CTD small phosphatase protein

Overview
NameCTD small phosphatase protein
Smed IDSMED30007070
Length (bp)1908
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CTD small phosphatase protein (SMED30007070) t-SNE clustered cells

Violin plots show distribution of expression levels for CTD small phosphatase protein (SMED30007070) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CTD small phosphatase protein (SMED30007070) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CTD small phosphatase protein (SMED30007070) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007070

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30007070SMESG000036352.1 PL06013A2E09ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30007070SMESG000036352.1 dd_Smed_v4_3276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007070SMESG000036352.1 dd_Smed_v4_3276_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CTD small phosphatase protein vs. Ensembl Human
Match: CTDSP2 (CTD small phosphatase 2 [Source:HGNC Symbol;Acc:HGNC:17077])

HSP 1 Score: 222.631 bits (566), Expect = 2.644e-67
Identity = 101/169 (59.76%), Postives = 128/169 (75.74%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASS 1035
            LLP+++E +Q + C +IDLDETLVHSSFK +  A+  V ++I+G  H+V+V KRPYVDEFL  +G LFECVLFTASL KYADPVT+ LD   VF +RLFRE+C F  G YVKDL  LGRD+   +ILDNSP SY+ HP+NAV + SWFDD  DT L +LIP F++L+ +
Sbjct:   90 LLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGA 258          
BLAST of CTD small phosphatase protein vs. Ensembl Human
Match: CTDSPL (CTD small phosphatase like [Source:HGNC Symbol;Acc:HGNC:16890])

HSP 1 Score: 222.246 bits (565), Expect = 3.466e-67
Identity = 105/190 (55.26%), Postives = 134/190 (70.53%), Query Frame = 1
Query:  460 EDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            E+   +  D     P      + LLP+++  +  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL  +G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR+++ +II+DNSP SY+ HP+NAV + SWFDD  DT L DLIP+F+ L+
Sbjct:   72 ENGGLQKGDQRQVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLS 261          
BLAST of CTD small phosphatase protein vs. Ensembl Human
Match: CTDSPL (CTD small phosphatase like [Source:HGNC Symbol;Acc:HGNC:16890])

HSP 1 Score: 219.164 bits (557), Expect = 3.597e-66
Identity = 102/167 (61.08%), Postives = 128/167 (76.65%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            LLP+++  +  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL  +G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR+++ +II+DNSP SY+ HP+NAV + SWFDD  DT L DLIP+F+ L+
Sbjct:   84 LLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLS 250          
BLAST of CTD small phosphatase protein vs. Ensembl Human
Match: CTDSP1 (CTD small phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:21614])

HSP 1 Score: 218.394 bits (555), Expect = 5.842e-66
Identity = 100/169 (59.17%), Postives = 126/169 (74.56%), Query Frame = 1
Query:  523 EKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            + LLP+    + +K C +IDLDETLVHSSFK V  A+  + V+IDGV H+V+V KRP+VDEFL  +G LFECVLFTASL KYADPV + LD    F +RLFRE+C F  GNYVKDL  LGRD+  ++ILDNSP SY+ HP NAV + SWFD+ +DT L DL+P+F+ L+
Sbjct:   77 QYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLS 245          
BLAST of CTD small phosphatase protein vs. Ensembl Human
Match: CTDSP1 (CTD small phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:21614])

HSP 1 Score: 218.394 bits (555), Expect = 6.491e-66
Identity = 100/169 (59.17%), Postives = 126/169 (74.56%), Query Frame = 1
Query:  523 EKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            + LLP+    + +K C +IDLDETLVHSSFK V  A+  + V+IDGV H+V+V KRP+VDEFL  +G LFECVLFTASL KYADPV + LD    F +RLFRE+C F  GNYVKDL  LGRD+  ++ILDNSP SY+ HP NAV + SWFD+ +DT L DL+P+F+ L+
Sbjct:   76 QYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLS 244          
BLAST of CTD small phosphatase protein vs. Ensembl Celegans
Match: scpl-1 (CTD small phosphatase-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q8T3G2])

HSP 1 Score: 218.009 bits (554), Expect = 4.177e-65
Identity = 98/158 (62.03%), Postives = 122/158 (77.22%), Query Frame = 1
Query:  553 NQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDL 1026
            + NKKC +IDLDETLVHSSFK VK  +  + V+IDGV+H+V+V KRPYVDEFLA++G  FEC+LFTASL KYADPV + LD  +VF  RLFREAC F  GNYVKDL  LGR++N  +I+DNSP SY  HP+NAV + +WFDD +DT L D++P  + L
Sbjct:  162 DSNKKCLVIDLDETLVHSSFKPVKNPDFVIPVEIDGVEHQVYVLKRPYVDEFLAKVGEHFECILFTASLAKYADPVADLLDKKRVFRGRLFREACVFHKGNYVKDLSRLGRNLNQTLIIDNSPASYAFHPENAVPVTTWFDDPSDTELLDILPSLEHL 319          
BLAST of CTD small phosphatase protein vs. Ensembl Celegans
Match: scpl-1 (CTD small phosphatase-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q8T3G2])

HSP 1 Score: 214.542 bits (545), Expect = 5.166e-65
Identity = 98/159 (61.64%), Postives = 122/159 (76.73%), Query Frame = 1
Query:  550 NNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDL 1026
             + NKKC +IDLDETLVHSSFK VK  +  + V+IDGV+H+V+V KRPYVDEFLA++G  FEC+LFTASL KYADPV + LD  +VF  RLFREAC F  GNYVKDL  LGR++N  +I+DNSP SY  HP+NAV + +WFDD +DT L D++P  + L
Sbjct:   66 QDSNKKCLVIDLDETLVHSSFKPVKNPDFVIPVEIDGVEHQVYVLKRPYVDEFLAKVGEHFECILFTASLAKYADPVADLLDKKRVFRGRLFREACVFHKGNYVKDLSRLGRNLNQTLIIDNSPASYAFHPENAVPVTTWFDDPSDTELLDILPSLEHL 224          
BLAST of CTD small phosphatase protein vs. Ensembl Celegans
Match: scpl-1 (CTD small phosphatase-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q8T3G2])

