CNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYC-QCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIE--KQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPY----YASLSK---DGHSCLINYVTTEPTTKYCDILVNRL----RCASGNCVNDRCIC--GPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            +IC  G+C N    + C C   +  +E    C    D+C      C   G+C     G + CIC   +    +G  C    + N C    K C+  G C     SY C      H    +  C    + + C++P     C    CV+    Y C+ C   ++G N    C+            C+     ++C  G C +    Y C  C  GF  T N + C  I+        N   C GG C      +++C+C  G+  S  G  C        S S+CE +G    T          + C C  GY  S + ++C      KD  +  E  ++C GGQCV+   S+ C C      +     CV   +        C  W   +      CV               A + G + S     + + E  D++ C    +     G          F+CLC  G+    DG+ C    V++C    ++C       +   +F C+C      + ++S    D HS +++       TK C + +N         + N     C C  G G+    D  E Y    + S+   N                  C    G+I +E+       +            +E CK G C+   ++ Y C C  G+     K  C+ +D      +E+ C+GG C +    + C C     +  NG+ C+
Sbjct:  712 NICGPGQCYNLDVGYTCTCHFGYQYNEQLGRCD-DIDECSTVPRLCA-NGRC-ENVIGSFRCICRPGFIFDDSGAEC---QDINECLKVNK-CI-GGRCINLPGSYRCEFCDAGHVMNTRGQC---EDVNECRNPNT---CPTAKCVNTPGSYECVRCPSGFEGRNG--HCIDVDE--------CADG---NVCSNGICANTEGSYSCTPCGTGFRLTSNGKACEDIDECQ-----NGIVCGGGDCVNT-RGSFQCECQPGYHLSSGGDQCEDINECL-SESVCEPHGDCLNTD-------GSFYCVCHHGYKSSANGRFC------KDVDECSE-GQQCPGGQCVNTEGSFTCECEPGLRLNPGTHTCVDIDECAEFDSSRCGSWRCENTHGSYRCVQ--------------ACDRGYRLSSTAECQDIDECLDDTVCGRNGFCENTEG---------SFRCLCDQGYHDLQDGQECI--DVNECEMFSSVCGDDALCENVEGSFLCICQQHNKEFDTMSGKCVDRHS-IVDSRAPGVETKECYVNLNDANFCDNVLAVNLTRHECCCTLGAGWG---DNCEIYPCPVLGSVEFKNL-----------------CPHGKGFIPNEDIVYDTIPQDFKDADECILFGQEICKRGTCHNT-EHGYKCFCKSGFYYDRQKLECLDVDE---CTDEWSCEGGSCVNTDGSFDCFCRPPLILDSNGKRCV 1339          

HSP 6 Score: 53.5286 bits (127), Expect = 2.697e-7
Identity = 99/421 (23.52%), Postives = 163/421 (38.72%), Query Frame = 1
Query: 1432 TSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCA-VNEYRCKGGYCYDIVDGYLCI 2679
            + IC L  + C  G CY +    Y C C  GY  +E    C       D  +   + + C  G+C +   S+RC+C   +I  ++G EC    +        C K    + C GG C++   +Y C+  +  +      +C  + +     P+            C   +C+ +    ++C+  P      +G   D   VD+C +  N+C+ G C  +  S     C     L+ +G +C           +  D   N + C  G+CVN R    C C PGY  S  G +C  I +  S     +  C+  G     D ++ C C +GY  S NGR C   +             ++C  G C    +  + C C  G +      +C+ +D  +CA  +  RC    C +    Y C+
Sbjct:  704 SDICLLRPNICGPGQCYNLDVG-YTCTCHFGYQYNEQLGRC------DDIDECSTVPRLCANGRCENVIGSFRCICRPGFIFDDSGAECQDINE--------CLK---VNKCIGGRCINLPGSYRCEFCDAGHVMNTRGQCEDVNE--CRNPNT-----------CPTAKCV-NTPGSYECVRCPSGFEGRNGHCID---VDECADG-NVCSNGICANTEGSYSCTPCGTGFRLTSNGKAC-----------EDIDECQNGIVCGGGDCVNTRGSFQCECQPGYHLSSGGDQCEDINECLS-----ESVCEPHGDCLNTDGSFYCVCHHGYKSSANGRFCKDVDEC--------SEGQQCPGGQCVNT-EGSFTCECEPGLRLNPGTHTCVDID--ECAEFDSSRCGSWRCENTHGSYRCV 1061          
BLAST of Fibrillin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005398.1 (pep scaffold:Pmarinus_7.0:GL477786:13802:46188:-1 gene:ENSPMAG00000004892.1 transcript:ENSPMAT00000005398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 3.761e-15
Identity = 114/421 (27.08%), Postives = 173/421 (41.09%), Query Frame = 1
Query:  526 RNYCPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNND-QECVRYGTSEPLVSRYCSKSEYYSLCEGGSC-VDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHR-CQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQT----EPPAVRLCSKWEYYS 1761
            R  C  GF    N  RCDD+DEC  +  C NGEC+N  GSF+C CPP   L + T +C+   D+C   G+ C   G C+ T  G + C C +P   +  G       + + C+     C  +  C     S+ C C  G+  +++   C+     DI +   I E C    C +E   + C+C  +YQ +++   +CV     EP V      S+ +   E   C  ++N++  C+   G   T +   C       + C  +    +G R       N  C   +G + S NGR    A+        C L+    C+  +C       Y C C  GY     R +C       D C+N   S+ C  GQC ++  SY C C       + G+ CV    +    +P  V L   W+  S
Sbjct:  275 RCSCNPGFAPSGNGKRCDDVDECAERP-CQNGECVNTPGSFKCSCPPGFQLSDGT-NCR-DIDECST-GNEC-EGGTCINTV-GSFQCGC-QPGFAALPGTDLCCSADVDECDN-ATACSEHQYCINSMGSFQCHCDQGYQTAKEGLGCV-----DINECETITEVCGSELCDNEEGTFLCICPNDYQEFDSQLGKCV----PEPTVG-----SQSHVPAERRECYFNVNDENVCRNVLGRNVTRDECCCTVGAGWGTDCEPSPCPLEGTR-----EFNELCPEGKGLVPSPNGRGYRDADE-------CTLFSQELCRDSLCVNTQAG-YKCYCRTGYLYDRSRLHCTD----VDECEN---SQSCVDGQCYNSEGSYSCYCTAPLTLDHTGRRCVNRTASSSGDDPAHVFLDICWKEVS 653          

HSP 2 Score: 72.7886 bits (177), Expect = 2.949e-13
Identity = 114/487 (23.41%), Postives = 174/487 (35.73%), Query Frame = 1
Query: 1171 LCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRC-VCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLL------------------QEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKS--------SEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDY 2538
            +C  G CV L+  + C C+ G+    +   CI ++    +CA +   C GGRC+      + C C +G+  S  G  CI  +    + + C   G    T          Y C C  GYS S D+    +  +Y + C+N  +   C GG+CV+   S+RC  C   Y            ++ +  +   C K     +         +  +           +N + C  I K+    P    C+L                      + C  GRCI D    ++C C PGF  + +G+ CD   VD+C   E  C  G C  +  S F+C CP    LS DG +C           +  D       C  G C+N     +C C PG+ +        S D  EC      S                     +++C C  GY  ++ G  C+          +C       + G    I  NDY
Sbjct:   10 ICGHGECVHLDRGHTCVCNGGYKLNPSLTHCIDVD----ECARSPAPCPGGRCENT-RGGFRCVCSQGYAASRGGTECIDVDECERADA-CGGNGRCVNTA-------GGYTCNCDRGYSLSTDKGE-TRRSEYVNECENTIL---CPGGRCVNLPGSHRCEFCDPGYQWRGQTGGVDERRRPKTKSKERCRKLAQREITNTSTTPPLSPPHLNLIAADIDECQNPQAC--INKRCVNIPGAFECVLCPTGFKAAGTKCEDVNECLNSTAVCRDGRCI-DLQGSYRCSCNPGFAPSGNGKRCDD--VDECA--ERPCQNGECVNTPGS-FKCSCPPGFQLS-DGTNC-----------RDIDECSTGNECEGGTCINTVGSFQCGCQPGFAALPGTDLCCSADVDECDNATACSEHQYCINSM-----------GSFQCHCDQGYQTAKEGLGCVDINECETITEVCGSELCDNEEGTFLCICPNDY 448          

HSP 3 Score: 70.0922 bits (170), Expect = 1.874e-12
Identity = 170/724 (23.48%), Postives = 263/724 (36.33%), Query Frame = 1
Query:  742 FGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRG-GSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQ-CSEGFY--------------ATENRRRCIKIE----TITSQCA------LNQFQCQGGRCQELDN----------NNYEC-QCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPY-YASLSKDGHSCLI-------NYVTTEPTTKYCDI-LVNRLRCASG-NCVNDRCIC--GPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEV 2766
             G+CV    G +TC+C   Y ++ +   CI   + + C      C P G C+     + C C  G+  S     CI   + D C   E A+ C G G CV+   GY C C+  Y    +  E  R        S Y ++ E   LC GG CV+L   + C+ C  G+                T+++ RC K+     T TS         LN        CQ                +EC  C  GF  +  G  C       NST++C       + G C  +    Y C+C  G++ S + K C   ++  +        + C+ G+CV+   S++C C   +  S+ G  C           R   +    + C+GG C++T  ++ C C  G+ A      C   +  V E  + + C   +Y    MG          F+C C  G+ +A +G  C    +++C     +C    C+      F C+CP  Y         C+        ++V  E    Y ++   N  R   G N   D C C  G G+ +  +   C  +E                        N  C    G + S NGR    ++   +        +E C+  +C    Q  Y C C  GY     +  C  +D      N   C  G CY+    Y C C    T+   GR C+ +  +    D + V
Sbjct:   13 HGECVHLDRG-HTCVCNGGYKLNPSLTHCI---DVDECARSPAPC-PGGRCENTRGGFRCVCSQGYAASRGGTECI---DVDEC---ERADACGGNGRCVNTAGGYTCNCDRGYSLSTDKGETRR--------SEYVNECENTILCPGGRCVNLPGSHRCEFCDPGYQWRGQTGGVDERRRPKTKSKERCRKLAQREITNTSTTPPLSPPHLNLIAADIDECQNPQACINKRCVNIPGAFECVLCPTGFKAA--GTKCEDVNECLNSTAVC-------RDGRCIDLQ-GSYRCSCNPGFAPSGNGKRCDDVDECAE--------RPCQNGECVNTPGSFKCSCPPGFQLSD-GTNC-----------RDIDECSTGNECEGGTCINTVGSFQCGCQPGFAALPGTDLCCSAD--VDECDNATACSEHQYCINSMGS---------FQCHCDQGYQTAKEGLGC--VDINECETITEVCGSELCDNE-EGTFLCICPNDYQEFDSQLGKCVPEPTVGSQSHVPAERRECYFNVNDENVCRNVLGRNVTRDECCCTVGAGWGTDCEPSPC-PLEGTREF-------------------NELCPEGKGLVPSPNGRGYRDADECTL------FSQELCRDSLCVNT-QAGYKCYCRTGYLYDRSRLHCTDVDE---CENSQSCVDGQCYNSEGSYSCYCTAPLTLDHTGRRCVNRTASSSGDDPAHV 643          

HSP 4 Score: 63.5438 bits (153), Expect = 2.032e-10
Identity = 100/420 (23.81%), Postives = 156/420 (37.14%), Query Frame = 1
Query:  589 QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRC-LCNGEYQGYNN----------------------DQECVRYGTSEP-------LVSRYCSKSEYYSLCEGGSCVDLNNDYYC-QCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEY 1755
            Q   IC +GEC++      C C   + L+ +   C    D+C    + C   G+C  T  G + C+C + Y+ S  G  CI   + + C      C   G C      Y C+C  G+  S DK     +   + C++  +   C GG CV+    +RC  C+  YQ                           +E     T+ P       L++    + +    C    CV++   + C  C  GF A        K E + ++C  +   C+ GRC +L   +Y C C  GF  S NG+ C   +         E     CQ G C    P  + C+C  G+  S+       N +  D C        C GG C++   S++C C   + +      C      E      CS+ +Y
Sbjct:    6 QTPDICGHGECVHLDRGHTCVCNGGYKLNPSLTHC-IDVDECARSPAPC-PGGRCENTRGG-FRCVCSQGYAASRGGTECI---DVDECER-ADACGGNGRCVNTAGGYTCNCDRGYSLSTDKGETRRSEYVNECENTIL---CPGGRCVNLPGSHRCEFCDPGYQWRGQTGGVDERRRPKTKSKERCRKLAQREITNTSTTPPLSPPHLNLIAADIDECQNPQACINKRCVNIPGAFECVLCPTGFKAAG-----TKCEDV-NECLNSTAVCRDGRCIDL-QGSYRCSCNPGFAPSGNGKRCDDVD---------ECAERPCQNGECVNT-PGSFKCSCPPGFQLSDG-----TNCRDIDECS---TGNECEGGTCINTVGSFQCGCQPGFAALPGTDLCCSADVDECDNATACSEHQY 390          

HSP 5 Score: 55.8398 bits (133), Expect = 5.361e-8
Identity = 83/367 (22.62%), Postives = 133/367 (36.24%), Query Frame = 1
Query:  520 CDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQ-CPPDHYLDENTMSCQYRR-------DQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPY------------------------GECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAER-CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETI----TSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSIC--ELYGHRCQTGVCYPIYPNEY 1503
            CDR Y       +  R + ++EC+   +C  G C+N  GS RC+ C P +     T     RR       ++C+             P     +  +         N ++CI K   N+   F+ +  P                         G C     SY CSC  GF  S + K C      D+    E AER C+ G CV+    ++C C   +Q             S+    R   +    + CEGG+C++    + C C  GF A      C   +       + C+ +Q+             +++C C +G+  ++ G  C+        T +C  EL  +   T +C  I PN+Y
Sbjct:  111 CDRGYSLSTDKGETRRSEYVNECENTILCPGGRCVNLPGSHRCEFCDPGYQWRGQTGGVDERRRPKTKSKERCRKLAQREITNTSTTPPLSPPHLNLIAADIDECQNPQACINKRCVNIPGAFECVLCPTGFKAAGTKCEDVNECLNSTAVCRDGRCIDLQGSYRCSCNPGFAPSGNGKRC-----DDV---DECAERPCQNGECVNTPGSFKCSCPPGFQ------------LSDGTNCRDIDECSTGNECEGGTCINTVGSFQCGCQPGFAALPGTDLCCSADVDECDNATACSEHQYCIN-------SMGSFQCHCDQGYQTAKEGLGCVDINECETITEVCGSELCDNEEGTFLC--ICPNDY 448          

HSP 6 Score: 51.6026 bits (122), Expect = 1.008e-6
Identity = 58/227 (25.55%), Postives = 96/227 (42.29%), Query Frame = 1
Query:  226 CVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQ---CQNGKCICESGYFGEDCNTAIISTCYVKI-DRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRC----------------DDIDECQFKS--ICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKT 840
            CV +N CE   +   +E C  N +      C N  Q    Q GKC+ E     +    A    CY  + D  +C++      ++++ECC      WG     C+ + CP   T++ N                   D DEC   S  +C +  C+N +  ++C C   +  D + + C    D+C+    SC + G+C   S+G Y+C C  P ++   G+ C+ +T
Sbjct:  415 CVDINECETITEVCGSELC-DNEEGTFLCICPNDYQEFDSQLGKCVPEPTVGSQSHVPAERRECYFNVNDENVCRNV-LGRNVTRDECCCTVGAGWG---TDCEPSPCPLEGTREFNELCPEGKGLVPSPNGRGYRDADECTLFSQELCRDSLCVNTQAGYKCYCRTGYLYDRSRLHCT-DVDECE-NSQSC-VDGQCY-NSEGSYSCYCTAPLTLDHTGRRCVNRT 632          
BLAST of Fibrillin-2 vs. Ensembl Sea Lamprey
Match: FBLN5 (fibulin 5 [Source:HGNC Symbol;Acc:HGNC:3602])

HSP 1 Score: 63.929 bits (154), Expect = 1.110e-10
Identity = 58/178 (32.58%), Postives = 86/178 (48.31%), Query Frame = 1
Query:  535 CPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGG-SCVSEGKGYRCL 1065
            CP+G+     +C DIDEC++  +C  G C+N +GS+ CQC P + L  N  SC+   D+C + GS C     C  T  G + C C   + +  +G +C    + + C+Y   LC     C     SY CSCP G+    D  SC      D+ +    +  C G  +C +   GY+CL
Sbjct:  159 CPEGYQMVAGQCVDIDECRY-GMCAQG-CVNTQGSYTCQCSPGYVLSSNNRSCE-DVDEC-VEGSPCSQL--CFNTY-GSFLCRCSPGFVLDGDGLTC---KDVDECSYSDYLC--QYRCNNNAGSYSCSCPGGYQLQTDNGSC-----RDVDECATNSHNCTGNENCYNVFGGYKCL 319          
BLAST of Fibrillin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006555.1 (pep scaffold:Pmarinus_7.0:GL476370:200676:210822:-1 gene:ENSPMAG00000005922.1 transcript:ENSPMAT00000006555.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 1.210e-9
Identity = 130/533 (24.39%), Postives = 198/533 (37.15%), Query Frame = 1
Query:  565 RCDDIDECQ--FKSICLNGECINEKGSFRCQCPPDHYLDENTM--SCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKI-ETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGH 2148
             C D+DECQ    +      C N  G++ C C   +YL+E  M  +C    D+C+  GS+    G     + G Y C C+  Y    NG  C+   + + C      C     C     SY C C +GF ++ +     + ++ D C     A   +G  CV+    Y C C   Y G  N   C+       L S  CS +         +C +    + CQC  GF  T    +C+ + E  TS  A     C  G        +Y C CL G+I   NG  C+  +        C L  + C         P  + C C  G+ ++ ++  C+   +    CQ    +    G  CV+   SY C+C   YI   NG  C+   +   P+    +     S C+                     +E G KC  + +  T    ++ C    Y    +G          + CLCL G+    +G  C    VD+CL   N C+     ++   +F+C C   A    D H
Sbjct:   27 TCQDVDECQSGIYNCTQYSTCHNLDGNYTCICNSGYYLNEFPMQRTC-IDVDECEKAGSALCGHGAYCANTLGSYACRCLVGY--VGNGTVCL---DVDECLLPSNNCSANSTCTNTPGSYQCQCDAGFQKTGE-----MCTDVDECLKFGSAACGQGAYCVNTVGSYNCPCLAGYIG--NGTVCLDVDECL-LPSNNCSANS--------TCKNTPGSFQCQCDAGFQKT--GEKCVDVNECQTSGSA----ACGPGAYCVNTVGSYNCPCLAGYIG--NGTVCLDVDE-------CLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEK--CVDVNE----CQTSGSAACGPGAYCVNTVGSYNCLCLAGYIG--NGTVCLDVDECLLPS----NNCSANSTCKNTPGSFQCQCDAGFQNVFPPPSETGEKCVDVNECHTS--GSAACGPGAYCVNTVG---------SYNCLCLAGYI--GNGTVCLD--VDECLLPSNNCSANSTCKNTPGSFQCQCD--AGFQSDFH 493          

HSP 2 Score: 60.4622 bits (145), Expect = 2.031e-9
Identity = 96/351 (27.35%), Postives = 138/351 (39.32%), Query Frame = 1
Query:  535 CPKGFTQKENRCDDIDECQFKS--ICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGS-SCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFY-----ATENRRRCIKI-ETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK 1560
            C  G+      C D+DEC   S     N  C N  GSF+CQC  D    +    C    ++CQ  GS +CG    CV T  G Y C C+  Y    NG  C+   + + C      C     C+    S+ C C +GF ++ +K  C+   + + CQ+   A    G  CV+    Y CLC   Y G  N   C+       L S  CS +         +C +    + CQC  GF       +E   +C+ + E  TS  A     C  G        +Y C CL G+I   NG  C+  +        C L  + C         P  + C C  G+ QS+   + ++
Sbjct:  187 CLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQC--DAGFQKTGEKC-VDVNECQTSGSAACGPGAYCVNTV-GSYNCPCLAGY--IGNGTVCL---DVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEK--CV---DVNECQTSGSAACGPGAYCVNTVGSYNCLCLAGYIG--NGTVCLDVDECL-LPSNNCSANS--------TCKNTPGSFQCQCDAGFQNVFPPPSETGEKCVDVNECHTSGSA----ACGPGAYCVNTVGSYNCLCLAGYIG--NGTVCLDVDE-------CLLPSNNCSANSTCKNTPGSFQCQCDAGF-QSDFHGFGMR 498          
BLAST of Fibrillin-2 vs. Ensembl Nematostella
Match: EDO38786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBY8])

HSP 1 Score: 118.627 bits (296), Expect = 5.553e-28
Identity = 121/479 (25.26%), Postives = 195/479 (40.71%), Query Frame = 1
Query:  406 CYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCP--KGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQ-------YRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKK---TNYN---------VCNYFKKLC---------------LPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPP 1725
            CY  +   +C S    +  ++  CC+    AWGNPC  C     P  +GF    K   C D+DEC+   +IC NG C+N  G +RC+CP    L ++ M C        Y+R    +    C + G  + T+     C  ++  +   + K C      T+ N         VC Y + LC                  G+C     S+ C+C  GF  S D+  C    + D C+  ++   C+ G C +    +RC+CN  Y+  ++  +CV        ++   ++ E   +C  G C +    Y C C+ G+ A     +C  I    ++C+     C  GRC       Y C C  G+I S +G  C+  +   N+     +    C  G C      +Y C C  GY     +K C+      D  +  E  + C+GGQC +   +++C C G +I  +  + C    +   P
Sbjct:    3 CYTVVKNRMCHSQLIGVVCTRNLCCATIGQAWGNPCERCPLKPAPCDRGFLPNYKTKACQDVDECKTITNICANGRCVNTNGGYRCECPRGFALSQDGMYCIGNTPGRCYKR----IVNGYCHM-GSSLSTTQAACCCSMMQSKAWGPDCKRCPAPGTGTSLNIACGRVYGVVCIYKRTLCCVDISDVDECTDESVCTNGQCINNIGSFTCTCRRGFTLSLDRTRC---DDMDECREKDV---CKNGRCQNVNGAFRCICNKGYELSSDRTQCVD-------INECLTQGE---MCRNGVCENTEGSYRCICNAGYAANAEENKCADI----NECSTIPDVCMNGRCAN-SPGGYSCICNSGYITSADGHHCVDIDECENAAG---MKKGMCVNGKCRNTN-GDYTCDCNSGYRNDATQKLCL------DINECLENPRLCQGGQCKNLPGTFQCTCSGGFIYDSATEMCKDIDECADP 445          