HSP 1 Score: 220.32 bits (560), Expect = 2.439e-64
Identity = 98/156 (62.82%), Postives = 121/156 (77.56%), Query Frame = 1
Query:  559 NKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDL 1026
            NKKC +IDLDETLVHSSFK VK  +  + V+IDGV+H+V+V KRPYVDEFLA++G  FEC+LFTASL KYADPV + LD  +VF  RLFREAC F  GNYVKDL  LGR++N  +I+DNSP SY  HP+NAV + +WFDD +DT L D++P  + L
Sbjct:  310 NKKCLVIDLDETLVHSSFKPVKNPDFVIPVEIDGVEHQVYVLKRPYVDEFLAKVGEHFECILFTASLAKYADPVADLLDKKRVFRGRLFREACVFHKGNYVKDLSRLGRNLNQTLIIDNSPASYAFHPENAVPVTTWFDDPSDTELLDILPSLEHL 465          
BLAST of CTD small phosphatase protein vs. Ensembl Celegans
Match: scpl-3 (CTD small phosphatase-like protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4V4])

HSP 1 Score: 119.013 bits (297), Expect = 6.085e-30
Identity = 66/167 (39.52%), Postives = 93/167 (55.69%), Query Frame = 1
Query:  571 FIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTK-VFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQN 1068
             ++DLDETLVH S   +  A +   V    + ++V+V  RP++  FL+ +   FE ++FTAS   YA+ + + LDP K     RLFRE C    GNYVKDL ILGRD +  +ILDN+  S+     N + I SWF D+NDT L  L  + + + +    V E L   
Sbjct:   31 LVLDLDETLVHCSLTPLDNATMVFPVVFQNITYQVYVRLRPHLRTFLSRMAKTFEIIIFTASKKVYANKLCDILDPRKNHIRHRLFREHCVCVFGNYVKDLTILGRDPSKTMILDNAVQSFAYQLDNGIPIESWFHDRNDTELLKLCSFLEAIPTLGRDVREILRHK 197          
BLAST of CTD small phosphatase protein vs. Ensembl Celegans
Match: scpl-3 (CTD small phosphatase-like protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4V4])

HSP 1 Score: 118.627 bits (296), Expect = 1.868e-29
Identity = 66/167 (39.52%), Postives = 93/167 (55.69%), Query Frame = 1
Query:  571 FIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTK-VFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQN 1068
             ++DLDETLVH S   +  A +   V    + ++V+V  RP++  FL+ +   FE ++FTAS   YA+ + + LDP K     RLFRE C    GNYVKDL ILGRD +  +ILDN+  S+     N + I SWF D+NDT L  L  + + + +    V E L   
Sbjct:   67 LVLDLDETLVHCSLTPLDNATMVFPVVFQNITYQVYVRLRPHLRTFLSRMAKTFEIIIFTASKKVYANKLCDILDPRKNHIRHRLFREHCVCVFGNYVKDLTILGRDPSKTMILDNAVQSFAYQLDNGIPIESWFHDRNDTELLKLCSFLEAIPTLGRDVREILRHK 233          
BLAST of CTD small phosphatase protein vs. Ensembl Fly
Match: CG5830 (gene:FBgn0036556 transcript:FBtr0075521)

HSP 1 Score: 218.394 bits (555), Expect = 2.798e-65
Identity = 98/171 (57.31%), Postives = 128/171 (74.85%), Query Frame = 1
Query:  517 ENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            +   LLP++   + ++KC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL ++G L+ECVLFTASL KYADPV + LD   VF +RLFRE+C +  GNY+KDL+ LGRD+  I+I+DNSP SY+ HP NAV + SWFDD  D  LR+LIP F+ L+
Sbjct:   74 QQRYLLPQVRLTDMHRKCMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLS 244          
BLAST of CTD small phosphatase protein vs. Ensembl Fly
Match: CG5830 (gene:FBgn0036556 transcript:FBtr0333579)

HSP 1 Score: 218.394 bits (555), Expect = 5.587e-65
Identity = 98/171 (57.31%), Postives = 128/171 (74.85%), Query Frame = 1
Query:  517 ENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            +   LLP++   + ++KC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL ++G L+ECVLFTASL KYADPV + LD   VF +RLFRE+C +  GNY+KDL+ LGRD+  I+I+DNSP SY+ HP NAV + SWFDD  D  LR+LIP F+ L+
Sbjct:   97 QQRYLLPQVRLTDMHRKCMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLS 267          
BLAST of CTD small phosphatase protein vs. Ensembl Fly
Match: Dd (gene:FBgn0029067 transcript:FBtr0339623)

HSP 1 Score: 107.842 bits (268), Expect = 4.766e-26
Identity = 64/165 (38.79%), Postives = 88/165 (53.33%), Query Frame = 1
Query:  559 NKKCFIIDLDETLVHS--------SFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTK-VFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDL 1026
             +K  ++DLDETL+HS        + K     +  V V ID      FV KRP+VD FL  +   ++ V+FTAS+  Y   V + LD  + +   R +R+ C    G+Y KDL  +  D+N I I+DNSP +Y   P NA+ I SWF D  DTAL  L+P    L
Sbjct:   56 QRKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDAL 220          
BLAST of CTD small phosphatase protein vs. Ensembl Fly
Match: Dd (gene:FBgn0029067 transcript:FBtr0077226)

HSP 1 Score: 107.457 bits (267), Expect = 6.190e-26
Identity = 64/165 (38.79%), Postives = 88/165 (53.33%), Query Frame = 1
Query:  559 NKKCFIIDLDETLVHS--------SFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTK-VFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDL 1026
             +K  ++DLDETL+HS        + K     +  V V ID      FV KRP+VD FL  +   ++ V+FTAS+  Y   V + LD  + +   R +R+ C    G+Y KDL  +  D+N I I+DNSP +Y   P NA+ I SWF D  DTAL  L+P    L
Sbjct:   59 QRKTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDAL 223          
BLAST of CTD small phosphatase protein vs. Ensembl Fly
Match: CG8584 (gene:FBgn0033322 transcript:FBtr0088724)

HSP 1 Score: 97.0561 bits (240), Expect = 7.215e-22
Identity = 59/172 (34.30%), Postives = 94/172 (54.65%), Query Frame = 1
Query:  559 NKKCFIIDLDETLVHSSFKFVKT--------------ANINVNVDIDGVQHEVF-VCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTK-VFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDL 1026
             +K  ++DLDETLVHS +    T               +  +N+ IDG++  VF V KRP+VDEFL  +   ++ V++TASL  YA  V + LD  + +   R +R+ C        KDL ++  D++ ++I+DNSP +Y   P NA+ I ++  D +DT L  ++P+   L
Sbjct:   94 GRKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDAL 265          
BLAST of CTD small phosphatase protein vs. Ensembl Zebrafish
Match: ctdspla (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like a [Source:ZFIN;Acc:ZDB-GENE-060825-333])