HSP 2 Score: 85.1149 bits (209), Expect = 3.468e-17
Identity = 88/284 (30.99%), Postives = 123/284 (43.31%), Query Frame = 1
Query:  535 CPKGFTQK--ENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAER--CRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRG 1374
            C +GFT      RCDD+DEC+ K +C NG C N  G+FRC C   + L  +   C    ++C   G  C   G C  T +G Y CIC   Y+ +     C    + N C+    +C+  G C      Y C C SG+  S D   C+   + D C++    ++  C  G C +    Y C CN    GY ND        ++ L        E   LC+GG C +L   + C CS GF        C  I+    +CA +  +C  G C      +Y C+C RG
Sbjct:  210 CRRGFTLSLDRTRCDDMDECREKDVCKNGRCQNVNGAFRCICNKGYELSSDRTQC-VDINECLTQGEMC-RNGVCENT-EGSYRCICNAGYAANAEENKC---ADINECSTIPDVCM-NGRCANSPGGYSCICNSGYITSADGHHCV---DIDECENAAGMKKGMCVNGKCRNTNGDYTCDCN---SGYRND-------ATQKLCLDINECLENPRLCQGGQCKNLPGTFQCTCSGGFIYDSATEMCKDID----ECA-DPDRCVYGTCTNT-RGSYRCECPRG 467          

HSP 3 Score: 79.337 bits (194), Expect = 2.653e-15
Identity = 119/473 (25.16%), Postives = 176/473 (37.21%), Query Frame = 1
Query: 1558 KNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDN--------SYCLLQEYL--------------SRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSE----SALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHS 2883
            K +  +D  + + I+  C  G+CV+    YRC C   +  S +G  C+            C K      C  G  + T     C       A   G  C R     T    N          C+ +  L              S C  G+CI +    F C C  GFT + D   CD   +D+C   +++C  GRC+   N  FRC+C     LS D   C+ IN           + L     C +G C N     RCIC  GY ++ +  +C  I + S+I  +                 Y C C +GYI S +G  C+  +    +A +KK +C     KC+          DY C C  GY+    +K C  +D  +C  N   C+GG C ++   + C C G +         I         DI E +  +P            ++C  G C   +  Y+C+CP  
Sbjct:   57 KTKACQDVDECKTITNICANGRCVNTNGGYRCECPRGFALSQDGMYCIGNTPGR------CYKRIVNGYCHMGSSLSTTQAACCCSMMQSKAW--GPDCKRCPAPGTGTSLNIACGRVYGVVCIYKRTLCCVDISDVDECTDESVCTNGQCI-NNIGSFTCTCRRGFTLSLDRTRCDD--MDEC-REKDVCKNGRCQNV-NGAFRCICNKGYELSSDRTQCVDIN-----------ECLTQGEMCRNGVCENTEGSYRCICNAGYAANAEENKCADINECSTIPDVCMNGRCAN-----SPGGYSCICNSGYITSADGHHCVDIDECENAAGMKKGMC--VNGKCRNT------NGDYTCDCNSGYRNDATQKLC--LDINECLENPRLCQGGQCKNLPGTFQCTCSGGF---------IYDSATEMCKDIDECA--DP------------DRCVYGTCTNTRGSYRCECPRG 467          

HSP 4 Score: 72.7886 bits (177), Expect = 3.682e-13
Identity = 112/433 (25.87%), Postives = 168/433 (38.80%), Query Frame = 1
Query:  886 GECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNND-QECVRYGTSEPL----------VSRY-----------CSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCP 2118
            G C      Y C CP GF  S+D   CI N+    C    +   C  GS +S  +   C    + + +  D + C   GT   L          V  Y             +    S+C  G C++    + C C  GF  + +R RC  ++    +       C+ GRCQ + N  + C C +G+  S +   C+           C   G  C+ GVC       Y C C  GY+ + +   C       D  +   I   C  G+C ++   Y C+C+  YI+S +G  CV   + E  A           +C  G+C +TN +Y C C +GY      + C  I +          CL    L  C GG+C  +    F+C C  GF   S    C  + +D+C + +  C  G C  +  S +RC CP
Sbjct:   77 GRCVNTNGGYRCECPRGFALSQDGMYCIGNTPGR-CYKRIVNGYCHMGSSLSTTQAACCCSMMQSKAWGPDCKRCPAPGTGTSLNIACGRVYGVVCIYKRTLCCVDISDVDECTDESVCTNGQCINNIGSFTCTCRRGFTLSLDRTRCDDMDECREK-----DVCKNGRCQNV-NGAFRCICNKGYELSSDRTQCVDINE-------CLTQGEMCRNGVCENT-EGSYRCICNAGYAANAEENKC------ADINECSTIPDVCMNGRCANSPGGYSCICNSGYITSADGHHCVDIDECENAA------GMKKGMCVNGKCRNTNGDYTCDCNSGYRNDATQKLCLDINE----------CLENPRL--CQGGQC-KNLPGTFQCTCSGGFIYDSATEMC--KDIDECADPDR-CVYGTCTNTRGS-YRCECP 465          

HSP 5 Score: 59.6918 bits (143), Expect = 4.226e-9
Identity = 100/429 (23.31%), Postives = 160/429 (37.30%), Query Frame = 1
Query: 1978 CLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIE-------------KVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGR---SCIKSESALIKKSICD-----LHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCP--------YCFYG-CFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTCRTKSLNRTLNIKFSGIFKFSTGSPSEVKQSIEK 3174
            C  GF      ++C  + VD+C    NIC  GRC  + N  +RC CP   +LS+DG  C+ N     P   Y  I+       S         C    +S   G +C +               +V  +  + +         ++D+   E  C NG   +  G    +C +  +  + ++ CD       ++ CK G C  +    + C C  GY+ ++D+  C+  D  +C      C+ G C +    Y CIC   Y        C          DI+E S              I + C  G+C      Y C C   + T+   H CV D ++C          C  G C + N   TC C+  Y N     LC+  ++ +         + K+L  T     SG F +   S +E+ + I++
Sbjct:   48 CDRGFLPNYKTKAC--QDVDECKTITNICANGRCVNT-NGGYRCECPRGFALSQDGMYCIGN----TPGRCYKRIVNGYCHMGSSLSTTQAACCCSMMQSKAWGPDCKRCPAPGTGTSLNIACGRVYGVVCIYKRTLCCVDISDVDECTDESVCTNGQCINNIGSFTCTCRRGFTLSLDRTRCDDMDECREKDVCKNGRCQNV-NGAFRCICNKGYELSSDRTQCV--DINECLTQGEMCRNGVCENTEGSYRCICNAGYAANAEENKC---------ADINECS-------------TIPDVCMNGRCANSPGGYSCICNSGYITSADGHHCV-DIDECENAAGMKKGMCVNGKCRNTNGDYTCDCNSGYRNDATQKLCLDINECLENPRLCQGGQCKNLPGTFQCTCSGGFIYD--SATEMCKDIDE 441          
BLAST of Fibrillin-2 vs. Ensembl Nematostella
Match: EDO38789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBZ1])

HSP 1 Score: 101.293 bits (251), Expect = 9.046e-22
Identity = 161/676 (23.82%), Postives = 249/676 (36.83%), Query Frame = 1
Query:  310 NNCSNKGQCQNG---------KCICESGYFGEDCNTAIISTCYVKIDRGLC-KSTPENLQLS-KEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKS-ICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI---------VNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECV---RYGTSEPLVSRYCSKSE---YYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKY------CIKNEQYKDY-CQN--------------------------QEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL 2157
            + C   G C +G          C+C  GY   D     +      + +GLC   T  N + S + EC   F++  G             GF      C DIDEC  ++ +C NG CIN +GSF CQC   + L  +   C    ++CQ     C   G+C  T  G   C C+  Y+++  GK   +  + N C+     C P G C     SY C C  GF        C+         V  N + C  P   +  +   C + GKG+   C         +   +     G +    +R+   +E      LC  G C++ +  + CQC  GF    +   C       ++C      C+ G C  ++  +Y C C  G+  + +  SC   +  R    +C    +RC         P  + CAC  G+  S ++++      C KN +   Y C+N                          QE    CR G CV+    Y C C+  Y  S NG+ C   ++       LC       LC+             +          G  C     + T E  N   + +     C+ G+CI  K  GF+C+C  G+  + +GR C    +++C     +C    C+ +  S + C CP    +  D   CL
Sbjct:   83 DECGTPGYCDHGMCKNMNGSFSCVCNQGYHLTDNKRTCVDMNECILGKGLCGNGTCINTEGSYRCECHPGFKLNRG-------------GF------CQDIDECVMEADVCRNGMCINTEGSFTCQCIAGYTLSADRRHC-IDVNECQDVPGFC-ENGRCTNTIGGAR-CECVAGYALNTEGKI-TRCVDVNECDENPNFCRPGGRCVNTPGSYRCLCDPGFQSYNGGTVCVDSREDFCFDVFDNENSCTKPRPIKMTKSVCCCTLGKGWGDPCELCPSPKTPEFSIICPKGVGIARKNGTRFEDVNECTMMPDLCRNGVCINNDGSFRCQCKMGFKLDASGHHCED----KNECVETPGICKTGNCTNIE-GSYTCTCPVGYAPTRDSPSCSDIDECRERAGLC---AYRCIN------TPGSFKCACPNGFELSTNQRHCKDINECKKNPELCPYGCKNFVGGYRCTCPDGYRGDGRTCTDINECQERRGLCRNGACVNIDGGYVCNCNPGYKRSKNGKRCEDQRKG------LCFATVTDGLCEA--VTKQMMQVSKRDCCCTAGKAWGISCELCPAKDTMELGNGMNVCEMTSGLCINGKCISIKG-GFRCMCNVGYKLSMNGRKC--YDINECEGPTKVCQ-FDCKNTDGS-YECSCPKGYQVDADKKKCL 708          

HSP 2 Score: 99.3673 bits (246), Expect = 3.268e-21
Identity = 178/746 (23.86%), Postives = 291/746 (39.01%), Query Frame = 1
Query:  535 CPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSIC-----ELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKK--SICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMD--NPKCAVNEYRCKGGYCYDIVDG-YLCICVGNYTVTENGRDCI 2724
            CP+GFT      +C D+DEC     C +G C N  GSF C C   ++L +N  +C    ++C L    CG  G C+ T +G Y C C   + ++  G       + + C     +C   G C     S+ C C +G+  S D++ CI     D+ +  ++   C  G C +   G RC C   Y   N + +  R      +    C ++  +    GG CV+    Y C C  GF +      C+                          ++ E  C   F   +N  SC K    + + S+C     + +G  C+  +C      E+   C +G   +          +++D  +   +   CR G C++N  S+RC C   +    +G  C    +            E   +C+ G C +   +Y C C  GY  T +   CS I++             +E    C   RCI +    FKC C  GF  +++ R C  + +++C  N  +C  G   ++    +RC CP       DG +C          T   +    R  C +G CVN      C C PGYK S++GK C    K     ++    C+    Q +  +  +C C  G     +   C   ++  +    ++C++    C  G C  I +  + C C +GYK + + + C  ++       V ++ CK        DG Y C C   Y V  + + C+
Sbjct:   66 CPEGFTPDVTGLKCTDMDECGTPGYCDHGMCKNMNGSFSCVCNQGYHLTDNKRTC-VDMNECILGKGLCG-NGTCINT-EGSYRCECHPGFKLNRGGFC----QDIDECVMEADVCR-NGMCINTEGSFTCQCIAGYTLSADRRHCI-----DVNECQDVPGFCENGRCTNTIGGARCECVAGY-ALNTEGKITRC-----VDVNECDENPNFCR-PGGRCVNTPGSYRCLCDPGFQSYNGGTVCV--------------------------DSREDFCFDVF---DNENSCTKPRPIKMTKSVCCCTLGKGWGDPCE--LCPSPKTPEFSIICPKGVGIARK-----NGTRFEDVNECTMMPDLCRNGVCINNDGSFRCQCKMGFKLDASGHHCEDKNEC----------VETPGICKTGNCTNIEGSYTCTCPVGYAPTRDSPSCSDIDE------------CRERAGLC-AYRCI-NTPGSFKCACPNGFELSTNQRHC--KDINECKKNPELCPYGC--KNFVGGYRCTCP--DGYRGDGRTC----------TDINECQERRGLCRNGACVNIDGGYVCNCNPGYKRSKNGKRCEDQRKGLCFATVTDGLCEAVTKQMMQVSKRDCCCTAGKAWGISCELCPAKDTMELGNGMNVCEMTSGLCINGKCISI-KGGFRCMCNVGYKLSMNGRKCYDINECEGPTKVCQFDCKN------TDGSYECSCPKGYQVDADKKKCL 708          

HSP 3 Score: 93.2041 bits (230), Expect = 2.358e-19
Identity = 168/719 (23.37%), Postives = 260/719 (36.16%), Query Frame = 1
Query:  745 GKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCR-GGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ-------------TEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSC-----------LINY-VTTEPTTKYC------DILVNRLRCASGN------------CVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQ-----NDYICACVLGYKQATDKKSCIIMDNPK-------CAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDC 2721
            GKC  T  G Y C C K      +   C      +V       C+   +C     S+ C+CP GF        C   ++ D C +P     C  G C +    + C+CN  Y   +N + CV    +E ++ +         LC  G+C++    Y C+C  GF        C  I+    +C +    C+ G C   + + + CQC+ G+  S + R CI     ++    CE    RC   +          C C+ GY+ + + K      +  D  +  E    CR GG+CV+   SYRC+C   + S N G  CV  ++             T+P  +++    +    C  G+                ++    +      K  T   D + C +   L  C  G CI +    F+C C  GF   + G  C  E  ++C+    IC  G C     S + C CP   + ++D  SC           L  Y     P +  C      ++  N+  C   N            C N     RC C  GY+   DG+ C  I +      L +            D  Y C C  GY +S+NG+ C      L   ++ D        G+C  + +     +   C C  G       + C   D  +       C +    C  G C  I  G+ C+C   Y ++ NGR C
Sbjct:   12 GKCQNTI-GSYICTCPKGLRHDPSSGKC-----KDVDECLMNPCVSPAKCLNTFGSFLCNCPEGFTPDVTGLKC---TDMDECGTPGY---CDHGMCKNMNGSFSCVCNQGYHLTDNKRTCVDM--NECILGK--------GLCGNGTCINTEGSYRCECHPGFKLNRGGF-CQDID----ECVMEADVCRNGMCINTEGS-FTCQCIAGYTLSADRRHCIDVNECQDVPGFCE--NGRCTNTI------GGARCECVAGYALNTEGKI----TRCVDVNECDENPNFCRPGGRCVNTPGSYRCLCDPGFQSYNGGTVCVDSREDFCFDVFDNENSCTKPRPIKM---TKSVCCCTLGKGWGDPCELCPSPKTPEFSIICPKGVGIARKNGTRFEDVNECTMMPDL--CRNGVCINNDG-SFRCQCKMGFKLDASGHHC--EDKNECVETPGICKTGNCTNIEGS-YTCTCPVGYAPTRDSPSCSDIDECRERAGLCAYRCINTPGSFKCACPNGFELSTNQRHCKDINECKKNPELCPYGCKNFVGGYRCTCPDGYRG--DGRTCTDINECQERRGLCRNGACVNI-----DGGYVCNCNPGYKRSKNGKRCEDQRKGLCFATVTD--------GLCEAVTKQMMQVSKRDCCCTAGKAWGISCELCPAKDTMELGNGMNVCEMTSGLCINGKCISIKGGFRCMCNVGYKLSMNGRKC 666          

HSP 4 Score: 67.3958 bits (163), Expect = 2.243e-11
Identity = 61/198 (30.81%), Postives = 90/198 (45.45%), Query Frame = 1
Query:  325 KGQCQNGKCI---------CESGYF----GEDCNTAIISTCYVKIDRGLCKS-TPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKS-ICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIK----KTNYNVCNY 861
            +G C+NG C+         C  GY     G+ C       C+  +  GLC++ T + +Q+SK +CC     AWG  C       CP   T +    + ++ C+  S +C+NG+CI+ KG FRC C   + L  N   C Y  ++C+     C    K    +DG Y C C K Y V  + K C+     KT  + C Y
Sbjct:  536 RGLCRNGACVNIDGGYVCNCNPGYKRSKNGKRCEDQRKGLCFATVTDGLCEAVTKQMMQVSKRDCCCTAGKAWGISCEL-----CPAKDTMELG--NGMNVCEMTSGLCINGKCISIKGGFRCMCNVGYKLSMNGRKC-YDINECEGPTKVCQFDCK---NTDGSYECSCPKGYQVDADKKKCLDVDECKTGAHNCQY 722          
BLAST of Fibrillin-2 vs. Ensembl Nematostella
Match: EDO38787 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBY9])

HSP 1 Score: 88.5817 bits (218), Expect = 7.593e-19
Identity = 101/379 (26.65%), Postives = 155/379 (40.90%), Query Frame = 1
Query:  574 DIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERC-RGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQC-QGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIK-NEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC 1698
            D+DEC  +  +C NG C+N  GS+RC+C     LD    +C    ++C  +   C   G+CV    G + CIC + Y ++ +   C    + N C      C     C     SY C C +GF    D ++C      DI +  E  + C  G +C +   GY C C   Y+   + + C+     +          E   LC  G C +    + C C++G+   +    C+ +    ++C   Q  C +  RC  L   +Y C+C  GFI   +G SC   +      + C   G    T       P  + C C EGY+   D   C+  NE   D          C  GQC++   S+ C C   Y+ + NG+ C
Sbjct:    2 DVDECTMYPQLCRNGICVNTPGSYRCECSAGLTLDSIQNAC-VDINECNTWQGLC-RNGRCV-NKQGTFECICNQGYGLTADRMDC---EDINECLVDNGRCSEM--CNNTLGSYLCDCGAGFALQPDGRTC-----RDIDECMERPDVCGPGNTCNNIEGGYYCTCGKGYKQSVDSRSCIDVDECQ----------EDPRLCTNGVCRNTPGSFECLCAKGYAIAKGTTACVDV----NECQTGQAMCHENARCANL-VGSYRCECKPGFIG--DGSSCTDVDECTTGIAQCSEQGTCVNT-------PGSHRCVCHEGYTG--DGITCVDINECLAD-------PNLCEHGQCINKAGSFMCDCEIGYLPTPNGKGC 334          

HSP 2 Score: 66.2402 bits (160), Expect = 1.795e-11
Identity = 93/318 (29.25%), Postives = 138/318 (43.40%), Query Frame = 1
Query:  325 KGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFT-QKENR-CDDIDECQFK-SICLNGE-CINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQ-ECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRC 1263
            +G C+NG+C+ + G F   CN     T     DR  C+   E L +    C  +     G+    CD   C  GF  Q + R C DIDEC  +  +C  G  C N +G + C C   +    ++ SC    D+CQ     C   G C  T  G + C+C K Y+++    +C+   + N C   + +C     C     SY C C  GF    D  SC   ++ D C +  IA+    G+CV+    +RC+C   ++GY  D   CV    +E L           +LCE G C++    + C C  G+  T N + C
Sbjct:   52 QGLCRNGRCVNKQGTFECICNQGYGLT----ADRMDCEDINECL-VDNGRCSEMCNNTLGS--YLCD---CGAGFALQPDGRTCRDIDECMERPDVCGPGNTCNNIEGGYYCTCGKGYKQSVDSRSC-IDVDECQEDPRLC-TNGVCRNTP-GSFECLCAKGYAIAKGTTACV---DVNECQTGQAMCHENARCANLVGSYRCECKPGFIG--DGSSC---TDVDECTTG-IAQCSEQGTCVNTPGSHRCVC---HEGYTGDGITCVDI--NECLADP--------NLCEHGQCINKAGSFMCDCEIGYLPTPNGKGC 334          

HSP 3 Score: 65.0846 bits (157), Expect = 4.297e-11
Identity = 63/237 (26.58%), Postives = 92/237 (38.82%), Query Frame = 1
Query: 1012 ERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNN---NYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQ 1713
            + CR G CV+    YRC C+      +    CV               + +  LC  G CV+    + C C++G+  T +R  C  I         N+     GRC E+ NN   +Y C C  GF    +GR+C   +       +C   G+ C            Y C C +GY QS D + CI      D  + QE  + C  G C +   S+ C+C   Y  +     CV   +
Sbjct:   11 QLCRNGICVNTPGSYRCECSAGLTLDSIQNACVDINEC----------NTWQGLCRNGRCVNKQGTFECICNQGYGLTADRMDCEDI---------NECLVDNGRCSEMCNNTLGSYLCDCGAGFALQPDGRTCRDIDECMERPDVCGP-GNTCNN------IEGGYYCTCGKGYKQSVDSRSCI------DVDECQEDPRLCTNGVCRNTPGSFECLCAKGYAIAKGTTACVDVNE 215          

HSP 4 Score: 56.6102 bits (135), Expect = 2.605e-8
Identity = 91/378 (24.07%), Postives = 145/378 (38.36%), Query Frame = 1
Query: 1603 KRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDC 2721
            + CR G CV+   SYRC C       +    CV   +        C+ W+   LC+ G CV+    + C C  GY  T +   C  I + +    DN  C   E  +  +G          + C C  GF    DGR+C    +D+C+   ++C PG    +    + C C      S D  SC+ ++    +P          RL C +G C N      C+C  GY  ++    C  + +  +  ++     +          +Y C+C  G+I   +G SC   +      + C       + G C       + C C  GY    D  +C+  D  +C  +   C+ G C +    ++C C   Y  T NG+ C
Sbjct:   11 QLCRNGICVNTPGSYRCECSAGLTLDSIQNACVDINE--------CNTWQ--GLCRNGRCVNKQGTFECICNQGYGLTADRMDCEDINECLV---DNGRC--SEMCNNTLG---------SYLCDCGAGFALQPDGRTC--RDIDECMERPDVCGPGNTCNNIEGGYYCTCGKGYKQSVDSRSCIDVDECQEDP----------RL-CTNGVCRNTPGSFECLCAKGYAIAKGTTACVDVNECQTGQAMCHENARCANLV----GSYRCECKPGFIG--DGSSCTDVDECTTGIAQCS------EQGTCVNT-PGSHRCVCHEGY--TGDGITCV--DINECLADPNLCEHGQCINKAGSFMCDCEIGYLPTPNGKGC 334          