HSP 1 Score: 226.868 bits (577), Expect = 4.536e-69
Identity = 109/208 (52.40%), Postives = 144/208 (69.23%), Query Frame = 1
Query:  406 AQPLSASNETNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            A+P + +N+T   P    +++S    D     P      + +LP++S N+  K C +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL ++G +FECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR++N +II+DNSP SY+ HP+NAV + SWFDD  DT L DL+P F+ L+
Sbjct:   54 AEPPATNNKTCSLPPPAEDNSSSPKCDQVQVIPIPSPPAKYILPEVSINDYGKNCVVIDLDETLVHSSFKPISNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGEMFECVLFTASLAKYADPVADLLDQWGVFRARLFRESCVFHRGNYVKDLSRLGRELNKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLLPLFEGLS 261          
BLAST of CTD small phosphatase protein vs. Ensembl Zebrafish
Match: ctdsp2 (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-184])

HSP 1 Score: 223.016 bits (567), Expect = 6.831e-68
Identity = 106/186 (56.99%), Postives = 135/186 (72.58%), Query Frame = 1
Query:  520 NEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQNKPP 1077
             E LLP ++ ++Q K C +IDLDETLVHSSFK +  A+  V V+I+G  H+V+V KRPYVDEFL  +G LFECVLFTASL KYADPVT+ LD   VF +RLFRE+C F  G YVKDL  LGR+++  +ILDNSP SY+ HP+NAV ++SWFDD  DT L  LIP F++L+ +   V   L+Q + P
Sbjct:   74 GESLLPAVTSHDQGKICVVIDLDETLVHSSFKPISNADFIVPVEIEGTTHQVYVLKRPYVDEFLQRMGELFECVLFTASLAKYADPVTDLLDQCGVFRTRLFRESCVFYQGCYVKDLSRLGRELHKTLILDNSPASYIFHPENAVPVLSWFDDSEDTELLHLIPVFEELSQAE-DVYSRLQQLRAP 258          
BLAST of CTD small phosphatase protein vs. Ensembl Zebrafish
Match: ctdsp2 (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-184])

HSP 1 Score: 223.016 bits (567), Expect = 6.831e-68
Identity = 106/186 (56.99%), Postives = 135/186 (72.58%), Query Frame = 1
Query:  520 NEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQNKPP 1077
             E LLP ++ ++Q K C +IDLDETLVHSSFK +  A+  V V+I+G  H+V+V KRPYVDEFL  +G LFECVLFTASL KYADPVT+ LD   VF +RLFRE+C F  G YVKDL  LGR+++  +ILDNSP SY+ HP+NAV ++SWFDD  DT L  LIP F++L+ +   V   L+Q + P
Sbjct:   74 GESLLPAVTSHDQGKICVVIDLDETLVHSSFKPISNADFIVPVEIEGTTHQVYVLKRPYVDEFLQRMGELFECVLFTASLAKYADPVTDLLDQCGVFRTRLFRESCVFYQGCYVKDLSRLGRELHKTLILDNSPASYIFHPENAVPVLSWFDDSEDTELLHLIPVFEELSQAE-DVYSRLQQLRAP 258          
BLAST of CTD small phosphatase protein vs. Ensembl Zebrafish
Match: ctdsp1 (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 [Source:ZFIN;Acc:ZDB-GENE-050522-523])

HSP 1 Score: 222.246 bits (565), Expect = 1.455e-67
Identity = 103/167 (61.68%), Postives = 126/167 (75.45%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            LLP++   +  K C +IDLDETLVHSSFK V  A+  + V+IDG  H+V+V KRP+VDEFL  +G LFECVLFTASL KYADPV++ LD    F SRLFRE+C F  GNYVKDL  LGRD+N +II+DNSP SY+ HP NAV + SWFDD +DT L DLIP+F+ L+
Sbjct:   83 LLPQIKSKDVGKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGTVHQVYVLKRPHVDEFLKRMGELFECVLFTASLAKYADPVSDLLDKWGAFRSRLFRESCVFHRGNYVKDLSRLGRDLNKVIIVDNSPASYIFHPDNAVPVASWFDDMSDTELLDLIPFFERLS 249          
BLAST of CTD small phosphatase protein vs. Ensembl Zebrafish
Match: ctdsplb (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like b [Source:ZFIN;Acc:ZDB-GENE-060929-488])

HSP 1 Score: 222.246 bits (565), Expect = 2.016e-67
Identity = 102/167 (61.08%), Postives = 130/167 (77.84%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            LLP+++ N+  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL ++G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR++ ++II+DNSP SY+ HP+NAV + SWFDD  DT L DL+P+F+ L+
Sbjct:   85 LLPEVNINDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELFECVLFTASLAKYADPVADLLDQWGVFRARLFRESCVFHRGNYVKDLSRLGRELRNVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLLPFFEGLS 251          
BLAST of CTD small phosphatase protein vs. Ensembl Xenopus
Match: poln (polymerase (DNA directed) nu [Source:Xenbase;Acc:XB-GENE-988834])

HSP 1 Score: 224.942 bits (572), Expect = 1.963e-68
Identity = 103/169 (60.95%), Postives = 128/169 (75.74%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASS 1035
            LLP+++  ++ K C +IDLDETLVHSSFK +  A+  V V+I+G  H+V+V KRPYVDEFL  +G L+ECVLFTASL KYADPVT+ LD + VF SRLFREAC F  G YVKDL  LGRD+   +ILDNSP SY+ HP+NAV + SWFDD +DT L  LIP F++L+ S
Sbjct:   77 LLPEVAPKDKEKICMVIDLDETLVHSSFKPISNADFIVPVEIEGTTHQVYVLKRPYVDEFLERMGQLYECVLFTASLAKYADPVTDLLDKSGVFRSRLFREACVFHQGCYVKDLSRLGRDLKKTVILDNSPASYIFHPENAVPVQSWFDDMSDTELLSLIPIFEELSYS 245          
BLAST of CTD small phosphatase protein vs. Ensembl Xenopus
Match: poln (polymerase (DNA directed) nu [Source:Xenbase;Acc:XB-GENE-988834])

HSP 1 Score: 224.557 bits (571), Expect = 3.385e-68
Identity = 113/217 (52.07%), Postives = 142/217 (65.44%), Query Frame = 1
Query:  385 STTGSSIAQPLSASNETNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASS 1035
            S    SI  P+    ETN +P      +       Y F+         LLP+++  ++ K C +IDLDETLVHSSFK +  A+  V V+I+G  H+V+V KRPYVDEFL  +G L+ECVLFTASL KYADPVT+ LD + VF SRLFREAC F  G YVKDL  LGRD+   +ILDNSP SY+ HP+NAV + SWFDD +DT L  LIP F++L+ S
Sbjct:   51 SRPAGSIEPPI-PKEETNATPK-----SDLLQCLQYQFYQ---IPGTSLLPEVAPKDKEKICMVIDLDETLVHSSFKPISNADFIVPVEIEGTTHQVYVLKRPYVDEFLERMGQLYECVLFTASLAKYADPVTDLLDKSGVFRSRLFREACVFHQGCYVKDLSRLGRDLKKTVILDNSPASYIFHPENAVPVQSWFDDMSDTELLSLIPIFEELSYS 258          
BLAST of CTD small phosphatase protein vs. Ensembl Xenopus
Match: tada1 (transcriptional adaptor 1 [Source:Xenbase;Acc:XB-GENE-951719])

HSP 1 Score: 223.787 bits (569), Expect = 8.986e-68
Identity = 111/210 (52.86%), Postives = 144/210 (68.57%), Query Frame = 1
Query:  400 SIAQPLSASNETNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            S+  P S +N + L P    E+   + +D            + LLP+L  ++  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL ++G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR+++ +II+DNSP SY+ HP+NAV + SWFDD  DT L DLIP+F+ L+
Sbjct:   53 SVEPPTSNNNSSPLPP-LVEENGGIQKADQTQALTIPSPPAKYLLPELKVSDYGKKCVVIDLDETLVHSSFKPINNADFIVPVEIDGTIHQVYVLKRPHVDEFLQKMGELFECVLFTASLAKYADPVADLLDRWGVFNARLFRESCVFHRGNYVKDLSRLGRELSKVIIIDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLS 261          
BLAST of CTD small phosphatase protein vs. Ensembl Xenopus
Match: tada1 (transcriptional adaptor 1 [Source:Xenbase;Acc:XB-GENE-951719])

HSP 1 Score: 223.402 bits (568), Expect = 1.143e-67
Identity = 108/208 (51.92%), Postives = 144/208 (69.23%), Query Frame = 1
Query:  406 AQPLSASNETNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
             +P +++N ++  P    E+   + +D            + LLP+L  ++  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL ++G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR+++ +II+DNSP SY+ HP+NAV + SWFDD  DT L DLIP+F+ L+
Sbjct:   56 VEPPTSNNNSSPLPPLVEENGGIQKADQTQALTIPSPPAKYLLPELKVSDYGKKCVVIDLDETLVHSSFKPINNADFIVPVEIDGTIHQVYVLKRPHVDEFLQKMGELFECVLFTASLAKYADPVADLLDRWGVFNARLFRESCVFHRGNYVKDLSRLGRELSKVIIIDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLS 263          
BLAST of CTD small phosphatase protein vs. Ensembl Xenopus
Match: tada1 (transcriptional adaptor 1 [Source:Xenbase;Acc:XB-GENE-951719])

HSP 1 Score: 221.09 bits (562), Expect = 6.324e-67
Identity = 103/167 (61.68%), Postives = 129/167 (77.25%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            LLP+L  ++  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL ++G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR+++ +II+DNSP SY+ HP+NAV + SWFDD  DT L DLIP+F+ L+
Sbjct:   84 LLPELKVSDYGKKCVVIDLDETLVHSSFKPINNADFIVPVEIDGTIHQVYVLKRPHVDEFLQKMGELFECVLFTASLAKYADPVADLLDRWGVFNARLFRESCVFHRGNYVKDLSRLGRELSKVIIIDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLS 250          
BLAST of CTD small phosphatase protein vs. Ensembl Mouse
Match: Ctdsp2 (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2 [Source:MGI Symbol;Acc:MGI:1098748])

HSP 1 Score: 226.483 bits (576), Expect = 5.747e-69
Identity = 113/212 (53.30%), Postives = 144/212 (67.92%), Query Frame = 1
Query:  415 LSASNETNLSPNETNEDNSFKNSD-----SYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASS 1035
            + +S+ T L+  E  E N+   SD      Y F+         LLP+++E +Q + C +IDLDETLVHSSFK +  A+  V V+I+G  H+V+V KRPYVDEFL  +G LFECVLFTASL KYADPVT+ LD   VF +RLFREAC F  G YVKDL  LGRD+   +ILDNSP SY+ HP+NAV + SWFDD  DT L +LIP F++L+ +
Sbjct:   51 VQSSSSTELTHKE--EANTIAKSDLLQCLQYQFYQ---IPGTCLLPEVTEQDQGRICVVIDLDETLVHSSFKPINNADFIVPVEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFREACVFHQGCYVKDLSRLGRDLRKTVILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPVFEELSGT 257          
BLAST of CTD small phosphatase protein vs. Ensembl Mouse
Match: Ctdspl (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like [Source:MGI Symbol;Acc:MGI:1916524])

HSP 1 Score: 226.483 bits (576), Expect = 6.172e-69
Identity = 107/202 (52.97%), Postives = 139/202 (68.81%), Query Frame = 1
Query:  424 SNETNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            +N  ++ P    E+   +  D     P      + LLP+++  +  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL  +G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR+++ +II+DNSP SY+ HP+NAV + SWFDD  DT L DLIP+F+ L+
Sbjct:   60 ANSPSVLPPLVEENGGLQKGDQRQVIPVPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLS 261          
BLAST of CTD small phosphatase protein vs. Ensembl Mouse
Match: Ctdspl (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like [Source:MGI Symbol;Acc:MGI:1916524])