HSP 5 Score: 51.9878 bits (123), Expect = 8.011e-7
Identity = 59/236 (25.00%), Postives = 93/236 (39.41%), Query Frame = 1
Query: 2032 VDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            VD+C     +C  G C  +  S +RC C    +L    ++C+ IN   T            +  C +G CVN +    CIC  GY  + D  +C  I +           C           +Y C C  G+    +GR+C   +  + +  +C           C  I +  Y C C  GYKQ+ D +SCI +D  +C  +   C  G C +    + C+C   Y + +    C+
Sbjct:    3 VDECTMYPQLCRNGICVNTPGS-YRCECSAGLTLDSIQNACVDINECNTW-----------QGLCRNGRCVNKQGTFECICNQGYGLTADRMDCEDINECLVDNGRCSEMCNNTL------GSYLCDCGAGFALQPDGRTCRDIDECMERPDVCG------PGNTCNNI-EGGYYCTCGKGYKQSVDSRSCIDVD--ECQEDPRLCTNGVCRNTPGSFECLCAKGYAIAKGTTACV 211          
BLAST of Fibrillin-2 vs. Ensembl Nematostella
Match: EDO28820 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5E3])

HSP 1 Score: 86.2705 bits (212), Expect = 2.668e-18
Identity = 87/316 (27.53%), Postives = 132/316 (41.77%), Query Frame = 1
Query:  571 DDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCR-GGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICAC 1515
            +D+DEC     C +G C N  GSF C C   ++L +N  +C    D+C +    C   G C+ T +G +TC CI  Y++S + + CI   + N C      C   G C        C C +G+  + + K   +    D+ +  E    CR GG CV+    YRCLC+  +Q YN    C    T  P             LC  G C++ +  + CQC  GF    +   C       ++C      C+ G C  ++  +Y C C  G+  + +  SC   +  R    +C    +RC         P  + CAC
Sbjct:    5 EDMDECGTPGYCDHGMCKNMNGSFSCVCNQGYHLTDNKRTC-VDIDECVMEADVC-RNGMCINT-EGSFTCQCIAGYTLSADRRHCI---DVNECQDVPGFC-ENGRCTNTIGGARCECVAGYALNTEGK---ITRCVDVNECDENPNFCRPGGRCVNTPGSYRCLCDPGFQSYNGGTVCC---TMMP------------DLCRNGVCINNDGSFRCQCKMGFKLDASGHHCED----KNECVETPGICKTGNCTNIE-GSYTCTCPVGYAPTRDSPSCSDIDECRERAGLC---AYRCIN------TPGSFKCAC 281          

HSP 2 Score: 70.4774 bits (171), Expect = 4.725e-13
Identity = 81/316 (25.63%), Postives = 134/316 (42.41%), Query Frame = 1
Query: 1174 CEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCR-GGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCP 2118
            C+ G C ++N  + C C++G++ T+N+R C+ I+    +C +    C+ G C   +  ++ CQC+ G+  S + R CI     ++    CE    RC   +          C C+ GY+ + + K      +  D  +  E    CR GG+CV+   SYRC+C   + S N G  C                     LC+ G C++ + ++ C+C  G+    +G  C           D + C+  E    C  G C  +    + C C  G+    D  SC    +D+C     +C   RC  +  S F+C CP
Sbjct:   16 CDHGMCKNMNGSFSCVCNQGYHLTDNKRTCVDID----ECVMEADVCRNGMCINTE-GSFTCQCIAGYTLSADRRHCIDVNECQDVPGFCE--NGRCTNTI------GGARCECVAGYALNTEGKI----TRCVDVNECDENPNFCRPGGRCVNTPGSYRCLCDPGFQSYNGGTVCCTMMP---------------DLCRNGVCINNDGSFRCQCKMGFKLDASGHHCE----------DKNECV--ETPGICKTGNCT-NIEGSYTCTCPVGYAPTRDSPSCSD--IDECRERAGLCAY-RCINTPGS-FKCACP 282          

HSP 3 Score: 62.7734 bits (151), Expect = 1.643e-10
Identity = 79/342 (23.10%), Postives = 120/342 (35.09%), Query Frame = 1
Query:  310 NNCSNKGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKS-ICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQ----GYN--NDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQC 1314
            + C   G C +G C   +G F   CN                                                      T  +  C DIDEC  ++ +C NG CIN +GSF CQC   + L  +   C    ++CQ     C   G+C  T  G   C C+  Y+++  GK   +  + N C+     C P G C     SY C C  GF        C             + + CR G C++    +RC C   ++    G++  +  ECV                E   +C+ G+C ++   Y C C  G+  T +   C  I+    +  L  ++C
Sbjct:    8 DECGTPGYCDHGMCKNMNGSFSCVCNQGYH-------------------------------------------------LTDNKRTCVDIDECVMEADVCRNGMCINTEGSFTCQCIAGYTLSADRRHC-IDVNECQDVPGFC-ENGRCTNTIGGAR-CECVAGYALNTEGKI-TRCVDVNECDENPNFCRPGGRCVNTPGSYRCLCDPGFQSYNGGTVCCT----------MMPDLCRNGVCINNDGSFRCQCKMGFKLDASGHHCEDKNECV----------------ETPGICKTGNCTNIEGSYTCTCPVGYAPTRDSPSCSDIDECRERAGLCAYRC 270          

HSP 4 Score: 58.9214 bits (141), Expect = 3.175e-9
Identity = 45/207 (21.74%), Postives = 87/207 (42.03%), Query Frame = 1
Query: 2377 DNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVD---------------------ISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            + ++ C C  GY  ++N R+C+  +  +++  +C       + G+C    +  + C C+ GY  + D++ CI  D  +C      C+ G C + + G  C CV  Y +   G+  I + + V   D                     + +  +Q+    + C    + + C+ G C+     ++C+C   FK +   H C  D N+C
Sbjct:   25 NGSFSCVCNQGYHLTDNKRTCVDIDECVMEADVC-------RNGMCINT-EGSFTCQCIAGYTLSADRRHCI--DVNECQDVPGFCENGRCTNTIGGARCECVAGYALNTEGK--ITRCVDVNECDENPNFCRPGGRCVNTPGSYRCLCDPGFQSYNGGTVCCTM-MPDLCRNGVCINNDGSFRCQCKMGFKLDASGHHC-EDKNEC 217          

HSP 5 Score: 57.3806 bits (137), Expect = 1.071e-8
Identity = 74/273 (27.11%), Postives = 105/273 (38.46%), Query Frame = 1
Query: 1834 TENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMD--NPKCAVNEYRC 2634
            T+N R C  I++ V E               C  G CI +    F C C+ G+T ++D R C    V++C +    C  GRC  +     RC C    +L+ +G       +T       CD   N  R   G CVN     RC+C PG++S   G  C  +                 G    +D ++ CQC  G+    +G  C      +    IC       KTG C  I +  Y C C +GY    D  SC  +D    +  +  YRC
Sbjct:   39 TDNKRTCVDIDECVME------------ADVCRNGMCI-NTEGSFTCQCIAGYTLSADRRHCID--VNECQDVPGFCENGRCTNT-IGGARCECVAGYALNTEGK------ITRCVDVNECDENPNFCR-PGGRCVNTPGSYRCLCDPGFQSYNGGTVCCTMMP----------DLCRNGVCINNDGSFRCQCKMGFKLDASGHHCEDKNECVETPGIC-------KTGNCTNI-EGSYTCTCPVGYAPTRDSPSCSDIDECRERAGLCAYRC 270          
BLAST of Fibrillin-2 vs. Ensembl Nematostella
Match: EDO39165 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB01])

HSP 1 Score: 76.2554 bits (186), Expect = 6.176e-14
Identity = 196/748 (26.20%), Postives = 284/748 (37.97%), Query Frame = 1
Query:  586 CQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEP--DNSYC--LLQEYLSRCM----------------------GGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILV--NRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQ-----NDYICACVLGYKQATDKKSCIIMDNPKCA----VNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRD 2718
            CQ  S    G C     S  C C P         SC+   D+C+L    C     C+   +  + CIC     V F+G  C  +TNYN C+     C     CQ     + C CP G            N++ D CQS     +   G+C +   G+ CLC   Y G   + + V   +S P V+             GG C D   +Y C C  GF + EN +  I  E  +S C        G  C++L  + + CQC  GF     G++C         T+I E  G  C  G       N Y C CL G++     ++C   +   D CQ+        G  C+   +SY+C+C   Y     GQ C  +   +    R C           G C+D  ++++C C  G+    +G+ CS       + P    S C  L+ +Y   C+                      GG C+ +   G+ CLC+ G+T    G +C+ + +D CL N   C  G CE   N N++CVCP     ++   +C  N       +  CD  +  N   C S N     C C  GY     G +C      S I       C G        NNY C C  G+                   ++CD++ ++C+   C          ND+ C C  G++  T       +D  +CA    +NE +C      D+V GY C C   YT T   RD
Sbjct:   18 CQHDSCLNGGTCSEGSNSLLCSCLPGF----TGQSCETDVDECKLV--QCHNGATCIDQVN-SFKCIC----PVGFHGILC--ETNYNDCH--SNPCQNNATCQDLINDFSCQCPQGITGQ------TCNTDIDECQSSPCKHQ---GTCQNYLGGFNCLCRHGYSGITCEVD-VNECSSSPCVN-------------GGVCADGLGEYKCICPSGF-SGENCQVNID-ECASSPCK------NGATCEDL-VDEFRCQCQPGF----KGQNC--------ETNINECIGAACANGSTCIDLVNAYQCTCLPGFTG----RHC---DVDIDECQSNPCQ---HGSACMDGVSSYQCICQPGYT----GQYC--HIDIDECLSRPCLN--------NGMCLDLVSDFHCTCPTGF----SGKDCSVNIDDCADAPCQHGSTCIDLVNDYKCSCLQGYTGKDCHIDINECSSNPCQYGGTCL-NLLNGYACLCIDGYT----GLNCEKD-IDDCLFNP--CHNGTCEDLVN-NYKCVCPD----NRQERTCAGN-------SSVCDTYLCRNGGSCFSNNSTYYTCECPKGYT----GHDCE-----SKINYCKSSSCYGNATCLDGANNYTCICPRGF-----------------TGTLCDVNVDECEDSPCANGASCEDLINDFRCHCPAGFQGRT-----CAVDINECATSPCLNEAKCT-----DVVSGYRCTCRSGYTGTRCERD 622          

HSP 2 Score: 75.8702 bits (185), Expect = 7.699e-14
Identity = 218/866 (25.17%), Postives = 326/866 (37.64%), Query Frame = 1
Query:  277 TCPQNNQKLCTNNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGE-CINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQ----LYGSSCGIFGKCVPTSDG--QYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGS-CVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERT-RNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRG-GQCVSNGNSYRCVCHGKYISS---NNGQECVRYKQTEPPAVR-LCSKWEYY--SLCQGGEC-VDTXXXXXXXXXXXXXATE--NGRKCS--------RIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSN-----FRCVCPYYASLSKDGHSCLINYVTTEPTT----KYCDILVNRLRCASGNCVNDRCICGPGYKSSE---DGKECYK---------IEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKC-KTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRC------KGGYCYDIVDGYLCICVGNYT 2697
            TC  +  +  ++ C N G C +G    KCIC SG+ GE+C         V ID   C S+P     + E+    F            R  C  GF + +N   +I+EC   + C NG  CI+   +++C C P          C    D+CQ     +GS+C          DG   Y CIC   Y+    G+ C    + ++     + CL  G C      ++C+CP+GF      K C VN + D   +P     C+ GS C+     Y+C C    QGY      +          +Y           GG+C++L N Y C C +G+         +  E     C  N   C  G C++L  NNY+C C              + ERT   ++S+C+ Y  R   G C+      Y C C +GY+  +        E   +YC+    S  C G   C+   N+Y C+C   +  +    N  EC         +   L + +  +  +  QG  C VD N      C N    T+  +G +C+        R E+ + +E  +S C+         GG C+ D T  F+CLC PG+              D+C  N + C    C  +GN       F C C    ++   G +C +N     P+       C  LVN   C           C  G+K S+   D  EC           +++V+S                     Y+C C  G+  +              + +I D     C    IC  +  ND+ CAC  GY+  T            CA+N   C      +GG C D V GY C+C+  +T
Sbjct:  162 TCEVDVNECSSSPCVNGGVCADGLGEYKCICPSGFSGENCQ--------VNIDE--CASSPCKNGATCEDLVDEF------------RCQCQPGF-KGQNCETNINEC-IGAACANGSTCIDLVNAYQCTCLPGF----TGRHCDVDIDECQSNPCQHGSAC---------MDGVSSYQCICQPGYT----GQYC----HIDIDECLSRPCLNNGMCLDLVSDFHCTCPTGF----SGKDCSVNID-DCADAP-----CQHGSTCIDLVNDYKCSC---LQGYTGKDCHIDINECSSNPCQY-----------GGTCLNLLNGYACLCIDGYTG-------LNCEKDIDDCLFNP--CHNGTCEDL-VNNYKCVCPDN-----------RQERTCAGNSSVCDTYLCR-NGGSCFSNNSTYYTCECPKGYTGHD-------CESKINYCK----SSSCYGNATCLDGANNYTCICPRGFTGTLCDVNVDECEDSPCANGASCEDLINDFRCHCPAGFQGRTCAVDINECATSPCLNEAKCTDVVSGYRCTCRSGYTGTRCERDI-DECSSSPCV--------NGGLCV-DYTNYFECLCHPGYGG------------DRCEINIDDCANKPCLHNGNCTDYVNYFTCAC----AVGYTGRTCEVNIDDCSPSPCRHGGSCQDLVNGYLCH----------CPAGFKGSKCETDIDECATNPCDNNGTCVDRVAS---------------------YDCVCKPGFTGTR------------CEANIDDCATSPCLNNAICTDL-INDFHCACPAGYQGQT------------CAINVDDCTPQPCKQGGTCVDAVSGYTCLCMPGFT 843          

HSP 3 Score: 61.6178 bits (148), Expect = 1.790e-9
Identity = 212/867 (24.45%), Postives = 309/867 (35.64%), Query Frame = 1
Query:  310 NNCSNKGQCQNGK----CICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY------------------------CPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYS----------------------------------VSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDN-----NNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQ-GGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRC---ASGNCVNDRCICGPGYKSSEDGKECYK-IEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNY 2694
            ++C N G C  G     C C  G+ G+ C T +     V+   G         Q++  +C  I  V +    + C+ NY                        CP+G T +     DIDECQ       G C N  G F C C   +    + ++C+   ++C    SS  + G       G+Y CIC   +S                                    F G++C  +TN N C      C     C     +Y C+C  GF      + C V  + D CQS        G +C+     Y+C+C   Y G    Q C  +   +  +SR C  +        G C+DL +D++C C  GF   +              C++N   C    CQ         N+Y+C CL+G+     G+ C           I E   + CQ G       N Y C C++GY+        +  E+  D C    +   C  G C    N+Y+CVC              R ++T      +C  +    LC+ GG C                +T    +C +       E   +YC      S C G     D    + C+C  GFT    G  CD   VD+C   ++ C  G       ++FRC CP  A       +  IN   T P        +N  +C    SG     RC C  GY     G  C + I++ SS   +N   C          N +EC C  GY     G  C  +      K    LH   C   + Y      + CAC +GY   T +   + +D+  C+ +  R  GG C D+V+GYLC C   +
Sbjct:   21 DSCLNGGTCSEGSNSLLCSCLPGFTGQSCETDVDECKLVQCHNGATCID----QVNSFKC--ICPVGFHG--ILCETNYNDCHSNPCQNNATCQDLINDFSCQCPQGITGQTCN-TDIDECQSSPCKHQGTCQNYLGGFNCLCRHGY----SGITCEVDVNECS---SSPCVNGGVCADGLGEYKCICPSGFSGENCQVNIDECASSPCKNGATCEDLVDEFRCQCQPGFKGQNC--ETNINEC--IGAACANGSTCIDLVNAYQCTCLPGF----TGRHCDV--DIDECQSNPCQ---HGSACMDGVSSYQCICQPGYTG----QYC--HIDIDECLSRPCLNN--------GMCLDLVSDFHCTCPTGFSGKD--------------CSVNIDDCADAPCQHGSTCIDLVNDYKCSCLQGYT----GKDC--------HIDINECSSNPCQYGGTCLNLLNGYACLCIDGYTG-------LNCEKDIDDC----LFNPCHNGTCEDLVNNYKCVCPDN-----------RQERTCAGNSSVCDTY----LCRNGGSCFSN------------NSTYYTCECPKGYTGHDCESKINYC----KSSSCYGNATCLDGANNYTCICPRGFT----GTLCDVN-VDEC--EDSPCANGASCEDLINDFRCHCP--AGFQGRTCAVDINECATSP-------CLNEAKCTDVVSGY----RCTCRSGYT----GTRCERDIDECSSSPCVNGGLCVDYT------NYFECLCHPGY----GGDRCEINIDDCANKPC--LHNGNCTDYVNY------FTCACAVGYTGRTCE---VNIDD--CSPSPCR-HGGSCQDLVNGYLCHCPAGF 728          

HSP 4 Score: 60.077 bits (144), Expect = 5.707e-9
Identity = 206/911 (22.61%), Postives = 301/911 (33.04%), Query Frame = 1
Query:  316 CSNKGQC----QNGKCICESGYFGEDCNTAII----------STCYVKIDRGLCKS----TPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYN--------NDQECVRYGTSEPLVSRY---CSKSEYYSLCE-------------GGSCVDLNNDYYCQCSEGFYATENRRRC-IKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKW--EYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSAS--------------------DGR-----SCDPEYVDQ-CLNNENICTPGRCERSGN-----SNFRCVCPYYASLSKDGHSCLINYVTTEP-----------------------TTKYCDILVNRLRCASGNCVND----------RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKS---CIIMDNPKCAVNEYRCKG--GYCYDIVDGYLCICVGNYT 2697
            C N G C     +  C C +G+ G+DC+  I           STC   ++   C      T ++  +   EC S     +G  C+     Y   C  G+T       DID+C F   C NG C +   +++C CP +        +C      C  Y   C   G C   +   YTC C K Y+    G  C  K NY         C     C     +Y C CP GF  +      + + N D C+    A    G SC      +RC C   +QG              C+       +VS Y   C      + CE             GG CVD  N + C C  G+       RC I I+   ++  L+      G C +   N + C C  G+     GR+C +      S S C  +G  CQ  V      N Y+C C  G+  S       K E   D C           G CV    SY CVC   +  +           +      +C+    +++  C  G                      G+ C+      T +P               GG C+ D   G+ CLC+PGFT  +                    DGR     +C   +  Q C  N + C P  C+  G      ++F C C  Y   + +  +  I+     P                       T ++CD+ +    C S  C N+          +C+C   + S +  +     E    +     +           DN Y+C CL GY     G+ C      LI +     H + C+ G           C C +G+     +K    CI+           R  G  G C     G+LC+C   +T
Sbjct:  327 CLNNGMCLDLVSDFHCTCPTGFSGKDCSVNIDDCADAPCQHGSTCIDLVNDYKCSCLQGYTGKDCHIDINEC-SSNPCQYGGTCLNLLNGYACLCIDGYTGLNCE-KDIDDCLFNP-CHNGTCEDLVNNYKCVCPDN----RQERTCAGNSSVCDTY--LCRNGGSCFSNNSTYYTCECPKGYT----GHDCESKINY----CKSSSCYGNATCLDGANNYTCICPRGFTGT------LCDVNVDECEDSPCA---NGASCEDLINDFRCHCPAGFQGRTCAVDINECATSPCLNEAKCTDVVSGYRCTCRSGYTGTRCERDIDECSSSPCVNGGLCVDYTNYFECLCHPGYGG----DRCEINIDDCANKPCLHN-----GNCTDY-VNYFTCACAVGYT----GRTC-EVNIDDCSPSPCR-HGGSCQDLV------NGYLCHCPAGFKGS-------KCETDIDECATNPCDNN---GTCVDRVASYDCVCKPGFTGTRCEANIDDCATSPCLNNAICTDLINDFHCACPAGY--------------------QGQTCAINVDDCTPQPCK------------QGGTCV-DAVSGYTCLCMPGFTGINCSIEMDECGSYPCLNNGTCVDGRNRVTCTCAVGFTGQFCEVNIDDCDPAPCQNYGTCQDLVADFTCHC--YPGFTGETCATPIDLCEAHPCQNNATCRMDPLKGYSCSCPTGVTGRHCDVSI----CDSKPCRNNGSCVLTQSGYQCLCASSFTSPQCQRSIDDCEHAHCLNGATCVDS---------DNAYKCSCLEGYY----GKHC-----ELIDR----CHSQPCQNGATCVDDDGVVFCKCAMGFTGTHCEKEFNHCIVRVADTNLTFPSRICGDHGTCVSKPTGFLCVCQPGFT 1118          

HSP 5 Score: 59.6918 bits (143), Expect = 6.934e-9
Identity = 105/449 (23.39%), Postives = 159/449 (35.41%), Query Frame = 1
Query:  307 TNNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVK--IDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGF--------------HQSEDKKSCIVNS-----------------NSDICQSPEIAERCRG-GSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRS---ENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYS 1530
            TN C N G C +      C+C+ G+ G  C  A I  C     ++  +C     +   +                       CP G+ Q +    ++D+C  +     G C++    + C C P        ++C    D+C  Y   C   G CV   + + TC C    +V F G+ C  + N + C+     C  YG CQ     + C C  GF              H  ++  +C ++                  +  IC S    + CR  GSCV    GY+CLC   +              + P   R     E+     G +CVD +N Y C C EG+Y     + C  I+   SQ       CQ G     D+    C+C  GF  +   +    CI      N T    + G     G C    P  ++C C  G++
Sbjct:  742 TNPCDNNGTCVDRVASYDCVCKPGFTGTRCE-ANIDDCATSPCLNNAICTDLINDFHCA-----------------------CPAGY-QGQTCAINVDDCTPQPCKQGGTCVDAVSGYTCLCMPGF----TGINCSIEMDECGSY--PCLNNGTCVDGRN-RVTCTC----AVGFTGQFC--EVNIDDCD--PAPCQNYGTCQDLVADFTCHCYPGFTGETCATPIDLCEAHPCQNNATCRMDPLKGYSCSCPTGVTGRHCDVSICDS----KPCRNNGSCVLTQSGYQCLCASSF--------------TSPQCQRSIDDCEHAHCLNGATCVDSDNAYKCSCLEGYYG----KHCELIDRCHSQ------PCQNGATCVDDDGVVFCKCAMGFTGTHCEKEFNHCIVRVADTNLTFPSRICGDH---GTCVS-KPTGFLCVCQPGFT 1118          