HSP 1 Score: 220.32 bits (560), Expect = 1.171e-66
Identity = 102/167 (61.08%), Postives = 128/167 (76.65%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            LLP+++  +  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL  +G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR+++ +II+DNSP SY+ HP+NAV + SWFDD  DT L DLIP+F+ L+
Sbjct:   84 LLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLS 250          
BLAST of CTD small phosphatase protein vs. Ensembl Mouse
Match: Ctdsp1 (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 [Source:MGI Symbol;Acc:MGI:2654470])

HSP 1 Score: 218.394 bits (555), Expect = 4.948e-66
Identity = 100/169 (59.17%), Postives = 126/169 (74.56%), Query Frame = 1
Query:  523 EKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            + LLP+    + +K C +IDLDETLVHSSFK V  A+  + V+IDGV H+V+V KRP+VDEFL  +G LFECVLFTASL KYADPV + LD    F +RLFRE+C F  GNYVKDL  LGRD+  ++ILDNSP SY+ HP NAV + SWFD+ +DT L DL+P+F+ L+
Sbjct:   77 QYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLS 245          
BLAST of CTD small phosphatase protein vs. Ensembl Mouse
Match: Ctdsp2 (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2 [Source:MGI Symbol;Acc:MGI:1098748])

HSP 1 Score: 148.288 bits (373), Expect = 8.650e-42
Identity = 67/106 (63.21%), Postives = 80/106 (75.47%), Query Frame = 1
Query:  718 LGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASS 1035
            +G LFECVLFTASL KYADPVT+ LD   VF +RLFREAC F  G YVKDL  LGRD+   +ILDNSP SY+ HP+NAV + SWFDD  DT L +LIP F++L+ +
Sbjct:    1 MGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFREACVFHQGCYVKDLSRLGRDLRKTVILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPVFEELSGT 106          
BLAST of CTD small phosphatase protein vs. UniProt/SwissProt
Match: sp|Q9PTJ6|CTDSL_CHICK (CTD small phosphatase-like protein OS=Gallus gallus OX=9031 GN=NFI1 PE=2 SV=2)

HSP 1 Score: 230.335 bits (586), Expect = 1.277e-69
Identity = 109/203 (53.69%), Postives = 141/203 (69.46%), Query Frame = 1
Query:  421 ASNETNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            ++N T+  P    E+   +  D     P      + LLP+L+ ++  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL  +G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR+++ +II+DNSP SY+ HP+NAV + SWFDD  DT L DLIP+F+ L+
Sbjct:   58 STNSTSALPPLVEENGGLQKGDQMQVMPIPSPPAKYLLPELTASDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLS 260          
BLAST of CTD small phosphatase protein vs. UniProt/SwissProt
Match: sp|Q8BX07|CTDS2_MOUSE (Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Mus musculus OX=10090 GN=Ctdsp2 PE=2 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 4.020e-68
Identity = 113/212 (53.30%), Postives = 144/212 (67.92%), Query Frame = 1
Query:  415 LSASNETNLSPNETNEDNSFKNSD-----SYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASS 1035
            + +S+ T L+  E  E N+   SD      Y F+         LLP+++E +Q + C +IDLDETLVHSSFK +  A+  V V+I+G  H+V+V KRPYVDEFL  +G LFECVLFTASL KYADPVT+ LD   VF +RLFREAC F  G YVKDL  LGRD+   +ILDNSP SY+ HP+NAV + SWFDD  DT L +LIP F++L+ +
Sbjct:   51 VQSSSSTELTHKE--EANTIAKSDLLQCLQYQFYQ---IPGTCLLPEVTEQDQGRICVVIDLDETLVHSSFKPINNADFIVPVEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFREACVFHQGCYVKDLSRLGRDLRKTVILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPVFEELSGT 257          
BLAST of CTD small phosphatase protein vs. UniProt/SwissProt
Match: sp|P58465|CTDSL_MOUSE (CTD small phosphatase-like protein OS=Mus musculus OX=10090 GN=Ctdspl PE=2 SV=3)

HSP 1 Score: 226.483 bits (576), Expect = 4.317e-68
Identity = 107/202 (52.97%), Postives = 139/202 (68.81%), Query Frame = 1
Query:  424 SNETNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            +N  ++ P    E+   +  D     P      + LLP+++  +  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL  +G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR+++ +II+DNSP SY+ HP+NAV + SWFDD  DT L DLIP+F+ L+
Sbjct:   60 ANSPSVLPPLVEENGGLQKGDQRQVIPVPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLS 261          
BLAST of CTD small phosphatase protein vs. UniProt/SwissProt
Match: sp|O14595|CTDS2_HUMAN (Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Homo sapiens OX=9606 GN=CTDSP2 PE=1 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 1.270e-66
Identity = 101/169 (59.76%), Postives = 128/169 (75.74%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASS 1035
            LLP+++E +Q + C +IDLDETLVHSSFK +  A+  V ++I+G  H+V+V KRPYVDEFL  +G LFECVLFTASL KYADPVT+ LD   VF +RLFRE+C F  G YVKDL  LGRD+   +ILDNSP SY+ HP+NAV + SWFDD  DT L +LIP F++L+ +
Sbjct:   90 LLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGA 258          
BLAST of CTD small phosphatase protein vs. UniProt/SwissProt
Match: sp|O15194|CTDSL_HUMAN (CTD small phosphatase-like protein OS=Homo sapiens OX=9606 GN=CTDSPL PE=1 SV=2)