HSP 6 Score: 54.6842 bits (130), Expect = 2.247e-7
Identity = 165/687 (24.02%), Postives = 237/687 (34.50%), Query Frame = 1
Query:  316 CSNKGQCQN----GKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCD-DIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSE---DKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSK--SEYYSLC----------------------EGGSCVDLNNDYYCQCSEGFYAT-----------------------ENRRRCIKIETITSQ-CALNQFQCQG------GRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNE-YICACLEGYSQSE-DRKYCIKNEQYKDYCQNQEISKRCR-GGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCM------GGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCL---NNENICTPGR-CERSGN-----SNFRCVC-PYYASL 2133
            C+N   C++     +C C +G+ G         TC V I+   C ++P    L++ +C     V  G  C       C  G+T    RC+ DIDEC        G C++    F C C P +  D     C+   D C      C   G C    +  +TC C    +V + G++C  + N + C+     C   G CQ     Y C CP+GF  S+   D   C  N   +             G+CV     Y C+C   + G   +       TS  L +  C+   ++++  C                      +GG+CVD  + Y C C  GF                           NR  C      T Q C +N   C        G CQ+L   ++ C C  GF            E       +CE   H CQ      + P + Y C+C  G +    D   C               SK CR  G CV   + Y+C+C   +              T P   R     E+     G  CVD               ++N  KCS +E    +     +C   E + RC       G  C+ D    F C C  GFT    G  C+ E+ + C+    + N+  P R C   G      + F CVC P +  L
Sbjct:  555 CANGASCEDLINDFRCHCPAGFQGR--------TCAVDINE--CATSP---CLNEAKC---TDVVSGYRCT------CRSGYTGT--RCERDIDECSSSPCVNGGLCVDYTNYFECLCHPGYGGDR----CEINIDDCA--NKPCLHNGNCTDYVN-YFTCAC----AVGYTGRTC--EVNIDDCS--PSPCRHGGSCQDLVNGYLCHCPAGFKGSKCETDIDECATNPCDN------------NGTCVDRVASYDCVCKPGFTGTRCEANIDDCATSPCLNNAICTDLINDFHCACPAGYQGQTCAINVDDCTPQPCKQGGTCVDAVSGYTCLCMPGFTGINCSIEMDECGSYPCLNNGTCVDGRNRVTCTCAVGFTGQFCEVNIDDCDPAPCQNYGTCQDL-VADFTCHCYPGF----------TGETCATPIDLCE--AHPCQNNATCRMDPLKGYSCSCPTGVTGRHCDVSIC--------------DSKPCRNNGSCVLTQSGYQCLCASSF--------------TSPQCQRSIDDCEHAHCLNGATCVD---------------SDNAYKCSCLEGYYGK-----HC---ELIDRCHSQPCQNGATCVDDDGVVF-CKCAMGFT----GTHCEKEF-NHCIVRVADTNLTFPSRICGDHGTCVSKPTGFLCVCQPGFTGL 1120          
BLAST of Fibrillin-2 vs. Ensembl Medaka
Match: fbn2b (fibrillin-2 [Source:NCBI gene;Acc:101168694])

HSP 1 Score: 151.754 bits (382), Expect = 1.511e-36
Identity = 214/908 (23.57%), Postives = 349/908 (38.44%), Query Frame = 1
Query:  148 CCSGWIKNVYGDCVKSECDYDCGYGRCVGLNVCECYDKTIRTE--------------------TCPQNNQ-----KLCTNNCSNKGQCQN-GKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGFTQ--KENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSG--FHQSEDKKSCIV---NSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSE-YYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECV--RYKQTEPPAVRL--CSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSY--CLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILK 2730
            CC GW     G+     C   CG G C   N+C C +  +                        CP+        ++C N C N G+C    +C C  G+ G  C       C+ +++  +C+     +  +K  CC+    AWG+PC  C    + C +GF    +   C  +DECQ    +C  G CIN  GS+ C+CP  H   E +    ++ D+C      C   G+C  T+ G Y C C + Y  S +G  C+++            C    E         C C +G  +   +  + C V   N   D+C+   +   C  G C+     YRC CN    GY  D            + R C   E   + C  G CV+    YYC+C +G+  T  ++ C     I  +C +N   C+ GRC   +  +++C C  GF  + +G++CI  E             + C  G+C       + C C  G++ + + +YC  +E     CQ   I   C  G+C+++  S+RC C        +G+ CV    + T   A+++  CS+    ++ +  EC   + ++          + N    +     +    D     C L   +  C  G C  +    ++C+C  G+ S + G++C   ++++CL N  +C  G C R+   ++ C CP       D  +C IN   + P             C +G C N      C C  G K       C  ++    +               + DN  E       +KSE    C  +  A    S CD    +C+            I AC  G+ +       ++ +  +C V    C  G C +    +LC C    T+   GR C+++
Sbjct:   12 CCPGWKTLAGGNQCIVICRNSCGDGFCSRPNMCTCSNGQLSPNCVQSCNVRCMNGGSCMEDSCLCPKGYSGGHCGQVCENGCQNGGRCIGPNRCACVYGFTGPQCERYRTGPCFTQVNNQMCQGQLSGIVCTKTLCCATIGRAWGHPCEQCPAQPHPCRRGFIPNIRTGAC-QVDECQAVPGLCSGGNCINTVGSYECKCPAGHRQSETS----HKIDECSTIPGVCD-GGECSNTA-GSYVCTCPRGYISSTDGSRCVQRVGTCFSALANGRCA--AELNGQYTKMQCCCETGRCWALGQIPEMCPVRGSNETIDVCK--HLTNLCLNGRCIPTASSYRCECN---MGYKQD------------IRRECIVDECLNNPCVNGDCVNTPGSYYCRCHKGYQGTPTKQAC-----IIDECIVNGVMCRNGRCVNTE-GSFQCICNAGFELTSDGKNCIHDECATT---------NMCLNGMCIN-EDGSFKCICKPGFTLAPNGRYCTIDE-----CQTPGI---CMNGRCINSEGSFRCECPPGLAVDVDGRVCVDTHMRTTCYGAIKMGTCSRPLPGAVTK-SECCCFSPDHGFGQPCQPCPSRNSEFQAVCSSGIGITTDGRINECALDPDI--CQNGICE-NLLGSYRCICNIGYESDTSGKNC---FINECLVNRLLCDNGLC-RNTPGSYTCTCPKGYVFRPDSETCEINECESNP-------------CVNGACRNVAGSFHCECAHGSKLDSTNTICVSMKSTCWL--------------TIQDNRCEVNINGATLKSE----CCSTLGAAW-GSPCD----RCE------------ITACSRGFARMKG----LVCEIDECEVFPGVCTNGRCVNTQGSFLCECAEGLTLDSTGRTCVMR 809          

HSP 2 Score: 147.902 bits (372), Expect = 2.615e-35
Identity = 216/878 (24.60%), Postives = 335/878 (38.15%), Query Frame = 1
Query:  388 TAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSC----------------------QYRRDQCQ-LYGSSCGIFGKCVPTSDG-QYTCICIKPYSVSFNGKSCIKKTNYNV--CNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQ-SPEIAERCRGGSCVSEGKGYRCLCNGEYQ-GYNNDQECV------------------------------RYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC------VRYKQTEPPAVRLCSKWEYYSLCQGGECVD-------TXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLIN-----------YVTTEPTTKYCDIL------------VNRLRCASGNCVNDRCICGPG--YKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILK 2730
             ++ STC++ I    C+       L K ECCS    AWG+PC  C+   C +GF + +    +IDEC+ F  +C NG C+N +GSF C+C     LD    +C                      +YR D C    G++ G+  +  P  D  ++  IC +    +  G     +  Y V  C  F+ LC  +G C+    S+ C C SGF  + ++++C   ++ D C+ SP++   C  G+CV+    + C C   YQ G+   + C+                                 +SE  V   C  S+  SLC+ G CV++   Y C C  G+ AT +R+ C+ I+  T      +  C           +YEC C  G+    + R+C        S   CE     C  G C  I P EY C C +G+  S D + CI NE   +          C  G C +   S+ C C   Y        C      +     +  A  +     +   CQ G   D       T  +  C        T    +C   E    +    S     + ++ C  G+C+ +   G++C C  GFT   D ++C    +D+C N +NIC  G C+      FRCVC     L + G +C IN                P +  C+              VNR+    GNC  D    G G  Y ++E G     + + S  C+      +        ++ Y+  C  G     N        + +++   C      C+ G C       + C C  GY    D +   I+D  +C  +   C  G CY+    Y C+C   Y     G +C+++
Sbjct:  705 VSMKSTCWLTIQDNRCEVNINGATL-KSECCSTLGAAWGSPCDRCEITACSRGFARMKGLVCEIDECEVFPGVCTNGRCVNTQGSFLCECAEGLTLDSTGRTCVMRSELCYKKWHEDECGEPLPGKYRLDMCCCTVGAAWGVDCEECPKEDTPEFKAICPRGPGFANRGDILTGRPFYKVNECKVFRGLCT-HGNCRNTIGSFKCRCNSGFTLTAEERNC---TDIDECRISPDL---CGHGTCVNTPGSFECECFEGYQSGFMMMKNCMIDECETNPALCLGGTCLNTDGSYECECPSGYLLSSEASVMNECQLSD--SLCKNGQCVNMPGTYQCSCDTGYQATPDRQGCVDIDECTIMNGGCETHCTNSE------GSYECSCTEGYALMPDLRTC--------SIDECEETPDICDGGQCSNI-PGEYRCLCFDGFMASMDMRTCIVNECDLN-------PNICLHGDCENTKGSFICHCQLGYFVKKGSTGCTIDECEIGAHNCDMHAACVNLPGSFKCRCQAGWIGDGIKRDECTLEDNSCHHNADCANTPGSYRCMCKEGFNGDGFTCSMDECADNVNLCENGQCL-NAPGGYRCECEMGFTPTEDSKACQ---IDEC-NFQNICVFGTCQNLPGM-FRCVCDDGYELDRSGGNCTINECADPVNCINGICVNTPGSYLCNCPGDFELNPTGVGCVNRV----GNCFLDILPRGDGGIYCTAEVG---VGVTRASCCCAKALAWGEPCEICPSPNSEYKTLCPGGEGFRPN------PITVILEIDECQELPGLCQGGKCINT-FGSFQCECPAGYYLNEDTR---IID--ECVTHIGICGPGTCYNTFGNYTCVCPPEYMQVNGGNNCMMR 1525          

HSP 3 Score: 116.316 bits (290), Expect = 1.044e-25
Identity = 198/816 (24.26%), Postives = 312/816 (38.24%), Query Frame = 1
Query:  526 RNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECV------------RYGTSEPLVSRYCSKSE---------YYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVC-HGKYISSNNGQECVRYKQTEPPAVRLCS-KWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSC--------DPEYVDQCLN--------NENICTPG--------RCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSI---CDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKE 2811
            R  C  G+ Q   R   +DEC   + C+NG+C+N  GS+ C+C   +       +C    D+C + G  C   G+CV T +G + CIC   + ++ +GK+CI             +CL  G C     S+ C C  GF  + + + C +    D CQ+P I   C  G C++    +RC C        + + CV            + GT    +    +KSE         +   C+   C   N+++   CS G   T + R         ++CAL+   CQ G C+ L  + Y C C  G+    +G++C   E        C +    C  G+C    P  Y C C +GY    D + C  NE   + C N         G C +   S+ C C HG  + S N   CV  K T    ++    +          EC  T    +    +    T   R  +R++  V E  +      + +   C  GRC+  +   F C C  G T  S GR+C           + D+C          +   CT G         C +     F+ +CP     +  G     + +T  P  K  +  V R  C  GNC N     +C C  G+  + + + C  I++             G G       ++EC+C  GY          +S   ++K  +   C+ +   C  G C       Y C C  GY  +++     +M+  +C +++  CK G C ++   Y C C   Y  T + + C         VDI E +  N   ++ CT  E
Sbjct:  340 RCECNMGYKQDIRRECIVDEC-LNNPCVNGDCVNTPGSYYCRCHKGYQGTPTKQACII--DECIVNGVMC-RNGRCVNT-EGSFQCICNAGFELTSDGKNCIHDECATT-----NMCL-NGMCINEDGSFKCICKPGFTLAPNGRYCTI----DECQTPGI---CMNGRCINSEGSFRCECPPGLAVDVDGRVCVDTHMRTTCYGAIKMGTCSRPLPGAVTKSECCCFSPDHGFGQPCQ--PCPSRNSEFQAVCSSGIGITTDGR--------INECALDPDICQNGICENLLGS-YRCICNIGYESDTSGKNCFINE--------CLVNRLLCDNGLCRNT-PGSYTCTCPKGYVFRPDSETCEINECESNPCVN---------GACRNVAGSFHCECAHGSKLDSTN-TICVSMKSTCWLTIQDNRCEVNINGATLKSECCSTLGAAWGSPCDRCEITACSRGFARMKGLVCEIDE-----CEVFPGVCTNGRCVNTQG-SFLCECAEGLTLDSTGRTCVMRSELCYKKWHEDECGEPLPGKYRLDMCCCTVGAAWGVDCEECPKEDTPEFKAICPRGPGFANRG-----DILTGRPFYKVNECKVFRGLCTHGNCRNTIGSFKCRCNSGFTLTAEERNCTDIDECR-----ISPDLCGHGTCVNTPGSFECECFEGY----------QSGFMMMKNCMIDECETNPALCLGGTCLNT-DGSYECECPSGYLLSSEAS---VMN--ECQLSDSLCKNGQCVNMPGTYQCSCDTGYQATPDRQGC---------VDIDECTIMNGGCETHCTNSE 1066          

HSP 4 Score: 108.612 bits (270), Expect = 2.862e-23
Identity = 206/906 (22.74%), Postives = 325/906 (35.87%), Query Frame = 1
Query:  157 GWIKNVYGDCVKSEC-DYDCGYGRCV---GLNVCECYDKTIRTETCPQNNQKLCTNNCSNKG-QCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKEN-RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGS-SCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQC-------ALNQFQCQGGRCQELDNNNYECQCLRG--FIRSENGRSCIKAERTRNSTSICELYG-------HRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKN-EQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECV--------RYKQTE-----PPAVRL----CSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVC-PYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCIL 2727
            G+ +++  +C+  EC +  C  G CV   G   C C+     T T     Q    + C   G  C+NG+C+   G F   CN                + T +      +EC +   +     C+  D ++   C  GFT   N R   IDECQ   IC+NG CIN +GSFRC+CPP   +D +   C     +   YG+   G   + +P +  +  C C  P                   + F + C P   C      +   C SG   + D +      + DICQ+         G C +    YRC+CN  Y+   + + C     +E LV+R         LC+ G C +    Y C C +G+    +   C   E  ++ C           F C+     +LD+ N  C  ++   ++  ++ R  +        +  C   G        RC+            I AC  G+++ +     I   E +   C N         G+CV+   S+ C C       + G+ CV        ++ + E     P   RL    C+    +        VD                  G   +     +T  P       + +   C  G C  +    FKC C  GFT  ++ R+C    +D+C  + ++C  G C  +  S F C C   Y S      +C+I+   T P             C  G C+N      C C  GY  S +     + +   S+C   Q               Y+C C  GY  + + + C+  +   I    C+ H             +  Y C+C  GY    D ++C I    +C      C GG C +I   Y C+C   +  + + R CI+
Sbjct:  346 GYKQDIRRECIVDECLNNPCVNGDCVNTPGSYYCRCHKGYQGTPT----KQACIIDECIVNGVMCRNGRCVNTEGSFQCICNAGF-------------ELTSDGKNCIHDEC-ATTNMCLNGMCINEDGSFKCICKPGFTLAPNGRYCTIDECQTPGICMNGRCINSEGSFRCECPPGLAVDVDGRVCVDTHMRTTCYGAIKMGTCSRPLPGAVTKSECCCFSPD------------------HGFGQPCQP---CPSRNSEFQAVCSSGIGITTDGRINECALDPDICQN---------GICENLLGSYRCICNIGYESDTSGKNCF---INECLVNRL--------LCDNGLCRNTPGSYTCTCPKGYVFRPDSETCEINECESNPCVNGACRNVAGSFHCECAHGSKLDSTNTICVSMKSTCWLTIQDNRCEVNINGATLKSECCSTLGAAWGSPCDRCE------------ITACSRGFARMKGLVCEIDECEVFPGVCTN---------GRCVNTQGSFLCECAEGLTLDSTGRTCVMRSELCYKKWHEDECGEPLPGKYRLDMCCCTVGAAWG-------VDCEECPKEDTPEFKAICPRGPGFANRGDILTGRPFYKVNECKVFRGLCTHGNCR-NTIGSFKCRCNSGFTLTAEERNCTD--IDECRISPDLCGHGTCVNTPGS-FECECFEGYQSGFMMMKNCMIDECETNPAL-----------CLGGTCLNTDGSYECECPSGYLLSSEASVMNECQLSDSLCKNGQCVNM--------PGTYQCSCDTGYQATPDRQGCVDIDECTIMNGGCETHCTN---------SEGSYECSCTEGYALMPDLRTCSI---DECEETPDICDGGQCSNIPGEYRCLCFDGFMASMDMRTCIV 1129          

HSP 5 Score: 99.7525 bits (247), Expect = 1.223e-20
Identity = 202/835 (24.19%), Postives = 323/835 (38.68%), Query Frame = 1
Query:  145 LCCSGWIKNV-YGDCVKSECDYD---CGYGRC---VGLNVCEC---YDKTIRTETCPQNNQKLCTNNCSNKGQCQN----GKCICESGYFGE----DCNTAIISTCYVKID--------RGLCKS--TPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKEN-RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSIC-ELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYC-IKNEQYKDYCQNQ-------------------EISKRCRGGQCVSNGNSYRCVCHGKYISSN----------------NGQECVR----YKQTEPPAVRLCSKW--------EYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKC--SRIEKQV--------------------TEEPDNSYCLLQEYLSR-----CMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEK 2313
            LC  G++ ++    C+ +ECD +   C +G C    G  +C C   Y     +  C  +  ++  +NC     C N     KC C++G+ G+    D  T   ++C+   D        R +CK     +    S +EC     +     C+     Y   C  GFT  E+ +   IDEC F++IC+ G C N  G FRC C   + LD +  +C    ++C    +   I G CV T  G Y C C   + ++  G  C+ +    V N F  + LP G+        YC+   G   +     C         ++    E C    C S    Y+ LC G  +G+  +   V     E          E   LC+GG C++    + C+C  G+Y  E+ R       I  +C  +   C  G C      NY C C   +++   G +C+  +      S+C   +   C+  + + +      CA   G + ++  + C     +Y+  C NQ                   EI   C  G C++   S+RC C   +  +N                    C+     Y+    P  +L            E  ++C  GEC+DT  +Y C C NG+ AT +   C     E+Q                      E   N+ C+  +  S      C  GRCI ++   F+CLC  G+ + +DG++C    +++CLN    C+PG C+   +  FRC+CP    +  +   C+IN    EP             C  G C N     +C C PG+  S++ + CY   +
Sbjct: 1113 LCFDGFMASMDMRTCIVNECDLNPNICLHGDCENTKGSFICHCQLGYFVKKGSTGCTIDECEIGAHNCDMHAACVNLPGSFKCRCQAGWIGDGIKRDECTLEDNSCHHNADCANTPGSYRCMCKEGFNGDGFTCSMDECADNVNLCENGQCLNAPGGYRCECEMGFTPTEDSKACQIDECNFQNICVFGTCQNLPGMFRCVCDDGYELDRSGGNCTI--NECADPVNC--INGICVNTP-GSYLCNCPGDFELNPTGVGCVNR----VGNCFLDI-LPRGD-----GGIYCTAEVGVGVTRASCCCA--------KALAWGEPCE--ICPSPNSEYKTLCPGG-EGFRPNPITVILEIDE--------CQELPGLCQGGKCINTFGSFQCECPAGYYLNEDTR-------IIDECVTHIGICGPGTCYNT-FGNYTCVCPPEYMQVNGGNNCMMRK------SVCYRNFNDTCENELSFNMTKKMCCCAYNVGKAWNKPCEACPTPATEYQLLCGNQAPGFIIDIHTGKPIIDECREIPGICANGVCINQIGSFRCECPMGFSYNNILLIIDECNSGDNLCQRNANCINIPGSYRCECSPGFKLSPGGACLRNECQEIPNVCSHGECIDTQGSYRCLCHNGFKATADQTMCMIDECERQPCGNGTCKNTVGSYNCLCFPGFELTHNNDCMDIDECSALQGQVCRNGRCI-NELGSFQCLCSEGYENTADGKNC---VINECLNFPGTCSPGTCQNL-DGTFRCICPPGYEVQNE--QCIINECDVEPNI-----------CQFGTCTNTPGSFQCSCQPGFVLSDNKRRCYDTRE 1881          

HSP 6 Score: 90.5077 bits (223), Expect = 9.330e-18
Identity = 221/983 (22.48%), Postives = 356/983 (36.22%), Query Frame = 1
Query:  451 NLQLSKEECCSIFQV--AWGNPCVFCDR----------NYCPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGF-IRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQEC-------------VRYKQTEPPAV----RLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTT-----EPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIK--------------SESALIKKSI------CDLHR---EKCKTGICYPIGQNDYICACVLGYKQATDKK--SCIIM----DNPKC--AVNEYRCK--GGY----------------------CYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVD--------ISEVSYQNP----QSQSFCTRKEIIEK----CQPGKCVEKQEDYQCKCPHSFKTNYYDHEC-VRDSNKCPYCFYGCFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTC 3075
            +  ++K+ CC  + V  AW  PC  C            N  P            IDEC +   IC NG CIN+ GSFRC+CP     +   +      D+C    + C     C+    G Y C C   + +S  G +C++    N C     +C  +GEC     SY C C +GF  + D+  C++    D C+     + C  G+C +    Y CLC   ++  +N+ +C+       L  +         +C  G C++    + C CSEG+  T + + C     + ++C      C  G CQ LD   + C C  G+ +++E    CI  E        C++  + CQ G C    P  + C+C  G+  S++++ C    +   +C  +    +C   +   N    +C C  K      G  C               Y     P +     +    E   +CQ G C++T+ ++ C+C  GY     G  C   E  +     N  C                +   GF+C C  GF       +C+   +++C  N  +C   RC  +  S + C+CP    L  D   C  +  +      E     C  L+              CIC PG +   DG+ C   E  +        +C           +Y C+C +G+  S  G  CI                +S+  + S+      C++ R    +C+  +C   G   Y   C LG    TD +   C +M     N +C   +  +RC    GY                      C +    YLC C   YT+  +G+ C L   + K  +        I   + + P    Q Q+ C   E             CV     + C+C   F  +    EC V + +    C +GC +      C C + Y   +    C+    +     G ++C
Sbjct: 1542 SFNMTKKMCCCAYNVGKAWNKPCEACPTPATEYQLLCGNQAPGFIIDIHTGKPIIDECREIPGICANGVCINQIGSFRCECPMGFSYNNILLI----IDECNSGDNLCQRNANCI-NIPGSYRCECSPGFKLS-PGGACLR----NECQEIPNVC-SHGECIDTQGSYRCLCHNGFKATADQTMCMI----DECER----QPCGNGTCKNTVGSYNCLCFPGFELTHNN-DCMDIDECSALQGQ---------VCRNGRCINELGSFQCLCSEGYENTADGKNC-----VINECLNFPGTCSPGTCQNLD-GTFRCICPPGYEVQNE---QCIINE--------CDVEPNICQFGTCTNT-PGSFQCSCQPGFVLSDNKRRCYDTRE--SFCFTKFEGGKCTVPK-AFNTTKAKCCCS-KMPGEGWGFPCELCPNQNDAFNTLCPYGHGALPGLDDTREMNECLENPGICQNGICINTDGSFRCECPFGYNLDFTGVNCVTDECSIGNPCGNGTCT---------------NVVGGFECSCQEGFEPGPM-MTCE---INECSQNPLLCA-FRCVNTFGS-YECMCPAGYVLRDDQRMCRQDECSEGMDDCESKGMTCKNLIGTF----------MCICPPGMQRRPDGEGCMLNECRAKPGICKNGRCINTV------GSYRCECNDGFEPSLTGTECINRKGFCYTEVLRTMCQQSSTNRNSVTKSECCCNMGRGWGPQCE--LCPLPGTVQYKKMCPLGPGFTTDGRINECQVMPDLCQNGQCINTIGSFRCHCNIGYKADFTATSMDECSLSPKPCNFLCKNTEGSYLCSCPRGYTLQPDGKTCKLDECSTKQHNCQFLCVNTIGGFTCKCPPGFSQHQTACINNECSAPNSVCGSRASCVNTPGSFNCECSKGFSLDNTGMECEVDECSSNHRCQHGCQNMMGGYRCGCPQGYVQHYQWNQCVENECQSGTICGSASC 2434          

HSP 7 Score: 88.1965 bits (217), Expect = 4.025e-17
Identity = 210/944 (22.25%), Postives = 328/944 (34.75%), Query Frame = 1
Query:  334 CQNG---------KCICESGY----FGEDCNTAIISTCYVK---IDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFT-QKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC---------QYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIK-PYSVSFNGKSCIKKT--NYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNS-------NSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSE-----PLVSRYCSKSE---------------YYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRS-ENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNE-QYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLL---QEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDIS--------------EVSYQNPQSQSFCTRKEIIEK--CQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
            CQNG         +CIC  GY     G++C    I+ C V     D GLC++TP +   +                       CPKG+  + ++   +I+EC+  + C+NG C N  GSF C+C     LD     C           + ++C++  +   +  +C  T    +   C +   +    G + +K      + C  F  +C   G C     S+ C C  G       ++C++ S       + D C  P   +      C + G  +   C          +EC +  T E     P    + ++ +               +  LC  G+C +    + C+C+ GF  T   R C  I+    +C ++   C  G C     + +EC+C  G+       ++C+  E        CE     C  G C       Y C C  GY  S +    + NE Q  D          C+ GQCV+   +Y+C C   Y ++ + Q CV                           +D        C      +E   +CS  E      PD   C +   +E    C GG+C  +    ++CLC  GF ++ D R+C    V++C  N NIC  G CE +  S F C C     + K    C I+    E     CD+             +  C+  PG                                      +++C+C  G+I               IK+  C L    C            Y C C  G+    D  +C  MD  +CA N   C+ G C +   GY C C   +T TE+ + C +     +++ +               +  Y+  +S   CT  E  +   C  G CV     Y C CP  F+ N     CV     C
Sbjct:  595 CQNGICENLLGSYRCICNIGYESDTSGKNC---FINECLVNRLLCDNGLCRNTPGSYTCT-----------------------CPKGYVFRPDSETCEINECE-SNPCVNGACRNVAGSFHCECAHGSKLDSTNTICVSMKSTCWLTIQDNRCEVNINGATLKSECCSTLGAAWGSPCDRCEITACSRGFARMKGLVCEIDECEVFPGVCT-NGRCVNTQGSFLCECAEGLTLDSTGRTCVMRSELCYKKWHEDECGEPLPGKYRLDMCCCTVGAAWGVDC----------EECPKEDTPEFKAICPRGPGFANRGDILTGRPFYKVNECKVFRGLCTHGNCRNTIGSFKCRCNSGFTLTAEERNCTDID----ECRISPDLCGHGTCVNTPGS-FECECFEGYQSGFMMMKNCMIDE--------CETNPALCLGGTCLNT-DGSYECECPSGYLLSSEAS--VMNECQLSD--------SLCKNGQCVNMPGTYQCSCDTGYQATPDRQGCVD--------------------------IDECTIMNGGCETHCTNSEGSYECSCTEGYALM-PDLRTCSIDECEETPDICDGGQC-SNIPGEYRCLCFDGFMASMDMRTC---IVNECDLNPNICLHGDCENTKGS-FICHCQLGYFVKKGSTGCTIDEC--EIGAHNCDM-------------HAACVNLPG--------------------------------------SFKCRCQAGWIGDG------------IKRDECTLEDNSCHHNADCANTPGSYRCMCKEGFNG--DGFTCS-MD--ECADNVNLCENGQCLNAPGGYRCECEMGFTPTEDSKACQIDECNFQNICVFGTCQNLPGMFRCVCDDGYELDRSGGNCTINECADPVNCINGICVNTPGSYLCNCPGDFELNPTGVGCVNRVGNC 1374          

HSP 8 Score: 88.1965 bits (217), Expect = 4.199e-17
Identity = 140/625 (22.40%), Postives = 222/625 (35.52%), Query Frame = 1
Query: 1168 SLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERT-----RNSTSICELYGHR------CQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSR---CMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIG--QNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQN---------PQSQSFCTRKEIIE-------KCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKC 2934
             LC GG+C++    Y C+C  G   +E   +  +  TI   C        GG C     + Y C C RG+I S +G  C++   T      N     EL G        C+TG C+ +     +C  + G +++             D C++  ++  C  G+C+   +SYRC C+  Y   +  +EC+  +    P V              G+CV+T                 G    R  K     P    C++ E +     C  GRC+ +    F+C+C  GF   SDG++C     D+C    N+C  G C     S F+C+C    +L+ +G  C I+   T               C +G C+N     RC C PG     DG+ C      ++                             Y   + G        A+ K   C    +      C P     +++   C  G    TD +        +CA++   C+ G C +++  Y CIC   Y    +G++C +    V  +       +N         P+   F    E  E        C  G C      + C+C H  K +  +  CV   + C
Sbjct:  192 GLCSGGNCINTVGSYECKCPAGHRQSETSHKIDECSTIPGVC-------DGGECSNTAGS-YVCTCPRGYISSTDGSRCVQRVGTCFSALANGRCAAELNGQYTKMQCCCETGRCWALGQIPEMCP-VRGSNET------------IDVCKH--LTNLCLNGRCIPTASSYRCECNMGY-KQDIRRECIVDECLNNPCVN-------------GDCVNTP----------------GSYYCRCHKGYQGTPTKQACIIDECIVNGVMCRNGRCV-NTEGSFQCICNAGFELTSDGKNC---IHDECATT-NMCLNGMCINEDGS-FKCICKPGFTLAPNGRYCTIDECQTPGI------------CMNGRCINSEGSFRCECPPGLAVDVDGRVCVDTHMRTTC----------------------------YGAIKMGTCSRPLPGAVTKSECCCFSPDHGFGQPCQPCPSRNSEFQAVCSSGIGITTDGRI------NECALDPDICQNGICENLLGSYRCICNIGYESDTSGKNCFINECLVNRLLCDNGLCRNTPGSYTCTCPKGYVFRPDSETCEINECESNPCVNGACRNVAGSFHCECAHGSKLDSTNTICVSMKSTC 711          

HSP 9 Score: 80.1073 bits (196), Expect = 1.380e-14
Identity = 191/838 (22.79%), Postives = 296/838 (35.32%), Query Frame = 1
Query:  577 IDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICEL-------YGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCI-KNEQYKDYCQN------------------QEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKC------------SRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG--FKCLC---LPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGK----ECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQN---------PQSQSFCTRKEIIEK-------CQPGKCVEKQEDYQCKCPHSF 2886
            ++EC    +ICL+G+C N KGSF C C   +++ + +  C    D+C++   +C +   CV    G + C C       + G   IK+   + C      C    +C     SY C C  GF+   D  +C ++  +D          C  G C++   GYRC C   +    + + C               +  + ++C  G+C +L   + C C +G+    +   C       ++CA +   C  G C     + Y C C   F  +  G  C+      N    C L        G  C   V   +      C C +  +  E  + C   N +YK  C                    QE+   C+GG+C++   S++C C   Y           Y   +   +  C    +  +C  G C +T  NY C C   Y     G  C               E +++       C     + +     C    T    ++ LC    PGF    D  +  P  +D+C     IC  G C     S FRC CP   S +       I  +  E  +   D L  R    + NC+N     RC C PG+K S  G     EC +I  V S            G       +Y C C NG+  + +   C+  E            R+ C  G C       Y C C  G+ + T    C+ +D    A+    C+ G C + +  + C+C   Y  T +G++C++          S  + QN         P        + II +       CQ G C      +QC C   F
Sbjct: 1129 VNECDLNPNICLHGDCENTKGSFICHCQLGYFVKKGSTGCTI--DECEIGAHNCDMHAACV-NLPGSFKCRC----QAGWIGDG-IKR---DECTLEDNSCHHNADCANTPGSYRCMCKEGFNG--DGFTCSMDECADN------VNLCENGQCLNAPGGYRCECEMGFTPTEDSKAC------------QIDECNFQNICVFGTCQNLPGMFRCVCDDGYELDRSGGNCT-----INECA-DPVNCINGICVNTPGS-YLCNCPGDFELNPTGVGCV------NRVGNCFLDILPRGDGGIYCTAEVGVGV--TRASCCCAKALAWGEPCEICPSPNSEYKTLCPGGEGFRPNPITVILEIDECQELPGLCQGGKCINTFGSFQCECPAGY-----------YLNEDTRIIDECVT--HIGICGPGTCYNTFGNYTCVCPPEYMQVNGGNNCMMRKSVCYRNFNDTCENELSFNMTKKMCCCAYNVGKAWNKPCEACPTPATEYQLLCGNQAPGFII--DIHTGKP-IIDECREIPGICANGVCINQIGS-FRCECPMGFSYNN------ILLIIDECNSG--DNLCQR----NANCINIPGSYRCECSPGFKLSPGGACLRNECQEIPNVCS-----------HGECIDTQGSYRCLCHNGFKATADQTMCMIDE----------CERQPCGNGTCKNT-VGSYNCLCFPGF-ELTHNNDCMDIDECS-ALQGQVCRNGRCINELGSFQCLCSEGYENTADGKNCVINECLNFPGTCSPGTCQNLDGTFRCICPPGYEVQNEQCIINECDVEPNICQFGTCTNTPGSFQCSCQPGF 1867          

HSP 10 Score: 76.2554 bits (186), Expect = 2.041e-13
Identity = 190/856 (22.20%), Postives = 298/856 (34.81%), Query Frame = 1
Query:  532 YCPKGFTQKENR-CDDIDECQF--KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSC--------IVNSNSDICQSPEIAERCRGGSCVS----EGKGYRC-LCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYY---SLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIE-TITSQCA-------LNQFQC------QGGRCQELDNN------------------NYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGE------------CVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDG---KECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSY-QNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSF 2886
             C  GF    N  C DIDEC      +C NG CINE GSF+C C   +    +  +C    ++C  +  +C   G C    DG + CIC   Y V    + CI     N C+    +C  +G C     S+ CSC  GF  S++K+ C                C  P+     +   C S    EG G+ C LC  +   +N    C     + P +      +E      +C+ G C++ +  + C+C  G+        C+  E +I + C        +  F+C      + G     + N                  +YEC C  G++  ++ R C + +        CE  G  C+  +        ++C C  G  +  D + C+ NE     C+ +     C+ G+C++   SYRC C+  +  S  G EC+  K         C      ++CQ               C                 T   +K   +    T +   + C +   L  C  G+CI +    F+C C  G+ +     S     +D+C  +   C    C+ +  S + C CP   +L  DG +C ++  +T+     C  L          CVN      C C PG+   +      EC     V                      ++ C+C  G+     G  C   E +            +C+ G    +G   Y C C  GY Q      C+  +     +    C    CY+ +  + C C   +   +N   C          D++E S   NP              C  G C      YQC CP  F
Sbjct: 1740 LCFPGFELTHNNDCMDIDECSALQGQVCRNGRCINELGSFQCLCSEGYENTADGKNCVI--NECLNFPGTCSP-GTCQ-NLDGTFRCICPPGYEVQ--NEQCI----INECDVEPNICQ-FGTCTNTPGSFQCSCQPGFVLSDNKRRCYDTRESFCFTKFEGGKCTVPKAFNTTKAKCCCSKMPGEGWGFPCELCPNQNDAFNT--LCPYGHGALPGLDDTREMNECLENPGICQNGICINTDGSFRCECPFGYNLDFTGVNCVTDECSIGNPCGNGTCTNVVGGFECSCQEGFEPGPMMTCEINECSQNPLLCAFRCVNTFGSYECMCPAGYVLRDDQRMC-RQDECSEGMDDCESKGMTCKNLI------GTFMCICPPGMQRRPDGEGCMLNE-----CRAK--PGICKNGRCINTVGSYRCECNDGFEPSLTGTECINRKG-------FCYTEVLRTMCQQSSTNRNSVTKSECCCNMGRGWGPQCELCPLPGTVQYKKMCPLGPGFTTDGRINECQVMPDL--CQNGQCI-NTIGSFRCHCNIGYKADFTATS-----MDECSLSPKPCN-FLCKNTEGS-YLCSCPRGYTLQPDGKTCKLDECSTK--QHNCQFL----------CVNTIGGFTCKCPPGFSQHQTACINNECSAPNSVCG----------SRASCVNTPGSFNCECSKGFSLDNTGMECEVDECS---------SNHRCQHGCQNMMG--GYRCGCPQGYVQHYQWNQCVENECQSGTI----CGSASCYNTLGSFKCTCPSGFEFEQNAGGC---------QDVNECSMGANP--------------CIYG-CSNTDGGYQCGCPGGF 2490          

HSP 11 Score: 73.1738 bits (178), Expect = 1.643e-12
Identity = 148/660 (22.42%), Postives = 237/660 (35.91%), Query Frame = 1
Query:  346 KCICESGYFGED----CNTAIISTCYVKIDRGLCKSTPENLQLSKEECC--SIFQVAWGNPCVFCDR------NYCPKGFTQKENRCD--DIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNS---DICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRS-CIKAERTRNSTSICEL-------YGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTY-GFKCLCLPGFTSASDGRSCDPEYVDQCLNNE-----NICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKY-CDILVNRLRCA 2226
            +C C+ G+   D    C     S C+ K + G C + P+    +K +CC   +    WG PC  C          CP G        D  +++EC +   IC NG CIN  GSFRC+CP  + LD   ++C    D+C + G+ CG  G C     G + C C + +         +     N C+    LC     C     SY C CP+G+   +D++ C  +  S   D C+S       +G +C +    + C+C    Q         R    E  +   C       +C+ G C++    Y C+C++GF  +     CI                                  +GF  +E  R+ C ++   RNS +  E        +G +C+          + +C    G++       C   +   D CQN         GQC++   S+RC C+  Y +            +  P   LC   E   LC                                 +  T +PD   C L E  ++    + +   T  GF C C PGF+          ++   C+NNE     ++C       +   +F C C    SL   G  C ++  ++    ++ C  ++   RC 
Sbjct: 1860 QCSCQPGFVLSDNKRRCYDTRESFCFTKFEGGKC-TVPKAFNTTKAKCCCSKMPGEGWGFPCELCPNQNDAFNTLCPYGHGALPGLDDTREMNECLENPGICQNGICINTDGSFRCECPFGYNLDFTGVNCV--TDECSI-GNPCG-NGTCTNVVGG-FECSCQEGFEPGP-----MMTCEINECSQNPLLCA--FRCVNTFGSYECMCPAGYVLRDDQRMCRQDECSEGMDDCES-------KGMTCKNLIGTFMCICPPGMQ---------RRPDGEGCMLNECRAKP--GICKNGRCINTVGSYRCECNDGFEPSLTGTECIN--------------------------------RKGFCYTEVLRTMCQQSSTNRNSVTKSECCCNMGRGWGPQCELCPLPGTVQYKKMCPLGPGFTTDGRINEC---QVMPDLCQN---------GQCINTIGSFRCHCNIGYKADFTATSMDECSLSPKPCNFLCKNTEGSYLCS------------------------------CPRGYTLQPDGKTCKLDECSTKQHNCQFLCVNTIGGFTCKCPPGFS----------QHQTACINNECSAPNSVCGSRASCVNTPGSFNCECSKGFSLDNTGMECEVDECSSNHRCQHGCQNMMGGYRCG 2404          

HSP 12 Score: 62.7734 bits (151), Expect = 2.669e-9
Identity = 208/903 (23.03%), Postives = 323/903 (35.77%), Query Frame = 1
Query:  184 CVKSECDYD-CGYGRC---VGLNVCECYDKTIRTETCPQNNQKLCTNNCSN-KGQ-CQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKE----ECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENRCDDIDECQFK-SICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQ---CQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGL--------------------------SYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSY---RCVCHGKYISSNNGQEC--------VRYKQTEPPAVRLCSKWE------YYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSE--SALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNY 2694
            C+  EC+   CG G C   VG   C C+     T     NN  +  + CS  +GQ C+NG+CI E G F                 + LC    EN    K     EC +         C   D  +   CP G+  +  +C  I+EC  + +IC  G C N  GSF+C C P   L +N   C   R+     +  G  C +  K   T+  +  C  +      F  + C  + +      F  LC PYG     GL                          S+ C CP G++      +C+ +  S       I   C  G+C +   G+ C C   ++               P+++   ++     L     CV+    Y C C  G+   +++R C + E       ++  + +G  C+ L    + C C  G  R  +G  C+  E  R    IC+    RC   V        Y C C +G+  S     CI     K +C  + +   C+  Q  +N NS     C C+   +    G +C        V+YK+  P      +            LCQ G+C++T  ++ C C  GY A       S  E  ++ +P N  C   E                 + C C  G+T   DG++C    +D+C   ++ C        G   F C CP     S+   +C+ N  +            N +  +  +CVN      C C  G+     G EC ++++ SS                     Y C C  GY++      C+++E  S  I           C +  CY      + C C  G++   +   C   D  +C++    C  G C +   GY C C G +
Sbjct: 1715 CMIDECERQPCGNGTCKNTVGSYNCLCFPGFELT----HNNDCMDIDECSALQGQVCRNGRCINELGSF-----------------QCLCSEGYENTADGKNCVINECLNFPGTCSPGTCQNLDGTFRCICPPGYEVQNEQCI-INECDVEPNICQFGTCTNTPGSFQCSCQPGFVLSDNKRRCYDTRESFCFTKFEGGKCTV-PKAFNTTKAKCCCSKMPGEGWGFPCELCPNQNDA-----FNTLC-PYGHGALPGLDDTREMNECLENPGICQNGICINTDGSFRCECPFGYNLDFTGVNCVTDECS-------IGNPCGNGTCTNVVGGFECSCQEGFE-------------PGPMMTCEINECSQNPLLCAFRCVNTFGSYECMCPAGYVLRDDQRMCRQDECSE---GMDDCESKGMTCKNLIGT-FMCICPPGMQRRPDGEGCMLNE-CRAKPGICK--NGRCINTV------GSYRCECNDGFEPSLTGTECINR---KGFCYTEVLRTMCQ--QSSTNRNSVTKSECCCN---MGRGWGPQCELCPLPGTVQYKKMCPLGPGFTTDGRINECQVMPDLCQNGQCINTIGSFRCHCNIGYKADFTAT--SMDECSLSPKPCNFLCKNTEG---------------SYLCSCPRGYTLQPDGKTCK---LDECSTKQHNCQFLCVNTIGG--FTCKCP--PGFSQHQTACINNECSAP----------NSVCGSRASCVNTPGSFNCECSKGFSLDNTGMEC-EVDECSSNHRCQHGCQNMM-------GGYRCGCPQGYVQHYQWNQCVENECQSGTI-----------CGSASCYNT-LGSFKCTCPSGFEFEQNAGGC--QDVNECSMGANPCIYG-CSNTDGGYQCGCPGGF 2490          

HSP 13 Score: 55.4546 bits (132), Expect = 3.937e-7
Identity = 82/366 (22.40%), Postives = 134/366 (36.61%), Query Frame = 1
Query: 1909 QEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCAS---GNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDD-----------NNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEV--------------SYQNPQSQSFCTRKEIIEK--CQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            Q     C GG CI +    ++C C  G   +          +D+C     +C  G C  +  S + C CP     S DG  C+    T       C   +   RCA+   G     +C C  G         C+ + ++  +C +         C+ L +           ++Y C+C  GY K +  R CI  E               C  G C       Y C C  GY+    K++CII    +C VN   C+ G C +    + CIC   + +T +G++CI    A  ++ ++ +               +    +  +CT  E      C  G+C+  +  ++C+CP     +     CV
Sbjct:  188 QAVPGLCSGGNCI-NTVGSYECKCPAGHRQSETSHK-----IDECSTIPGVCDGGECSNTAGS-YVCTCPRGYISSTDGSRCVQRVGT-------CFSALANGRCAAELNGQYTKMQCCCETG--------RCWALGQIPEMCPVRGSNETIDVCKHLTNLCLNGRCIPTASSYRCECNMGY-KQDIRRECIVDECL----------NNPCVNGDCVNT-PGSYYCRCHKGYQGTPTKQACII---DECIVNGVMCRNGRCVNTEGSFQCICNAGFELTSDGKNCIHDECATTNMCLNGMCINEDGSFKCICKPGFTLAPNGRYCTIDECQTPGICMNGRCINSEGSFRCECPPGLAVDVDGRVCV 516          