HSP 1 Score: 222.246 bits (565), Expect = 1.665e-66
Identity = 105/190 (55.26%), Postives = 134/190 (70.53%), Query Frame = 1
Query:  460 EDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            E+   +  D     P      + LLP+++  +  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL  +G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR+++ +II+DNSP SY+ HP+NAV + SWFDD  DT L DLIP+F+ L+
Sbjct:   72 ENGGLQKGDQRQVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLS 261          
BLAST of CTD small phosphatase protein vs. TrEMBL
Match: A0A0V0J9E6 (CTD small phosphatase-like protein OS=Schistocephalus solidus OX=70667 GN=CTDSL PE=4 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 9.281e-71
Identity = 116/190 (61.05%), Postives = 142/190 (74.74%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQNKPPESAGILG 1098
            LL    E+++NKKCFIIDLDETLVHSSFK V+ A+  V V+IDG  H+V+V KRP+VDEFL  + +++ECVLFTASL KYADPV +FLD   VF  RLFREAC +  GNYVKDL  +GR I+ I+ILDNSPVSY+ H  +AVQI SWFDD +D AL DLIPYF+ LA  P +V E+L  N PP    ++G
Sbjct:   52 LLGPPRESDRNKKCFIIDLDETLVHSSFKAVEKADFRVGVEIDGCIHQVYVLKRPFVDEFLQAMADIYECVLFTASLSKYADPVADFLDKWNVFRYRLFREACVYHRGNYVKDLAQIGRPIDQIVILDNSPVSYMFHATHAVQITSWFDDTSDRALLDLIPYFQHLAGEP-NVVEFLRNNPPPPKCAVVG 240          
BLAST of CTD small phosphatase protein vs. TrEMBL
Match: A0A504YMQ0 (CTD small phosphatase protein OS=Fasciola gigantica OX=46835 GN=FGIG_03239 PE=4 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.159e-70
Identity = 121/204 (59.31%), Postives = 148/204 (72.55%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQNKPP---ESAGILGYPPSNLHWILM 1131
            LL   SEN++ KKCF+IDLDETLVHSSFK V+ A+  V V+IDG+ H V+V KRP+VD FL+ + NL+ECVLFTASL KYADPV +F+D    F  RLFRE+C F  GNYVKDL  LGR IN I+ILDNSP SY+ H  +AVQI SWFDD ND AL DLIPYF+ LAS P +V E+L  N PP    + G +G P +++  I +
Sbjct:  270 LLGPRSENDKGKKCFVIDLDETLVHSSFKMVEQADFKVGVEIDGITHRVYVLKRPHVDAFLSTMANLYECVLFTASLAKYADPVADFIDKWNTFRYRLFRESCVFHRGNYVKDLSHLGRPINQIVILDNSPASYMFHASHAVQISSWFDDANDRALLDLIPYFERLASHP-NVVEFLRTNTPPTPHAAVGTVGLPAASMTSIPL 472          
BLAST of CTD small phosphatase protein vs. TrEMBL
Match: A0A4S2MM95 (FCP1 homology domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000387 PE=4 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 1.586e-70
Identity = 119/197 (60.41%), Postives = 143/197 (72.59%), Query Frame = 1
Query:  508 NISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQNKPPESAGILG 1098
            N+  +  LL   SEN++ KKCF+IDLDETLVHSSFK V+ A+  V V+IDGV H V+V KRP+VD FL+ + NL+ECVLFTASL KYADPV +FLD    F  RLFRE+C +  GNYVKDL  LGR IN ++ILDNSP SY+ H  +AVQI SWFDD ND AL DLIPYF+ LAS P +V E+L  N PP     +G
Sbjct:  221 NVQHHTTLLGPRSENDKGKKCFVIDLDETLVHSSFKMVEQADFKVGVEIDGVTHRVYVLKRPHVDVFLSTMANLYECVLFTASLAKYADPVADFLDKWSAFRYRLFRESCVYHRGNYVKDLSHLGRPINQVVILDNSPASYMFHANHAVQISSWFDDVNDRALLDLIPYFERLASHP-NVVEFLRTNTPPTPHAAVG 416          
BLAST of CTD small phosphatase protein vs. TrEMBL
Match: A0A5J4NH36 (Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase OS=Paragonimus westermani OX=34504 GN=DEA37_0012809 PE=4 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 3.196e-70
Identity = 122/206 (59.22%), Postives = 148/206 (71.84%), Query Frame = 1
Query:  508 NISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQNKPP---ESAGILGYPPSNL 1116
            NI  +  LL   SEN++ KKCF+IDLDETLVHSSFK V+ A+  V V+IDGV H V+V KRP+VD FL+ + NL+ECVLFTASL KYADPV +F+D    F  RLFRE+C +  GNYVKDL  LGR IN I+ILDNSP SY+ H  +AVQI SWFDD ND  L DLIPYF+ LAS P +V ++L  N PP    + G +G PP+ L
Sbjct:  215 NIEHHNTLLGPRSENDKGKKCFVIDLDETLVHSSFKMVEHADFKVGVEIDGVTHRVYVLKRPHVDIFLSTMANLYECVLFTASLAKYADPVADFIDKWNAFRYRLFRESCVYHRGNYVKDLSHLGRPINQIVILDNSPASYMFHTHHAVQISSWFDDANDRVLLDLIPYFERLASHP-NVVDFLRNNTPPTPFAAVGTMGLPPTIL 419          
BLAST of CTD small phosphatase protein vs. TrEMBL
Match: A0A074Z683 (FCP1 homology domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_10535 PE=4 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 2.183e-69
Identity = 118/190 (62.11%), Postives = 140/190 (73.68%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQNKPPESAGILG 1098
            LL   SEN++ KKCF+IDLDETLVHSSFK V+ A+  V V+IDGV H V+V KRP+VD FL+ + NL+ECVLFTASL KYADPV +FLD    F  RLFRE+C +  GNYVKDL  LGR IN ++ILDNSP SY+ H  +AVQI SWFDD ND AL DLIPYF+ LAS P +V E+L  N PP     +G
Sbjct:  251 LLGPRSENDKGKKCFVIDLDETLVHSSFKMVEQADFKVGVEIDGVTHRVYVLKRPHVDVFLSTMANLYECVLFTASLAKYADPVADFLDKWSAFRYRLFRESCVYHRGNYVKDLSHLGRPINQVVILDNSPASYMFHANHAVQISSWFDDVNDRALLDLIPYFERLASHP-NVVEFLRTNTPPTPHAAVG 439          
BLAST of CTD small phosphatase protein vs. Ensembl Cavefish
Match: ctdspla (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like a [Source:ZFIN;Acc:ZDB-GENE-060825-333])

HSP 1 Score: 227.254 bits (578), Expect = 3.453e-68
Identity = 110/208 (52.88%), Postives = 141/208 (67.79%), Query Frame = 1
Query:  406 AQPLSASNETNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
             +P + +N+T   P    E+      D     P   S  + LLP++S N+  K C +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL ++G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR ++ +II+DNSP SY+ HP+NAV + SWFDD  DT L DL+P F+ L+
Sbjct:  145 VEPPAPNNKTCTLPPPAEENGGSPKCDQVQVIPIPSSPAKYLLPEVSINDYGKNCVVIDLDETLVHSSFKPISNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELFECVLFTASLAKYADPVADLLDQWGVFRARLFRESCVFHRGNYVKDLSRLGRQLSKVIIVDNSPASYIFHPENAVPVQSWFDDMADTELLDLLPLFEGLS 352          
BLAST of CTD small phosphatase protein vs. Ensembl Cavefish
Match: ctdsplb (CTD small phosphatase-like protein [Source:NCBI gene;Acc:103041610])

HSP 1 Score: 224.942 bits (572), Expect = 3.762e-68
Identity = 108/206 (52.43%), Postives = 144/206 (69.90%), Query Frame = 1
Query:  412 PLSASNETNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            P + +N T+  P    E+ +    +     P      + LL +++ N+  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL ++G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR+++++II+DNSP SY+ HP+NAV + SWFDD NDT L DL+P+F+ L+
Sbjct:   57 PATTNNNTSPLPPPVEENGAPPKCEQAEVIPVPGPPEKYLLSEVNINDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTVHQVYVLKRPFVDEFLQKMGELFECVLFTASLAKYADPVADLLDQWGVFRARLFRESCVFHRGNYVKDLSRLGRELHNVIIVDNSPASYIFHPENAVPVQSWFDDMNDTELLDLLPFFEGLS 262          
BLAST of CTD small phosphatase protein vs. Ensembl Cavefish
Match: ctdsplb (CTD small phosphatase-like protein [Source:NCBI gene;Acc:103041610])

HSP 1 Score: 224.172 bits (570), Expect = 3.854e-68
Identity = 108/206 (52.43%), Postives = 144/206 (69.90%), Query Frame = 1
Query:  412 PLSASNETNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            P + +N T+  P    E+ +    +     P      + LL +++ N+  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL ++G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR+++++II+DNSP SY+ HP+NAV + SWFDD NDT L DL+P+F+ L+
Sbjct:   57 PATTNNNTSPLPPPVEENGAPPKCEQAEVIPVPGPPEKYLLSEVNINDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTVHQVYVLKRPFVDEFLQKMGELFECVLFTASLAKYADPVADLLDQWGVFRARLFRESCVFHRGNYVKDLSRLGRELHNVIIVDNSPASYIFHPENAVPVQSWFDDMNDTELLDLLPFFEGLS 262          
BLAST of CTD small phosphatase protein vs. Ensembl Cavefish
Match: ctdsp1 (carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1-like [Source:NCBI gene;Acc:103040141])

HSP 1 Score: 221.476 bits (563), Expect = 3.246e-67
Identity = 102/167 (61.08%), Postives = 125/167 (74.85%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            LLP++   +  K C +IDLDETLVHSSFK V  A+  + V+IDG  H+V+V KRP+VDEFL  +G LFECVLFTASL KYADPV++ LD    F  RLFRE+C F  GNYVKDL  LGRD+N +II+DNSP SY+ HP NAV + SWFDD +DT L DLIP+F+ L+
Sbjct:   83 LLPQIKSKDAGKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGAVHQVYVLKRPHVDEFLKRMGELFECVLFTASLAKYADPVSDLLDKWGAFRCRLFRESCVFHRGNYVKDLSRLGRDLNKVIIVDNSPASYIFHPDNAVPVASWFDDMSDTELLDLIPFFERLS 249          
BLAST of CTD small phosphatase protein vs. Ensembl Cavefish
Match: ctdsplb (CTD small phosphatase-like protein [Source:NCBI gene;Acc:103041610])

HSP 1 Score: 220.32 bits (560), Expect = 8.360e-67
Identity = 102/167 (61.08%), Postives = 131/167 (78.44%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            LL +++ N+  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL ++G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR+++++II+DNSP SY+ HP+NAV + SWFDD NDT L DL+P+F+ L+
Sbjct:   85 LLSEVNINDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTVHQVYVLKRPFVDEFLQKMGELFECVLFTASLAKYADPVADLLDQWGVFRARLFRESCVFHRGNYVKDLSRLGRELHNVIIVDNSPASYIFHPENAVPVQSWFDDMNDTELLDLLPFFEGLS 251          
BLAST of CTD small phosphatase protein vs. Ensembl Sea Lamprey
Match: ctdsp2 (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-184])