HSP 14 Score: 54.299 bits (129), Expect = 8.698e-7
Identity = 113/476 (23.74%), Postives = 176/476 (36.97%), Query Frame = 1
Query:  319 SNKGQCQNGKCICESGYFGEDCNTAIIST------------CYVKIDRGLCKSTPENLQ-LSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQ-ECVRYGTSEPLVSRYCSKSEYYSLCEG-GSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECV 1701
            +  G C+NG+CI   G +  +CN     +            CY ++ R +C+ +  N   ++K ECC      WG  C  C     P   T            Q+K +C  G              P    D     CQ   D CQ         G+C+ T  G + C C   Y   F        T+ + C+   K C     C+    SY CSCP G+    D K+C ++  S    + +         CV+   G+ C C     G++  Q  C+    S P            S+C    SCV+    + C+CS+GF           +E    +C+ N  +CQ G CQ +    Y C C +G+++      C++ E        C+  G  C +  CY      + C C  G+   ++   C      +D  +    +  C  G C +    Y+C C G +  +  GQ C+
Sbjct: 2118 AKPGICKNGRCINTVGSYRCECNDGFEPSLTGTECINRKGFCYTEVLRTMCQQSSTNRNSVTKSECCCNMGRGWGPQCELC-----PLPGTV-----------QYKKMCPLG--------------PGFTTDGRINECQVMPDLCQ--------NGQCINTI-GSFRCHCNIGYKADF------TATSMDECSLSPKPCNFL--CKNTEGSYLCSCPRGYTLQPDGKTCKLDECSTKQHNCQFL-------CVNTIGGFTCKC---PPGFSQHQTACINNECSAP-----------NSVCGSRASCVNTPGSFNCECSKGFSLDN-----TGMECEVDECSSNH-RCQHG-CQNM-MGGYRCGCPQGYVQHYQWNQCVENE--------CQ-SGTICGSASCYNTL-GSFKCTCPSGFEFEQNAGGC------QDVNECSMGANPCIYG-CSNTDGGYQCGCPGGFYRA--GQHCI 2498          
BLAST of Fibrillin-2 vs. Ensembl Medaka
Match: FBN1 (fibrillin 1 [Source:NCBI gene;Acc:101171649])

HSP 1 Score: 118.627 bits (296), Expect = 2.372e-26
Identity = 231/973 (23.74%), Postives = 353/973 (36.28%), Query Frame = 1
Query:  310 NNCSNKGQCQNGKC---------ICESGYF----GEDCNTAIISTCYVK--IDRGLCKSTPENLQLSKEECCSIFQV--AWGNPC------------VFCDRNYCPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYY----------------SLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESAL----IKKSICDLHREK----------CKTG--------ICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY----CFYGCFDENSISTCSCSENY 3000
            N C + G C  G+C         IC + Y     G +C     S CY    +D G C        ++K+ CC  + +  AW  PC            + C              R  DIDEC +   +C NG CIN  GSFRC+CP     ++  + C+   D+CQ  G  C     C+    G + C C   +  +  G+ C+ +   N CN    +C P G+C     SY C CP+G+  + D+  C+   + D C+     + C  G+C +    Y CLC   Y G+ N          E    R         LC  G+C ++   + C C++G+  T + R C  I    ++CA+N   C  G C  +D + Y C C  G+   E   +C   +    S  IC         G C       + C C EG+  S   + C+  +   +YC  +  + RC   +   N +   C C  +      G  C      +  A R+    E Y                + C  G+C++T+ ++ C+C  GY    +G  C  I +     P             C  G C  +   GF+C C  GF     G     E +++C  N  +C   RC     S + C CP    L +D   C             C+  ++        C N      CIC PGY     G  C  + + ++   + +              +Y C+C  G++ +     CI +        +  ++C +              C  G        +C   G + Y   C LG    TD +     D  +C V    CK G C +    Y CIC+  YT           I + + VDI E   Q P+  +F              C   +  Y C CP  +        C RD ++C      C + C +     TC C   +
Sbjct: 1661 NECEHPGICGPGQCYNTIGNYTCICPADYMPVNGGNNCMDMRKSYCYRNFYLDNGTCDGE-LTFNMTKKMCCCSYNIGRAWNKPCEQCPVPSTDEFAILCGSERPGYYIDITTGRVIDIDECREIPGVCENGVCINMIGSFRCECPIGFIYNDKLLICE-DIDECQ-NGPVCQQNANCL-NMPGSFRCECEHGFRFTPTGQ-CLDR---NECNENPGICNP-GQCIDILGSYRCVCPNGYKTTRDQSMCV---DVDECER----QPCGNGTCKNTLGSYNCLC---YPGFQNSHNGDCIDVDECSTQR--------GLCRNGNCRNIVGSFLCVCNDGYELTLDGRVCTDI----NECAVNPGTCGAGTCVNMDGS-YRCICPPGYYLHE--ETCEDIDECSQSPEICTF-------GTCSNTE-GSFTCQCPEGFQLSASGRRCL--DIRVNYCFTKFENGRCLVPK-PQNISKEACCCT-RMPGQGWGDPCELCPAKDQEAYRVLCPNEGYERGKDDNPTDINECLNNPCVNGQCINTDGSFRCECPIGYNLDTSGVTCIDINECDIGNP-------------CGNGTCT-NAIGGFECTCDEGFEP---GPMMSCEDINECSQNPLLCA-FRCVNVVGS-YECKCPTGYVLREDRRMC--------KDQNECEDGIDDCASRGMTCKNLIGTYMCICSPGYTRHPSGDGCIDLNECATKPGICRNGRCENTV-----GSYRCKCDQGFVANPTQTECIDNREDFCYTEVLTTLCQMSSSNRNLVTKSECCCDGGRGWGINCELCPLPGTSQYKKMCPLGPGYTTDGR-----DIDECRVMGNLCKNGQCVNTKGSYKCICIPGYTT---------DITSTQCVDIDEC-IQAPKPCNF-------------ICKNTEGSYLCSCPRGYILQEDGKSC-RDLDECSTKQHNCQFLCINTIGGFTCKCPPGF 2526          

HSP 2 Score: 112.079 bits (279), Expect = 2.628e-24
Identity = 206/862 (23.90%), Postives = 319/862 (37.01%), Query Frame = 1
Query:  535 CPKGF--TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVC--NYFKKLCL-------------------PYGE-CQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACL-EGY----SQSEDRKYC------IKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTE--------------PPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEP---DNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENIC-------TPG------------------------RCERSGN-----------SNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDR----CICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKC 2826
            C  GF  T     C D DEC  +++CLNG CINE GSF+C C     LD +   C    D+C+  G    + G CV T +G + C C+   +V  +G+ C+     + C   Y +  C+                    YGE CQP       + P        K   + ++ SDI +     + C+ G C +  + Y+C CN  ++   + + CV    +E +++          LC+ G C +    + CQC +GF        C  I    S   +N      G C      ++ C C         G  CI+   T  ST   ++  +RC+  +        + CA L E +    ++ E    C      +K    +D  + Q     C  G+CV+   S+ C C        +G+ C+  +                 P   R+ +      +  G EC +                  G   S     +   P   D + C +   L  C  GRC  +    F+C C  GF   +D R+C    +D+C  + ++C       TPG                         CER+              +F+C+CP    ++ DG +C             CD L +RL C +G CVN      C C  GYKS+ED   C  I++ +                   + +YEC C NGY    + RSCI  +        C+ +   C  G C  I    Y C C  G+  + D KSC+ +D  +C +N   C  G C +    ++C C   Y+V +    C         ++  E+   N   Q+ CT      KC
Sbjct:  566 CNAGFEITADGKNCQDQDECLIRNMCLNGLCINEDGSFKCICKSGFLLDTSGRMC-VDIDECETPGMC--MNGHCVNT-EGSFRCECMAGMAVGLDGRVCVDTHMRSTCYGGYNRGQCVRPLFGVVTKSECCCASTEYAYGEPCQPCPRESSGTDPCCLSSCAHK---VPSAFSDINECALDPDICQNGVCENMQRTYKCTCNTGFEVDLSGRNCVDI--NECMMNSL--------LCDNGLCRNTPGSFTCQCFKGFRFDPETDVCEDINECESNPCIN------GDCVN-SQGSFVCTCSAASSLDSTGLECIE---TVKSTCWLKMVNNRCEVNINGATL-KSHCCATLGEAWNSPCAKCEKDPICGKGFARVKGNVCEDVDECQVFPGVCINGKCVNTQGSFFCQCPPGMTVDVSGRTCIDLRTEHCYLTHDDERCGTPIPGRHRVDACCCSVGVAWGPECDEC---PENGTPEFAQLCPRGPGFSHRGDFINGRPFLKDINECRMINTL--CSNGRCR-NTIGSFRCRCDNGFALDADERNC--TDIDECRISPDLCGQGTCVNTPGDFECNCFEGFESGFMMMKNCMDIDECERNPQLCRGGECVNTEGSFQCICPPGHEITPDGSACQ--------DINECD-LSDRL-CRNGQCVNMVGSYYCNCNTGYKSTEDLVNCVDIDECT------IENGGCETFCTNSEGSYECSCHNGYALMPDQRSCIDIDE-------CEENPSTCDGGQCTNI-PGTYQCLCFDGFMSSEDMKSCLDVD--ECELNSNICLSGNCENTKGSFICHCDLGYSVRKGTTGCT-------DINECEIGAHNCDRQATCTNTAGSFKC 1358          

HSP 3 Score: 108.997 bits (271), Expect = 1.810e-23
Identity = 196/849 (23.09%), Postives = 316/849 (37.22%), Query Frame = 1
Query:  580 DECQF-KSICLN----------------------------------------GECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEG----GSCV----DLNNDYYCQCSEGFYA-TENRRRCIKIETITSQC-------------------ALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYY---SLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQC--LNNENIC---TPGR--------------------CERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDI----LVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKE 2811
            + CQF +++CLN                                        GEC+N  GS+ CQCP           C+   D+C   G  C   G+CV T +G + C+C   + ++ +GK+C  +         + +CL  G C     S+ C C SGF      + C+   + D C++P +   C  G CV+    +RC C                G +  L  R C  +   S C G    G CV     +     C C+   YA  E  + C +  + T  C                   AL+   CQ G C+ +    Y+C C  GF    +GR+C+           C +    C  G+C    P  + C C +G+    +   C      +D   N+  S  C  G CV++  S+ C C       + G EC+   ++      + ++ E     +  +   C      +   C         G+  +R++  V E+ D      Q +   C+ G+C+  +   F C C PG T    GR+C     + C   +++  C    PGR                    C  +G   F  +CP     S  G     +++   P  K  DI    ++N L C++G C N     RC C  G+    D + C  I++             G G       ++EC C  G+   E+G   +K+    +    C+ + + C+ G C    +  + C C  G++   D  +C   D  +C +++  C+ G C ++V  Y C C   Y  TE+          V  VDI E + +N   ++FCT  E
Sbjct:  459 NPCQFYRNLCLNGRCVPLPGGTYRCECNMGFKLDRRGECIDDDECERNPCAHGECVNTPGSYICQCPAGFQSTATRTECR-DLDECVANGRICN-NGRCVNT-EGSFHCVCNAGFEITADGKNCQDQDEC----LIRNMCL-NGLCINEDGSFKCICKSGFLLDTSGRMCV---DIDECETPGM---CMNGHCVNTEGSFRCEC--------------MAGMAVGLDGRVCVDTHMRSTCYGGYNRGQCVRPLFGVVTKSECCCASTEYAYGEPCQPCPRESSGTDPCCLSSCAHKVPSAFSDINECALDPDICQNGVCENM-QRTYKCTCNTGFEVDLSGRNCVDINE-------CMMNSLLCDNGLCRNT-PGSFTCQCFKGFRFDPETDVC------EDI--NECESNPCINGDCVNSQGSFVCTCSAASSLDSTGLECIETVKSTCWLKMVNNRCEVNINGATLKSHCCATLGEAWNSPCAKCEKDPICGKGFARVKGNVCEDVDE----CQVFPGVCINGKCVNTQG-SFFCQCPPGMTVDVSGRTCIDLRTEHCYLTHDDERCGTPIPGRHRVDACCCSVGVAWGPECDECPENGTPEFAQLCPRGPGFSHRG-----DFINGRPFLK--DINECRMINTL-CSNGRCRNTIGSFRCRCDNGFALDADERNCTDIDECR-----ISPDLCGQGTCVNTPGDFECNCFEGF---ESGFMMMKN---CMDIDECERNPQLCRGGECVNT-EGSFQCICPPGHEITPDGSAC--QDINECDLSDRLCRNGQCVNMVGSYYCNCNTGYKSTED---------LVNCVDIDECTIENGGCETFCTNSE 1226          

HSP 4 Score: 103.99 bits (258), Expect = 7.549e-22
Identity = 255/1103 (23.12%), Postives = 395/1103 (35.81%), Query Frame = 1
Query:  316 CSNKGQCQNG----KCICESGYF--GEDCNTAIISTCYVKID---RGLCKSTPENLQ-----------------LSKEECCSIFQVAWGNPCVFCDRNY---CPKG--FTQKENRCDDIDECQFKS-ICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCI------VNSN-------------------------------SDICQSPEIAERC-RGGSCVSEGKGYRCLCNGEYQGY-----------------NNDQECVRYGTSEPLVSR--------YCSKS----EYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKI-ETITSQCALNQ--------FQCQ----------GGRCQELDN----------------NNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVC---YPIYPNEYICACLEGYSQSEDRKYC--IKNEQYKDYCQN-------------------QEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYG------------------------------FKCLC---LPGF-TSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGK-----ECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCP----YCFYG-CFDENSISTCSCSENYE 3003
            CSN G+C+N     +C C++G+    ++ N   I  C +  D   +G C +TP + +                 +  +EC    Q+  G  CV  + ++   CP G   T   + C DI+EC     +C NG+C+N  GS+ C C   +   E+ ++C    D+C +    C  F      S+G Y C C   Y++  + +SCI   + + C      C   G+C     +Y C C  GF  SED KSC+      +NSN                               +DI +    A  C R  +C +    ++C C   + G                  NN+ EC     S   V +        +CS S    E   LCE G C++L   + C+C  GF  T + + C  I E I +   +N         F+C+          GG C +++                   Y C C   F  +  G  C+   R+ +        G   +  VC     +  ++  C C EG       + C  + +  YK  C                     QE+   C+GGQC++   S++C C   +  + + + C    + E P +           C  G+C +T  NY C C   Y     G  C  + K        SYC    YL     G C G+ T+                               F  LC    PG+    + GR  D   +D+C     +C  G C     S FRC CP     +     C  I+     P  +            + NC+N     RC C  G++ +  G+     EC +   + +      +             +Y C C NGY  + +   C+  +         +  R+ C  G C       Y C C  G+ Q +    CI +D  +C+     C+ G C +IV  +LC+C   Y +T +GR C          DI+E +  NP +            C  G CV     Y+C CP  +   Y   E   D ++C      C +G C +     TC C E ++
Sbjct: 1049 CSN-GRCRNTIGSFRCRCDNGFALDADERNCTDIDECRISPDLCGQGTCVNTPGDFECNCFEGFESGFMMMKNCMDIDECERNPQLCRGGECVNTEGSFQCICPPGHEITPDGSACQDINECDLSDRLCRNGQCVNMVGSYYCNCNTGYKSTEDLVNC-VDIDECTIENGGCETF---CTNSEGSYECSCHNGYALMPDQRSCI---DIDECEENPSTC-DGGQCTNIPGTYQCLCFDGFMSSEDMKSCLDVDECELNSNICLSGNCENTKGSFICHCDLGYSVRKGTTGCTDINECEIGAHNCDRQATCTNTAGSFKCNCAPGWIGNGLKCTDLDECSNGTHSCNNNAECQNTMGSYRCVCKEGYFGDGFFCSDSDECAENSDLCENGHCLNLPGGFRCECDMGFITTADGKACEDIDECIFADICVNGRCQNLPGLFRCECNIGYERDTSGGNCTDINECADPTTCINGICVNIPGTYLCNCPPDFELNPTGVGCVDI-RSGSCYLNVLARGDASENYVCSQEIGVGVSKASCCCSEGAGWGSPCEACPHVNSTGYKTLCPGGEGFRPNPITVILEDINECQELPGLCQGGQCINTFGSFQCECPRGFSLNLDTRVCEDINECEHPGI-----------CGPGQCYNTIGNYTCICPADYMPVNGGNNCMDMRK--------SYCYRNFYLDN---GTCDGELTFNMTKKMCCCSYNIGRAWNKPCEQCPVPSTDEFAILCGSERPGYYIDITTGRVID---IDECREIPGVCENGVCINMIGS-FRCECPIGFIYNDKLLICEDIDECQNGPVCQ-----------QNANCLNMPGSFRCECEHGFRFTPTGQCLDRNECNENPGICNPGQCIDIL-----------GSYRCVCPNGYKTTRDQSMCVDVD---------ECERQPCGNGTCKNT-LGSYNCLCYPGF-QNSHNGDCIDVD--ECSTQRGLCRNGNCRNIVGSFLCVCNDGYELTLDGRVC---------TDINECAV-NPGT------------CGAGTCVNMDGSYRCICPPGY---YLHEETCEDIDECSQSPEICTFGTCSNTEGSFTCQCPEGFQ 2055          

HSP 5 Score: 100.138 bits (248), Expect = 1.056e-20
Identity = 246/1086 (22.65%), Postives = 380/1086 (34.99%), Query Frame = 1
Query:  307 TNNCSNKGQCQNG----KCICESGYFGEDCNTAIISTCYVKID---RGLCKSTPENLQLSKEECCSIFQVAWG------NPCVFCD--------------RNYCPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC-QYRRDQCQL----------------------------------YGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYY--SLCEGGSCVDLNNDYYC--------------QCS---------------EGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICEL----------------YGHR-------------------CQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL---INYVTTEPTTKYCDIL----VNRLRC----ASGNCVNDRCICGPGYKS-------SEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKS---------------ICDLHREKCKTGICYPI---GQNDYICA-------------CVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFDENSISTCSCSENYENLFDTGLC 3027
            T++C+N  +CQN     +C+C+ GYFG+    +    C    D    G C + P   +   +        A G      + C+F D              R  C  G+ +  +   C DI+EC   + C+NG C+N  G++ C CPPD  L+   + C   R   C L                                  +GS C     C   +   Y  +C        N  + I + + N C     LC   G+C     S+ C CP GF  + D + C    + + C+ P I   C  G C +    Y C+C  +Y   N    C+       +   YC ++ Y     C+G    ++     C              QC                 G+Y      R I I+    +C      C+ G C  +   ++ C+C  GFI ++    C   +  +N   +C+                 +G R                   C  G C  I    Y C C  GY  + D+  C+      D C+ Q     C  G C +   SY C+C+  + +S+NG +C+   +        CS      LC+ G C +   ++ C C +GY  T +GR C+ I +                   C  G C+ +    ++C+C PG+    +  +C  E +D+C  +  ICT G C  +  S F C CP    LS  G  CL   +NY  T+     C +     +++  C      G    D C   P             +G E  K +  + I       C  G C    D ++ C+C  GY    +G +CI      I                   CD   E      C  I    QN  +CA             C  GY    D++ C   +  +  +++   +G  C +++  Y+CIC   YT   +G  CI         D++E           C  K  I  C+ G+C      Y+CKC   F  N    EC+ +          C+ E   + C  S +  NL     C
Sbjct: 1381 THSCNNNAECQNTMGSYRCVCKEGYFGDGFFCSDSDECAENSDLCENGHCLNLPGGFRCECDM--GFITTADGKACEDIDECIFADICVNGRCQNLPGLFRCECNIGYERDTSGGNCTDINECADPTTCINGICVNIPGTYLCNCPPDFELNPTGVGCVDIRSGSCYLNVLARGDASENYVCSQEIGVGVSKASCCCSEGAGWGSPC---EACPHVNSTGYKTLCPGGEGFRPNPITVILE-DINECQELPGLCQ-GGQCINTFGSFQCECPRGFSLNLDTRVC---EDINECEHPGI---CGPGQCYNTIGNYTCICPADYMPVNGGNNCMD------MRKSYCYRNFYLDNGTCDGELTFNMTKKMCCCSYNIGRAWNKPCEQCPVPSTDEFAILCGSERPGYYIDITTGRVIDID----ECREIPGVCENGVCINMI-GSFRCECPIGFIYNDKLLICEDIDECQNG-PVCQQNANCLNMPGSFRCECEHGFRFTPTGQCLDRNECNENPGICNPGQCIDIL-GSYRCVCPNGYKTTRDQSMCVD----VDECERQP----CGNGTCKNTLGSYNCLCYPGFQNSHNG-DCIDVDE--------CSTQR--GLCRNGNCRNIVGSFLCVCNDGYELTLDGRVCTDINECAVNP------------GTCGAGTCV-NMDGSYRCICPPGYYLHEE--TC--EDIDECSQSPEICTFGTCSNTEGS-FTCQCPEGFQLSASGRRCLDIRVNYCFTKFENGRCLVPKPQNISKEACCCTRMPGQGWGDPCELCPAKDQEAYRVLCPNEGYERGKDDNPTDINECLNNPCVNGQCINT-DGSFRCECPIGYNLDTSGVTCIDINECDIGNPCGNGTCTNAIGGFECTCDEGFEPGPMMSCEDINECSQNPLLCAFRCVNVVGSYECKCPTGYVLREDRRMCKDQNECEDGIDDCASRGMTCKNLIGTYMCICSPGYTRHPSGDGCI---------DLNE-----------CATKPGI--CRNGRCENTVGSYRCKCDQGFVANPTQTECIDNRED------FCYTEVLTTLCQMSSSNRNLVTKSEC 2374          

HSP 6 Score: 98.9821 bits (245), Expect = 2.223e-20
Identity = 76/268 (28.36%), Postives = 108/268 (40.30%), Query Frame = 1
Query:  145 LCCSGWIKNVYGD-CVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAI---------------------------------ISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--NYCPKGF--TQKENRCDDIDECQ-FKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCI 831
             CC GW     G+ C+   C   CG G C   N+C C +  I      ++  + C   C N G C    C+C+ GY G  C   +                                    C+  ++  +C+     +  +K  CC+    AWG+PC  C    + C +GF    +   C D+DEC     IC  G CIN  GSF C+CP  H  +E +  C+   D+C      CG+ G+C  T  G Y C C + Y  S +G  CI
Sbjct:   75 FCCPGWKTLTGGNQCIVPICRSMCGDGFCSRPNLCTCPNGQIAPTCGSKSGIQNCNIRCMNGGSCAEDHCLCQKGYVGNHCGQPVCENGCLNGGRCVAPNRCVCTYGFTGAQCERDYRTGPCFASVNNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNHRTGACQDVDECHAIPGICQGGNCINTVGSFECKCPAGHKFNEISQKCE-DLDECSNIPGLCGV-GECSNTV-GSYFCKCPQGYYTSVDGSRCI 339          

HSP 7 Score: 97.0561 bits (240), Expect = 8.173e-20
Identity = 181/793 (22.82%), Postives = 294/793 (37.07%), Query Frame = 1
Query:  547 FTQKENRCDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIK-KTNYNVCNYFKKLCL------------------PYGECQPYGL-------SYYCSCPS-GFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGE-----------CVDTXXXXXXX--XXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSC--LINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSE----DGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVS-YQNP 2781
             T     C DI+EC      C  G C+N  GS+RC CPP +YL E T       D+C      C  FG C  T +G +TC C + + +S +G+ C+  + NY    +    CL                    G   P  L       +Y   CP+ G+ + +D     +N          +   C  G C++    +RC C   Y    +   C+             ++ +  + C  G+C +    + C C EGF         +  E I ++C+ N   C   RC  +   +YEC+C  G++  E+ R C       +    C   G  C+  +        Y+C C  GY++      CI      D  +       CR G+C +   SYRC C   ++++    EC+  ++        C      +LCQ              C D    +            ++  + C       T+  D   C +   L  C  G+C+  K   +KC+C+PG+T+      C    +D+C+     C    C+ +  S + C CP    L +DG SC  L    T +   ++  + +N +   +       C C PG+        D  EC     +              G  +    ++ C+C  G+    NG++C   +        CD    +C+ G    +G   Y C+C  GY Q      C+  D  +C +N   C G  C++ +  + C+C   +   +    C          DI+E S  QNP
Sbjct: 1974 LTLDGRVCTDINECAVNPGTCGAGTCVNMDGSYRCICPPGYYLHEETCE---DIDECSQSPEIC-TFGTCSNT-EGSFTCQCPEGFQLSASGRRCLDIRVNYCFTKFENGRCLVPKPQNISKEACCCTRMPGQGWGDPCELCPAKDQEAYRVLCPNEGYERGKDDNPTDINEC--------LNNPCVNGQCINTDGSFRCECPIGYNLDTSGVTCIDI-----------NECDIGNPCGNGTCTNAIGGFECTCDEGFEPGPM----MSCEDI-NECSQNPLLC-AFRCVNV-VGSYECKCPTGYVLREDRRMCKDQNECEDGIDDCASRGMTCKNLI------GTYMCICSPGYTRHPSGDGCI------DLNECATKPGICRNGRCENTVGSYRCKCDQGFVANPTQTECIDNRED------FCYTEVLTTLCQMSSSNRNLVTKSECCCDGGRGWGINCELCPLPGTSQYKKMCPLGPGYTTDGRDIDECRVMGNL--CKNGQCVNTKG-SYKCICIPGYTTDITSTQC--VDIDECIQAPKPCN-FICKNTEGS-YLCSCPRGYILQEDGKSCRDLDECSTKQHNCQF--LCINTIGGFT-------CKCPPGFTQHHSACIDNNECSSDPNLCG----------SNGVCQNTPGSFNCECQRGFSLDSNGQTCEDMDE-------CD-GNHRCQHGCQNLVG--GYRCSCPQGYLQHYQWNQCV--DENEC-LNTQICGGASCHNTLGSFRCLCPSGFDYEQTSGGC---------ADINECSTTQNP 2669          

HSP 8 Score: 93.9745 bits (232), Expect = 8.283e-19
Identity = 226/1003 (22.53%), Postives = 350/1003 (34.90%), Query Frame = 1
Query:  310 NNCSNKGQCQNGKCICESGYFGEDC--------------NTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDR--------------NYCPKGFTQKENRCDDIDECQF-KSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSC--IKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSE------------YYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIET--------------------ITSQCALNQFQCQGGRCQELDNNN---YECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYC---------------------------------------IKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEE-------------------------PDNSYCL----LQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECV 2916
            + C   G C NG C+   G F  +C              +T + STCY   +RG C      +    E CC+  + A+G PC  C R              +  P  F+       DI+EC     IC NG C N + +++C C     +D +  +C    ++C +    C   G C  T  G +TC C K +        C  I +   N C          G+C     S+ C+C +          CI    S  C    +  RC      +  K + C   GE      +  C +    +P+  +  ++ +            +  +C  G CV+    ++CQC  G     + R CI + T                        C  +     G  C E   N    +   C RG   S  G   I         + C +    C  G C       + C C  G++   D + C                                       +KN    D C+     + CRGG+CV+   S++C+C   +  + +G  C    + +              LC+ G+CV+   +YYC C  GY +TE+   C  I++   E                          PD   C+     +E  S C GG+C  +    ++CLC  GF S+ D +SC    VD+C  N NIC  G CE +  S F C C    S+ K    C  +    E     CD    R    +    + +C C PG+    +G +C  +++ S+         +          +Y C C  GY    +G  C  S+        C  + + C+ G C  +    + C C +G+    D K+C  +D  +C   +  C  G C ++   + C C   Y    +G +C          DI+E +  +P +            C  G CV     Y C CP  F+ N     CV
Sbjct:  624 DECETPGMCMNGHCVNTEGSFRCECMAGMAVGLDGRVCVDTHMRSTCYGGYNRGQCVRPLFGVVTKSECCCASTEYAYGEPCQPCPRESSGTDPCCLSSCAHKVPSAFS-------DINECALDPDICQNGVCENMQRTYKCTCNTGFEVDLSGRNC-VDINECMMNSLLCD-NGLCRNTP-GSFTCQCFKGFRFDPETDVCEDINECESNPC--------INGDCVNSQGSFVCTCSAASSLDSTGLECIETVKS-TCWLKMVNNRCEVNINGATLKSHCCATLGEAW----NSPCAKC-EKDPICGKGFARVKGNVCEDVDECQVFPGVCINGKCVNTQGSFFCQCPPGMTVDVSGRTCIDLRTEHCYLTHDDERCGTPIPGRHRVDACCCSVGVAWGPECDECPENGTPEFAQLCPRGPGFSHRGDF-INGRPFLKDINECRMINTLCSNGRCRNTI-GSFRCRCDNGFALDADERNCTDIDECRISPDLCGQGTCVNTPGDFECNCFEGFESGFMMMKNCMDIDECERN--PQLCRGGECVNTEGSFQCICPPGHEITPDGSACQDINECD----------LSDRLCRNGQCVNMVGSYYCNCNTGYKSTEDLVNCVDIDECTIENGGCETFCTNSEGSYECSCHNGYALMPDQRSCIDIDECEENPSTCDGGQCT-NIPGTYQCLCFDGFMSSEDMKSC--LDVDECELNSNICLSGNCENTKGS-FICHCDLGYSVRKGTTGC-TDINECEIGAHNCD----RQATCTNTAGSFKCNCAPGWIG--NGLKCTDLDECSNGTHSCNNNAECQNTM----GSYRCVCKEGYFG--DGFFCSDSDE-------CAENSDLCENGHCLNL-PGGFRCECDMGFITTADGKACEDID--ECIFADI-CVNGRCQNLPGLFRCECNIGYERDTSGGNC---------TDINECA--DPTT------------CINGICVNIPGTYLCNCPPDFELNPTGVGCV 1537          

HSP 9 Score: 80.8777 bits (198), Expect = 7.855e-15
Identity = 168/697 (24.10%), Postives = 259/697 (37.16%), Query Frame = 1
Query:  319 SNKGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNY---CPKGFTQKENRCDDIDEC-QFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC----------QYRRDQC----------------QLYGSSCGIFGKCVPTSDGQ-YTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQ-GYNNDQECVRYGTSEPLVSRY----------CSKSEYYSL------------CEGG---------SCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAER----TRNSTSICELYGHR----------CQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQY----KDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYK---QTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENIC-TPGRCERSGNSNFRCVCPYYASLSKDGHSC 2154
            + +G C+NG C    G F   CN        + +D  +C            EC           CV  D +Y   CP G+   E  C+DIDEC Q   IC  G C N +GSF CQCP    L  +   C          ++   +C                ++ G   G   +  P  D + Y  +C  P      GK     T+ N C      C+  G+C     S+ C CP G++      +CI  +  DI         C  G+C +   G+ C C+  ++ G     E +   +  PL+  +          C     Y L            CE G         +C +L   Y C CS G+    +   CI +    ++CA     C+ GRC+     +Y C+C +GF+ +     CI        T   T++C++              C  G  + I  N  +C  L G SQ   +K C     Y    +D  + + +   C+ GQCV+   SY+C+C   Y +     +CV      Q   P   +C   E   LC               C  GY   E+G+ C  +++  T++ +  +  +              +   GF C C PGFT      +C     ++C ++ N+C + G C+ +  S F C C    SL  +G +C
Sbjct: 1947 TQRGLCRNGNCRNIVGSFLCVCNDGY----ELTLDGRVCTDI--------NECAVNPGTCGAGTCVNMDGSYRCICPPGYYLHEETCEDIDECSQSPEICTFGTCSNTEGSFTCQCPEGFQLSASGRRCLDIRVNYCFTKFENGRCLVPKPQNISKEACCCTRMPGQGWGDPCELCPAKDQEAYRVLC--PNEGYERGKD-DNPTDINEC--LNNPCV-NGQCINTDGSFRCECPIGYNLDTSGVTCIDINECDI------GNPCGNGTCTNAIGGFECTCDEGFEPGPMMSCEDINECSQNPLLCAFRCVNVVGSYECKCPTGYVLREDRRMCKDQNECEDGIDDCASRGMTCKNLIGTYMCICSPGYTRHPSGDGCIDL----NECATKPGICRNGRCENT-VGSYRCKCDQGFVANPTQTECIDNREDFCYTEVLTTLCQMSSSNRNLVTKSECCCDGGRGWGI--NCELCP-LPGTSQY--KKMCPLGPGYTTDGRDIDECRVMGNLCKNGQCVNTKGSYKCICIPGYTTDITSTQCVDIDECIQAPKPCNFICKNTEGSYLCS--------------CPRGYILQEDGKSCRDLDECSTKQHNCQFLCI--------------NTIGGFTCKCPPGFTQHH--SACIDN--NECSSDPNLCGSNGVCQNTPGS-FNCECQRGFSLDSNGQTC 2576          

HSP 10 Score: 64.3142 bits (155), Expect = 9.608e-10
Identity = 161/766 (21.02%), Postives = 274/766 (35.77%), Query Frame = 1
Query:  925 CPSGFHQSEDKKSCIVNSNSDICQSPE----IAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYY-SLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSIC--DLHREKCKTGICYPIGQNDYICA---------CVLGYKQATDKKSCII-----------MDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPY--CFYG-CFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTCRTKSLNRTLNIKFSG 3120
            CP+  H    ++  I N  +  CQ  +    I   C+GG+C++    + C C   ++     Q+C                S    LC  G C +    Y+C+C +G+Y + +  RCI         +L   +C     Q L     + QC            C  + R  +  S  E+   R   GV + ++P         G        Y +      +      I +R R    +      +   HG  +                P   +C+  ++Y +LC  G CV      Y    N  +  +   +C  I+    E             + C  G C+ +    + C C  GF S +    C    +D+C+ N  IC  GRC  +  S F CVC     ++ DG +C              D  + R  C +G C+N+    +CIC  G+     G+ C  I++  +        C         + ++ C+C+ G     +GR C+ +      +S C    +R +C   +   + +++  CA         C    ++++    C +            D  +CA++   C+ G C ++   Y C C   + V  +GR+C         VDI+E           C    ++  C  G C      + C+C   F+ +     C  D N+C    C  G C +      C+CS    +L  TGL  I++ +       STC  K +N    +  +G
Sbjct:  234 CPAQPHPC--RRGFIPNHRTGACQDVDECHAIPGICQGGNCINTVGSFECKCPAGHKFNEISQKCEDLDEC----------SNIPGLCGVGECSNTVGSYFCKCPQGYYTSVDGSRCIDGRGGYCYASLLNGRCANQNSQLL----TKMQC------------CCDSGRCWSDGSTPEMCPIRGTGGVAHLVFPG-------RGPRPEVPNIYPVPRPDRPEIYGPPPIPERERIPDYIPEQTPIQPPPHGIPL----------------PTTSVCNPCQFYRNLCLNGRCVPLPGGTYRCECNMGFKLDRRGEC--IDDDECER------------NPCAHGECV-NTPGSYICQCPAGFQSTATRTEC--RDLDECVANGRICNNGRCVNTEGS-FHCVCNAGFEITADGKNCQDQ-----------DECLIRNMCLNGLCINEDGSFKCICKSGFLLDTSGRMCVDIDECETPGMCMNGHCVNT------EGSFRCECMAGMAVGLDGRVCVDTH----MRSTCYGGYNRGQCVRPLFGVVTKSECCCASTEYAYGEPCQPCPRESSGTDPCCLSSCAHKVPSAFSDINECALDPDICQNGVCENMQRTYKCTCNTGFEVDLSGRNC---------VDINE-----------CMMNSLL--CDNGLCRNTPGSFTCQCFKGFRFDPETDVC-EDINECESNPCINGDCVNSQGSFVCTCSA-ASSLDSTGLECIETVK-------STCWLKMVNNRCEVNING 878          

HSP 11 Score: 60.077 bits (144), Expect = 1.541e-8
Identity = 134/568 (23.59%), Postives = 209/568 (36.80%), Query Frame = 1
Query: 1114 YGTSEPLVSRYCSKSEYY-SLCEGGSCVDL-NNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVT--EEPDNSYCLLQEYLSRCMGGRCIGDK--TYGFKCLCLPGFTSASDG---RSCDPEY------VDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCL-INYVTTEPTTKYCDILVNRLRCASGNCVND----RCICGPGYKSSEDGKECYKIEKVSS--------IXXXXXXXXXXXXXXXXDDNNYEC-QCLNG--YIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCI 2724
            +G   P  S  C+  ++Y +LC  G CV L    Y C+C+ GF   + R  CI  +    +C  N   C  G C     + Y CQC  GF  +     C   +        C   G  C  G C       + C C  G+  + D K C    Q +D C    I   C  G C++   S++C+C   ++   +G+ CV   + E P            +C  G CV+T  ++ C+C  G     +GR C     + T     +   C+   +        C       YG  C   P  +S +D     SC  +       +++C  + +IC  G CE      ++C C     +   G +C+ IN           + ++N L C +G C N      C C  G++   +   C  I +  S        + S     C       LD    EC + +    ++K  N R  +    A +K   C    E   +    P  + +    C  G+ +    K  +  D  +C V    C  G C +    + C C    TV  +GR CI
Sbjct:  448 HGIPLPTTS-VCNPCQFYRNLCLNGRCVPLPGGTYRCECNMGF-KLDRRGECIDDD----ECERNP--CAHGECVNTPGS-YICQCPAGFQSTATRTECRDLDE-------CVANGRICNNGRCVNTE-GSFHCVCNAGFEITADGKNC----QDQDECL---IRNMCLNGLCINEDGSFKCICKSGFLLDTSGRMCVDIDECETPG-----------MCMNGHCVNTEGSFRCECMAGMAVGLDGRVCVDTHMRSTCYGGYNRGQCVRPLFGVVTKSECCCASTEYAYGEPCQPCPRESSGTDPCCLSSCAHKVPSAFSDINECALDPDICQNGVCENM-QRTYKCTCNTGFEVDLSGRNCVDIN-----------ECMMNSLLCDNGLCRNTPGSFTCQCFKGFRFDPETDVCEDINECESNPCINGDCVNSQGSFVCTCSAASSLDSTGLECIETVKSTCWLKMVNNRCEVNINGATLKSHCCATLGEAWNS----PCAKCEKDPICGKGFARV---KGNVCEDVDECQVFPGVCINGKCVNTQGSFFCQCPPGMTVDVSGRTCI 961          
BLAST of Fibrillin-2 vs. Ensembl Medaka
Match: ENSORLT00000027703.1 (latent transforming growth factor beta binding protein 2 [Source:NCBI gene;Acc:101168829])

HSP 1 Score: 88.1965 bits (217), Expect = 3.948e-17
Identity = 151/549 (27.50%), Postives = 222/549 (40.44%), Query Frame = 1
Query:  547 FTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYG-----SSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPE---IAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQ-CSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICA-CLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRC-VCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXX-XXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCL-CLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSC 2154
             TQ    C DI+EC   + C NG C+N +GS+ C+C        N+   +  RDQC+        SSC   G C+ T  G + C    P      G   I +   +V     +     G C     SY C+C  G+  S D          ++CQ  E   + E C  G CV+    + C CN  YQ   + + C              ++    + C  G C++    Y CQ C  GF  + +  RC  I+    +CA     C GG C   + +    +C  G+  S + +SC   +  ++ ++        C  G+C       Y C  C  GY  S D ++C    +  D C    +   C  G C +   SY C VC   +  S +GQ+C    +       L S     S+C G  C++T  +Y    C  G+  +E+G  C  I +   + PD            C  G C   +   F C+ C PGFT A +G SC  E VD+C NN+N+C  G+C  +  S F C+C      S D   C
Sbjct:  908 ITQNRKFCQDINECSMPNKCQNGNCVNTEGSYTCEC--------NSGFAKSWRDQCEDLDECKDPSSC-PSGICINTL-GSFQCQACSP------GLRLINERCVDVNECLNQTVCGRGRCVNTQGSYRCNCFHGYKLSPD----------NVCQDVEECVLPEVCNHGLCVNLDGTHECTCNHGYQVTPDRKSC-----------EDVNECATGNACPVGICINTAGSYTCQNCRPGFGPSADGLRCEDID----ECARGDM-CLGGVCANTEGSFICTRCTAGYRVSLDQQSCEDIDECQSIST--------CANGICL-NSEGSYSCEHCPAGYRVSHDGEFC----KDIDEC---ALPTTCPKGTCTNTEGSYMCVVCQPGFRVSEDGQQCNDVNEC------LGS-----SVCPGQMCLNTQGSYTCRSCQTGFQPSEDGHTCQDINE--CQTPD-----------VCPTGVCTNTEG-SFSCMTCAPGFTVAPNGLSC--EDVDEC-NNDNVCVRGQCINTYGS-FLCLCEAGFKFSVDTADC 1369          

HSP 2 Score: 75.485 bits (184), Expect = 3.042e-13
Identity = 140/579 (24.18%), Postives = 236/579 (40.76%), Query Frame = 1
Query:  145 LCCSGW-IKNVYGDCVK-SECDYDC--GYGRCV---GLNVCECYDKTIRTETCPQNNQKLC--TNNCSNKGQCQNGKCICESGYFGEDCNTAIIST---------------------CYVKIDRGLCKSTPENLQLSKEECCSIFQ-----VAWGNPCVFCDRNY---CPKGF-TQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKP-YSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCS-CPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRC-LCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQ-CSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQ-CLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKW 1749
            LC  G+ +  +  +C+  +ECD D   G G C+   G   C+C+    +  T    N+K C   N CS   +CQNG C+   G +  +CN+    +                     C   +    C++    L+L  E C  + +     V     CV    +Y   C  G+    +N C D++EC    +C +G C+N  G+  C C   + +  +  SC+   ++C   G++C + G C+ T+ G YTC   +P +  S +G  C    + + C     +CL  G C     S+ C+ C +G+  S D++SC    + D CQS      C  G C++    Y C  C   Y+  ++ + C           +   +    + C  G+C +    Y C  C  GF  +E+ ++C  +    ++C L    C G  C      +Y C+ C  GF  SE+G +C      +            C TGVC     +     C  G++ + +   C    +  D C N  +   C  GQC++   S+ C+C   +  S +  +C    + +     +C  W
Sbjct:  858 LCDPGFKLSALQTNCIDVNECDEDPCEGKGHCINSYGSYTCQCHSGYSQVIT---QNRKFCQDINECSMPNKCQNGNCVNTEGSYTCECNSGFAKSWRDQCEDLDECKDPSSCPSGICINTLGSFQCQACSPGLRLINERCVDVNECLNQTVCGRGRCVNTQGSYRCNCFHGYKLSPDNVCQDVEECVLPEVCNHGLCVNLDGTHECTCNHGYQVTPDRKSCE-DVNECAT-GNACPV-GICINTA-GSYTCQNCRPGFGPSADGLRC---EDIDECAR-GDMCL-GGVCANTEGSFICTRCTAGYRVSLDQQSC---EDIDECQS---ISTCANGICLNSEGSYSCEHCPAGYRVSHDGEFC-----------KDIDECALPTTCPKGTCTNTEGSYMCVVCQPGFRVSEDGQQCNDV----NEC-LGSSVCPGQMCLNT-QGSYTCRSCQTGFQPSEDGHTCQDINECQTPDV--------CPTGVCTNTEGSFSCMTCAPGFTVAPNGLSC----EDVDECNNDNV---CVRGQCINTYGSFLCLCEAGFKFSVDTADCDDQDECKEFGSSVCGAW 1386          

HSP 3 Score: 68.5514 bits (166), Expect = 4.028e-11
Identity = 202/883 (22.88%), Postives = 310/883 (35.11%), Query Frame = 1
Query:  310 NNCSNKGQCQNGKCI---------CESGYFGEDCNTAIIS---------TCYVKIDRGLCKSTPENLQLSKEECC-SIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCS------------CPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEG-GSCVDLNNDYYCQCSEGF--YATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVC-HGKYISSNNG----QECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCL-CLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNF--RCVCPYYASLSKDG---------------------------HSCLINYVTTEPTT--KYCDILVNRLRCASGNCVNDR-----CICGPGYKSSEDGKECYKIEK--VSSIXXXXXXXXXXXXXXXXDDNNYECQ-CLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDC 2721
            N C   G C+N  C+         C+ GY  +   +  +S         +CY  +  G C S P    L+K+ CC S    AWG+ C                +RC       FK IC  G       S           D      Q   D+ Q  G S        P+S         +P   S+     + +      +Y     +P+    P   SY  +             PS        K   +N  S I   P I  R   G C+S   GY CLC+  ++       C+     +               CEG G C++    Y CQC  G+    T+NR+ C  I    ++C++   +CQ G C   + + Y C+C  GF +S   + C   +  ++ +S        C +G+C     +    AC  G     +R  C+   +    C NQ +  R   G+CV+   SYRC C HG  +S +N     +ECV  +                 +C  G CV+ +  + C C +GY  T + + C  + +  T              + C  G CI +    + C  C PGF  ++DG  C  E +D+C   + +C  G C  +  S    RC   Y  SL +                               C   Y  +      K  D       C  G C N        +C PG++ SEDG++C  + +   SS+C                  +Y C+ C  G+  SE+G +C                 + C TG+C     +     C  G+  A +  SC  +D      N+  C  G C +    +LC+C   +  + +  DC
Sbjct:  615 NECLLPGICKNADCVNTKGSYRCTCKPGYMLDAARSHCVSDKAVSEERASCYRSVSSGFC-SLPLANHLTKQICCCSRVGKAWGHGC----------------DRCPLPGSDHFKEICPAGHGYTYSRS-----------DVQISVRQLEDDELQSTGVSLEEQYPQFPSSQPSLL-FPSEPQHPSYPQTPQVPQYP----DYHNMPQIPHHPLSPQHPSYSENEEAERTEGEEFLLPSAVVTDSPLKHPGINKCSSI---PSICGR---GKCISVQTGYTCLCDPGFKLSALQTNCIDVNECD------------EDPCEGKGHCINSYGSYTCQCHSGYSQVITQNRKFCQDI----NECSMPN-KCQNGNCVNTEGS-YTCECNSGFAKSWRDQ-CEDLDECKDPSS--------CPSGICINTLGSFQCQACSPGLRLINER--CVDVNE----CLNQTVCGR---GRCVNTQGSYRCNCFHGYKLSPDNVCQDVEECVLPE-----------------VCNHGLCVNLDGTHECTCNHGYQVTPDRKSCEDVNECATG-------------NACPVGICI-NTAGSYTCQNCRPGFGPSADGLRC--EDIDECARGD-MCLGGVCANTEGSFICTRCTAGYRVSLDQQSCEDIDECQSISTCANGICLNSEGSYSCEHCPAGYRVSHDGEFCKDIDECALPTTCPKGTCTNTEGSYMCVVCQPGFRVSEDGQQCNDVNECLGSSVCPGQMCLNT--------QGSYTCRSCQTGFQPSEDGHTCQDINECQTP--------DVCPTGVCTNTEGSFSCMTCAPGFTVAPNGLSCEDVDE---CNNDNVCVRGQCINTYGSFLCLCEAGFKFSVDTADC 1369          

HSP 4 Score: 62.7734 bits (151), Expect = 2.287e-9
Identity = 99/407 (24.32%), Postives = 162/407 (39.80%), Query Frame = 1
Query:  535 CPKGFTQKEN--RCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSS-CGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGF-HQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLC---NGEYQGYNNDQECVRYGTSE---PLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIR-SENGRSCIKAERTRNSTSICELYGHR-CQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTE 1719
            C  GFT   N   C+D+DEC   ++C+ G+CIN  GSF C C        +T  C   +D+C+ +GSS CG + +C  T  G Y+C            +S I + +++ C+  +  C  +G C+    S++C+C  G+ + + D   C+     D+ +    +  C    C +    + C+C   N E+    N    +     E   P++     + E Y         +LN+  YC        T+    C         C ++     G      D+ N  C    G +  S++ R              CE++G   C+ G C  I+ + Y C C  GY     R  C+      D CQ       C  G CV+   S+ C C    +  ++ + C+    TE
Sbjct: 1315 CAPGFTVAPNGLSCEDVDECNNDNVCVRGQCINTYGSFLCLCEAGFKFSVDTADCD-DQDECKEFGSSVCGAW-RCQNTI-GSYSC------------QSGILEEDWDKCDS-EINCGEHGFCENTNSSFHCNCDKGYTNPAGDVTQCV-----DVNECETSSALCGEALCENYDGSFLCICPNDNEEFDPITNRCRSMAMIDPEHIYPVIPFTDERKECY--------YNLNDANYCNNVLSRNTTKQECCCTAGAGWGDNCEIHTCPLPG-----KDDYNQLCPHGSGILPLSDSLRQSHGDGLPYIDADECEMFGSEICKNGQCSNIF-STYTCFCRSGYYYDNIRFECVD----FDECQ---FGNTCENGACVNTAGSFNCFCSPPLVLDDSQRHCISLNSTE 1679          

HSP 5 Score: 58.151 bits (139), Expect = 6.825e-8
Identity = 37/113 (32.74%), Postives = 50/113 (44.25%), Query Frame = 1
Query:  394 IISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWG-NPCVFCDRN-----------YCPKGFTQ-KENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENTMSC 693
            I+  C+ +   G C      L   +++CC     +WG N C  C               CPKGF +     C DI+EC    IC N +C+N KGS+RC C P + LD     C
Sbjct:  541 IVGRCFQETVDGQCGKPLPGL-TKQDDCCGSIGASWGLNKCQKCPTKPAYAVIANGQVQCPKGFKRMNATHCQDINECLLPGICKNADCVNTKGSYRCTCKPGYMLDAARSHC 652          

HSP 6 Score: 55.4546 bits (132), Expect = 3.696e-7
Identity = 160/677 (23.63%), Postives = 246/677 (36.34%), Query Frame = 1
Query:  706 DQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSP---EIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQ-CSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCV-CHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSR--------IEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKC-LCLPGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCI-----CGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQ-CLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLC 2676
            ++C    S CG  GKC+    G YTC+C   + +S    +CI   + N C+  +  C   G C     SY C C SG+ Q       ++  N   CQ      +  +C+ G+CV+    Y C CN  +     DQ        E L      + +  S C  G C++    + CQ CS G        RC+ +    ++C LNQ  C  GRC      +Y C C  G+  S +   C   E          +    C  G+C  +    + C C  GY  + DRK C    +             C  G C++   SY C  C   +  S +G  C    +        C++ +   +C GG C +T               E    C+R        +++Q  E+ D       + +S C  G C+  +   + C  C  G+  + DG  C  + +D+C      C  G C  +  S    VC     +S+DG  C  N V            +    C    C+N +       C  G++ SEDG  C  I +  +        C         + ++ C  C  G+  + NG SC   +        C+ +   C  G C       ++C C  G+K + D   C   D  K       C    C + +  Y C
Sbjct:  834 NKCSSIPSICG-RGKCISVQTG-YTCLCDPGFKLSALQTNCI---DVNECD--EDPCEGKGHCINSYGSYTCQCHSGYSQ-------VITQNRKFCQDINECSMPNKCQNGNCVNTEGSYTCECNSGFAKSWRDQ-------CEDL-----DECKDPSSCPSGICINTLGSFQCQACSPGLRLI--NERCVDV----NEC-LNQTVCGRGRCVNT-QGSYRCNCFHGYKLSPD-NVCQDVEEC--------VLPEVCNHGLCVNLD-GTHECTCNHGYQVTPDRKSCEDVNECA-------TGNACPVGICINTAGSYTCQNCRPGFGPSADGLRCEDIDE--------CARGD---MCLGGVCANT---------------EGSFICTRCTAGYRVSLDQQSCEDIDEC-----QSISTCANGICLNSEG-SYSCEHCPAGYRVSHDGEFC--KDIDECAL-PTTCPKGTCTNTEGSYMCVVCQPGFRVSEDGQQC--NDVNE---------CLGSSVCPGQMCLNTQGSYTCRSCQTGFQPSEDGHTCQDINECQTPDVCPTGVCTNT------EGSFSCMTCAPGFTVAPNGLSCEDVDE-------CN-NDNVCVRGQCINT-YGSFLCLCEAGFKFSVDTADCDDQDECK-EFGSSVCGAWRCQNTIGSYSC 1397          
BLAST of Fibrillin-2 vs. Ensembl Medaka
Match: LTBP3 (latent transforming growth factor beta binding protein 3 [Source:NCBI gene;Acc:101156033])

HSP 1 Score: 78.1814 bits (191), Expect = 3.975e-14
Identity = 195/881 (22.13%), Postives = 319/881 (36.21%), Query Frame = 1
Query:  310 NNCSNKGQCQNGKCICESGYFGEDCNTAII-------------STCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFTQKENRCDDIDECQFKSICLNG-----ECINEKGSFRCQCPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVP-TSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRR-CIKIETITSQCALNQFQCQGGRCQELDNNNYEC-QCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSC------------------DPEYVDQCL-----NNENICTPGR----------CERSGNSNFRCVCPYYASL--SKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCII----MDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCIL--KIIAVKSVDISEV 2766
            N CS +G CQNG C+   G F   CN+  I             + C++          P + Q+++E CC     AWG  C                 RC  +    F  IC  G     + I E  +      P     E            Q   +S    G  VP       T I + P +     +  IK +  + C   + +C  +GEC+     + C C  G+H S  +  C   +  ++    E   + R G CV+    Y+C+C+  ++        V +G         C K +   +  GG CV+L   Y C+C  GF +   R   C  I        LN   C   +C E    +YEC  C+ G+    +   C      +N           C  G+C  + P  Y C CL+G+  S D K C   ++  D        + C  G+C++   S++C C+  Y  +  G  C    +            +  S C  G C++   +Y+C+C  GY     G++C  I++  +   D + C    Y    +G          + C+C  G+  + D +SC                  D  + D  L       E  C+ G           C  S ++ F  +CP    L   +D H  L  Y+  +  + + + +  + RC +       C C  G+    +   C  + +               G     + ++ C C + +I   N + C+ +  + + +  CD   E CK G+C    Q+ + C+C L    A D+ SC+      D  +C    Y CK G C +    + C C    T +   + C+   +  A K V   +V
Sbjct:  292 NECSMQGVCQNGDCLNTLGSFKCSCNSGFILERNRCVDSPAEQAQCFLLASESKGCEHPLSTQITQEMCCCTVGKAWGRNC----------------ERCPHVGTVAFSKICPAGKGYLLQSITETVALPPFFLPPKPPKEEQERVPANTTPVQQISTS--TSGPRVPVVKPTPPTIIRLNPGNDPLETE--IKVSQSDECRLSRNIC-GHGECENSPNGHICHCYPGYHLSPQRNICEDENECEL----EPCSQGR-GRCVNTEGTYKCICSLGFKHK------VEHGGLRCKDIDECLKPDICGV--GGLCVNLPGSYKCECHSGFRSKSPRYPFCEDINE-----CLNPDTCPNEQC-ENTLGSYECTPCMPGY--EAHAGKCYDINECQNLGI--------CPNGLCENL-PGTYRCLCLDGFLHSADGKSCNDIDECADV-------RLCANGRCINTDGSFQCQCYAGYQRTQEGSHCEDIDEC-----------KRSSNCLRGRCINNMGSYHCECQRGYMLV-GGKECQDIDECAS---DRNLCQPHGYCENRLG---------SYVCICNHGYIPSEDKQSCEVVRVATDEKKECYMNLEDTVFCDSVLATNVTKQECCCSIGMGWGDHCEIYPCPVSHSAEFHMLCPNGQGLYYDEDLHYSLPAYLDIDECSLFAEEICKKGRCHNTQ-PGYECYCQQGFYYDSNLLVCIDVNECHD------ESLCANGHCVNTEGSFYCDCNSPWIPDTNKKKCVMATVSGMNQ--CD-DPEICKNGLCVKT-QSSHYCSCTLPLILAIDRNSCVTPEEQADVDECQDPSY-CKNGRCENTPGSFYCFCDPPLTFSALLKQCVYDDRTAAYKDVCFEQV 1078          

HSP 2 Score: 66.6254 bits (161), Expect = 1.433e-10
Identity = 194/844 (22.99%), Postives = 304/844 (36.02%), Query Frame = 1
Query:  535 CPKGFTQKEN----RCDDIDECQFKSIC-LNGECINEKGSFRCQC-------PPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCICIKPYSVSFNGKSCIKKTNYNVCNYFKKLCL-PYGECQPYGLSYYCSCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGGSCVSEGKGYRCLCNGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICEL----------------------------YGHRCQTGVCYPIYPNEY--ICACLEGYSQSEDRKYCIKNEQYKDYCQ--NQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEKQVTEEPDNSYCLLQEYLSRCMGGRCIGDKTYGFKCLCLPGFTSASDGRSC-DPEY---VDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVR 2919
            C  GF  K      RC DIDEC    IC + G C+N  GS++C+C        P +   E+   C    D C           +    + G Y C    P   +  GK       Y++ N  + L + P G C+    +Y C C  GF  S D KSC     +DI +  ++   C  G C++    ++C C   Y GY   QE    G+    +   C +S   S C  G C++    Y+C+C  G Y     + C  I+    +CA ++  CQ     E    +Y C C  G+I SE+ +SC       +    C +                            +G  C+   C   +  E+  +C   +G    ED  Y +      D C    +EI   C+ G+C +    Y C C   +   +N   C+   +               SLC  G CV+T  ++YC C + +    N +KC         + D+           C  G C+  ++  + C C      A D  SC  PE    VD+C  + + C  GRCE +  S F C C    + S    + L   V  + T  Y D+   +        V++  IC                  + S+                     EC C  G        +C    S +  + +C++H +    G      + D++ A  + YK     +     D+ +C+     C+ G+C       +C C   Y +  +   CI         DI E + + P+          +  C+  +CV     Y+C C H F      + CVR
Sbjct:  537 CSLGFKHKVEHGGLRCKDIDECLKPDICGVGGLCVNLPGSYKCECHSGFRSKSPRYPFCEDINEC-LNPDTCP---------NEQCENTLGSYECTPCMPGYEAHAGKC------YDI-NECQNLGICPNGLCENLPGTYRCLCLDGFLHSADGKSC-----NDIDECADV-RLCANGRCINTDGSFQCQC---YAGYQRTQE----GSHCEDIDE-CKRS---SNCLRGRCINNMGSYHCECQRG-YMLVGGKECQDID----ECASDRNLCQPHGYCENRLGSYVCICNHGYIPSEDKQSCEVVRVATDEKKECYMNLEDTVFCDSVLATNVTKQECCCSIGMGWGDHCEIYPCPVSHSAEFHMLCPNGQGLYYDEDLHYSLPAYLDIDECSLFAEEI---CKKGRCHNTQPGYECYCQQGFYYDSNLLVCIDVNECHD-----------ESLCANGHCVNTEGSFYCDCNSPWIPDTNKKKCVMATVSGMNQCDDP--------EICKNGLCVKTQSSHY-CSCTLPLILAIDRNSCVTPEEQADVDEC-QDPSYCKNGRCENTPGS-FYCFCDPPLTFS----ALLKQCVYDDRTAAYKDVCFEQ--------VDEDLICS---------------RPLQSLVVTYP----------------ECCCHFGRGWGPECNTCPPRNSEMFNR-LCEIHLDTESDG------EQDFLAA-FVNYKPGDSSEE----DSDECS-----CENGHCVRSYLSTMCKCNPGYRLDHSRARCI---------DIDECAERAPR----------VSPCKNARCVNTSGSYKCYCNHGFGPTRRPNICVR 1237          

HSP 3 Score: 53.5286 bits (127), Expect = 1.635e-6
Identity = 36/117 (30.77%), Postives = 55/117 (47.01%), Query Frame = 1
Query:  433 CKSTPENLQLSKEECCSIFQVAWG-NPCVFCDR---------------NYCPKGFTQ-KENRCDDIDECQFKSICLNGECINEKGSFRCQCPPDHYLDENT-MSCQYRRDQCQLYGS 729
            C STP  +  ++E+CC     +WG N C  C +               + CP+G+ +     C DI+EC  + +C NG+C+N  GSF+C C     L+ N  +     + QC L  S
Sbjct:  226 CNSTPLPVLTNQEDCCGSVGNSWGQNKCYQCPKLPNASVKHTIVEDYGSACPQGYKRYNSTHCQDINECSMQGVCQNGDCLNTLGSFKCSCNSGFILERNRCVDSPAEQAQCFLLAS 342          
BLAST of Fibrillin-2 vs. Ensembl Medaka
Match: FBLN1 (fibulin 1 [Source:NCBI gene;Acc:101160948])

HSP 1 Score: 75.485 bits (184), Expect = 2.208e-13
Identity = 179/739 (24.22%), Postives = 273/739 (36.94%), Query Frame = 1
Query:   73 YFDTILWNHIVVASICDYSDNGEPLCCSGWIKNVYG--------DCVKSECDYDCGYGRCVGLNVCECYDKTIRTETCPQNNQKLCTNNCSNKGQCQNGKCICESGYFGEDCNTAIISTCYVKIDRGLCKSTPENLQLSKEECCSIFQVAWGNPCVFCDRNYCPKGFT-QKENRCDDIDECQFKSIC--LNGECINEKGSFRCQ---CPPDHYLDENTMSCQYRRDQCQLYGSSCGIFGKCVPTSDGQYTCI-----CIKPYSVSFNGKSCIKKTNYNVCNYFKKLCLPYGECQPYGLSYYC--SCPSGFHQSEDKKSCIVNSNSDICQSPEIAERCRGG-SCVSEGKGYRCLC-NGEYQGYNNDQECVRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQ----CLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTG-----VCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECVRYKQTEPPAVRLCSKWEYYSLCQGGECVDTXXXXXXXXXXXXXATENGRKCSRIEK----QVTEEPDNSYCLLQEYLSRC-----MGG-----------------RCIGDKTYGFKCLCL-PGFTSASDGRSCDPEYVDQCLNNENICTPGRCERSGNSNFRCV 2112
            +F    W  ++    CD    G  +  +GW  +  G        D  KS CD        + + V    +  I T   PQ  +     NCS     +N  C C  G+              +K+D   C+   E L  +    C   QV       F  +  C  G+    EN C+DIDEC F+S     N  C+N  GSFRC+      D Y+ ++T SC    ++C  +  +C     C+  S+G YTC      C + Y ++ +G  C    + N C      C     C     S+YC  +C  GFH + + K        DI +       C     CV+    YRC    G  +GY  D         E L    C            +CV+    Y+C+C  GF  +   ++C  I+    +CAL    C         + +++C     C  G+I    G+ C+           C  + H C+ G          Y    + +C  GY  + D  +C    +  D C    +      G CV+   SYRC C   +  ++  + C    +    + RLC+           +C +T  +Y+C C  G+   ENG  C  +++      ++E  N Y   Q Y  R      + G                 RCI +   GF C C   G+T   DGRSC  + VD+C    + C+      +    FRC+
Sbjct:   87 FFSGFDWQTLISQICCDCCTLGLMVAKNGWSCDFRGLQLEKQCSDAAKSCCDQPKEIRPTIKVPV----EPKIFTTPPPQRMRSCQDANCSQLCL-ENAMCACREGF-------------QMKMDGVTCQDIDECL--TGRHNCGPGQVCLNTDGSFDCKPRCGTGYVLTAENHCEDIDECAFESHNCEANFVCLNTAGSFRCERKNVCRDGYIQDSTGSC-VDINECLTHTDACQPDQFCI-NSEGSYTCRSTTDDCKQGYQLTADGLRC---EDVNECLTSSHNCAHGEICLNTEGSFYCQAACAPGFHFTPENKC------RDIDECALWTHNCEANFVCVNTAGSYRCQPKTGCEEGYIQDSAGNCIDMDECLKGNVCGSR---------ACVNTEGSYHCECQTGFMYSRVSKKCEDID----ECALWTSTCGANFVCVNTDGSFQCHPDKACGDGYILDPAGK-CVDVNE-------CVTHSHPCRPGQACINTVGSFYCRSIVASCARGYHLNADGTHC----EDVDECVLHNVCG--SHGSCVNVEGSYRCECQNGFTFNSISKLCEDVNECRHYSGRLCAH----------KCENTEGSYHCSCIKGFKLAENGNNCEDVDECEINPCSQECANVYGSYQCYCRRGYELNDIDGITCEDIDECAIPNVCSYRCI-NTVGGFNCTCPSSGYTLGPDGRSC--QDVDECAAGTHTCSASENCFNIQGGFRCL 754          
BLAST of Fibrillin-2 vs. Planmine SMEST
Match: SMESG000081553.1 (SMESG000081553.1)

HSP 1 Score: 791.956 bits (2044), Expect = 0.000e+0
Identity = 421/428 (98.36%), Postives = 423/428 (98.83%), Query Frame = 1
Query: 2026 EYVDQCLNNENICTPGRCERSGNSNFRCVCPYYASLSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGNCVNDRCICGPGYKSSEDGKECYKIEKVSSIXXXXXXXXXXXXXXXXDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQATDKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGDSTCRTKSLNRTLNIKFSGIFKFSTGSPSEVKQSIEKILLIKQQKSIRLNVCSLQGEYQKIHKNELSNSFLTRQIVCIFYCQ 3309
            EYVDQCLNN NICTPGRCERSGNSNFRCVCPYYAS+SKDGHSCLINYVTTEPTTKYCDILVNRLRCASG+CVNDRCICG GYKSSEDGKECYKIEKVSSICSLNQLQCQGGGCQELDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQA DKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLG STCRTKSLNRTLNIKFSG FKFSTGSPSEVKQSIEKILLIKQQKSIRLNVCSLQGEYQKIHKNELSNSFLTRQIVCIFYCQ
Sbjct:    5 EYVDQCLNNGNICTPGRCERSGNSNFRCVCPYYASVSKDGHSCLINYVTTEPTTKYCDILVNRLRCASGDCVNDRCICGSGYKSSEDGKECYKIEKVSSICSLNQLQCQGGGCQELDDNNYECQCLNGYIKSENGRSCIKSESALIKKSICDLHREKCKTGICYPIGQNDYICACVLGYKQAADKKSCIIMDNPKCAVNEYRCKGGYCYDIVDGYLCICVGNYTVTENGRDCILKIIAVKSVDISEVSYQNPQSQSFCTRKEIIEKCQPGKCVEKQEDYQCKCPHSFKTNYYDHECVRDSNKCPYCFYGCFDENSISTCSCSENYENLFDTGLCIIKSDEISYSLGYSTCRTKSLNRTLNIKFSGKFKFSTGSPSEVKQSIEKILLIKQQKSIRLNVCSLQGEYQKIHKNELSNSFLTRQIVCIFYCQ 432          

HSP 2 Score: 178.718 bits (452), Expect = 3.473e-48
Identity = 111/271 (40.96%), Postives = 152/271 (56.09%), Query Frame = 1
Query: 1018 CRGGSCVSEGKG-YRCLCNGEYQGYNNDQEC-VRYGTSEPLVSRYCSKSEYYSLCEGGSCVDLNNDYYCQCSEGFYATENRRRCIKIETITSQCALNQFQCQGGRCQELDNNNYECQCLRGFIRSENGRSCIKAERTRNSTSICELYGHRCQTGVCYPIYPNEYICACLEGYSQSEDRKYCIKNEQYKDYCQNQEISKRCRGGQCVSNGNSYRCVCHGKYISSNNGQECV------------RYKQTEPPAVRLCSKWEYYSLCQGGECVD 1788
            C  G C   G   +RC+C        +   C + Y T+EP  ++YC        C  G CV   ND  C C  G+ ++E+ + C KIE ++S C+LNQ QC