HSP 1 Score: 224.172 bits (570), Expect = 3.351e-69
Identity = 104/198 (52.53%), Postives = 136/198 (68.69%), Query Frame = 1
Query:  442 SPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASS 1035
            +P +  E+ +       +  P  I     LLP+L   ++ KKC +IDLDETLVHSSFK ++ A+  + V+I+G  H+V+V KRP+VDEFL  +G LFECVLFTASL KYADPV + LD   VF  RLFRE+C F  G+YVKDL  LGRD++  II+DNSP SY+ HP+NAV + SWFDD +D  L DLIP F++L  +
Sbjct:   35 APKKVEENGALLKKCQRYLMPIEIPVERPLLPELRPLDEGKKCMVIDLDETLVHSSFKPIENADFIIPVEIEGTTHQVYVMKRPFVDEFLQRMGELFECVLFTASLAKYADPVADLLDRWGVFRVRLFRESCVFHHGSYVKDLSRLGRDLSQTIIIDNSPASYIFHPENAVPVGSWFDDMSDMELLDLIPLFEELGKT 232          
BLAST of CTD small phosphatase protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003894.1 (pep scaffold:Pmarinus_7.0:GL482776:1891:9390:1 gene:ENSPMAG00000003567.1 transcript:ENSPMAT00000003894.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.083 bits (549), Expect = 7.870e-67
Identity = 104/177 (58.76%), Postives = 130/177 (73.45%), Query Frame = 1
Query:  520 NEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNA-----VQIVSWFDDQNDTALRDLIPYFKDLASS 1035
            N+ LLP+++ +++ KKC +IDLDETLVHSSFK V  A+  V V+IDG  H+V+V KRP+VDEFL  +G LFEC+LFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGRD++   ILDNSP SY+ HP NA      Q  SWFDD  DT L DLIP+F++L+ +
Sbjct:    8 NKSLLPEVNHSDRGKKCIVIDLDETLVHSSFKPVNNADFIVPVEIDGTVHQVYVLKRPHVDEFLKRMGELFECILFTASLAKYADPVADLLDKWGVFRTRLFRESCVFHRGNYVKDLSRLGRDLSHTAILDNSPASYIFHPDNARPAILSQSWSWFDDMTDTELLDLIPFFEELSEA 184          
BLAST of CTD small phosphatase protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005899.1 (pep scaffold:Pmarinus_7.0:GL476522:358859:362945:1 gene:ENSPMAG00000005326.1 transcript:ENSPMAT00000005899.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.726 bits (465), Expect = 3.332e-55
Identity = 84/137 (61.31%), Postives = 103/137 (75.18%), Query Frame = 1
Query:  619 VKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            +  A+  V V+IDG  H+V+V KRP+VDEFL  +G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR++N +II+DNSP SY+ HP NAV +VSWFDD  DT L DL+P F+ L+
Sbjct:    2 INNADFIVPVEIDGTIHQVYVLKRPHVDEFLKRMGELFECVLFTASLAKYADPVADLLDKWGVFRARLFRESCVFHHGNYVKDLSRLGRELNKVIIIDNSPASYIFHPDNAVPVVSWFDDMTDTELLDLVPLFEGLS 138          
BLAST of CTD small phosphatase protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001121.1 (pep scaffold:Pmarinus_7.0:GL485372:3962:9133:1 gene:ENSPMAG00000000998.1 transcript:ENSPMAT00000001121.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.673 bits (374), Expect = 9.012e-40
Identity = 91/255 (35.69%), Postives = 129/255 (50.59%), Query Frame = 1
Query:  337 ALIDNGKAKSVDTIINSTTGSSIAQPLSASNETNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKK-------------CFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTK-VFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWL 1059
            A++D     + D         ++  P S+  E + +P ET  D  ++  D Y F         K LP L+E    +K               ++DLDETLVH S   ++ A +   V    V ++V+V  RPY  EFL  +   FE +LFTAS   YAD + N LDP K +   RLFRE C    GNY+KDL+ILGRD++  II+DNSP ++     N + I SWF D+ DT L  LIP+ + L    + V  ++
Sbjct:  115 AVVDLACGAAADDGETEDEEPAMLPPESSYPEPSATPAETCYDEDWEVFDPYAFI--------KNLPPLTEEQLARKPALPLKTRSTPEYSLVLDLDETLVHCSLIHLEDAALTFPVLFQDVNYQVYVRLRPYFREFLERMSKHFEIILFTASKKVYADKLLNILDPAKKLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDRGDTELLKLIPFLERLVRMDVDVRPYI 361          
BLAST of CTD small phosphatase protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010797.1 (pep scaffold:Pmarinus_7.0:GL476346:608242:622413:1 gene:ENSPMAG00000009781.1 transcript:ENSPMAT00000010797.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.747 bits (369), Expect = 2.446e-38
Identity = 83/206 (40.29%), Postives = 113/206 (54.85%), Query Frame = 1
Query:  451 ETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKK-------------CFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTK-VFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDL 1026
            E N D  +   D Y+F         K LP LSE+   +K               ++DLDETLVH S   ++ A +   V    V ++V+V  RP+  EFL  +  ++E +LFTAS   YAD + N LDP K + + RLFRE C    GNYVKDL+ILGRD++  II+DNSP ++     N + I SWF D+ND  L  LIP+ + L
Sbjct:  254 EANYDEDWDVFDPYYFI--------KHLPPLSEDQLTRKPALPLKTRSTPEYSLVLDLDETLVHCSLNELEDAALTFPVLFQDVSYQVYVRLRPHFREFLERMSKIYEVILFTASKKVYADKLLNILDPKKKLVKHRLFREHCVCVQGNYVKDLNILGRDLSKTIIVDNSPQAFAYQLSNGIPIESWFVDKNDKELLKLIPFLETL 451          
BLAST of CTD small phosphatase protein vs. Ensembl Yeast
Match: PSR1 (Plasma membrane associated protein phosphatase; involved in the general stress response; required along with binding partner Whi2p for full activation of STRE-mediated gene expression, possibly through dephosphorylation of Msn2p; PSR1 has a paralog, PSR2, that arose from the whole genome duplication [Source:SGD;Acc:S000003933])

HSP 1 Score: 196.052 bits (497), Expect = 1.283e-56
Identity = 89/167 (53.29%), Postives = 122/167 (73.05%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            LLP   E+ + KKC I+DLDETLVHSSFK++++A+  ++V+ID   H V+V KRP V+EFL  +G LFE V+FTAS+ +Y DP+ + LD  KV   RLFREAC   +GNY+K+L  +GR ++ IIILDNSP SY+ HP++A+ I SWF D +D  L D+IP  +DL+
Sbjct:  246 LLPPQDESTKGKKCLILDLDETLVHSSFKYLRSADFVLSVEIDDQVHNVYVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKVIHHRLFREACYNYEGNYIKNLSQIGRPLSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNELLDIIPLLEDLS 412          
BLAST of CTD small phosphatase protein vs. Ensembl Yeast
Match: PSR2 (Plasma membrane phosphatase involved in the general stress response; required with Psr1p and Whi2p for full activation of STRE-mediated gene expression, possibly through dephosphorylation of Msn2p; PSR2 has a paralog, PSR1, that arose from the whole genome duplication [Source:SGD;Acc:S000004009])

HSP 1 Score: 187.193 bits (474), Expect = 9.675e-54
Identity = 100/208 (48.08%), Postives = 132/208 (63.46%), Query Frame = 1
Query:  418 SASNETNLSPNETNEDNSFKNSDSYHFFPKNISE--NEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASS 1035
            S  N+ NL P  T ED S    D  H  P        + LLP   +  Q KKC I+DLDETLVHSSFK++ +A+  + V+ID   H V+V KRP VDEFL  +  L+E V+FTAS+ +YA+P+ + LDP      RLFREAC   +GNY+K+L  +GR ++  IILDNSP SY+ HP++AV I SWF D +D  L D+IP  +DL+S 
Sbjct:  182 SPDNDLNLIPT-TEEDFS----DLTHLQPDQYHAPGYDTLLPPKLQEFQQKKCLILDLDETLVHSSFKYMHSADFVLPVEIDDQVHNVYVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTIHHRLFREACYNYEGNYIKNLSQIGRPLSETIILDNSPASYIFHPQHAVPISSWFSDTHDNELLDIIPLLEDLSSG 384          
BLAST of CTD small phosphatase protein vs. Ensembl Yeast
Match: NEM1 (Probable catalytic subunit of Nem1p-Spo7p phosphatase holoenzyme; regulates nuclear growth by controlling phospholipid biosynthesis, required for normal nuclear envelope morphology and sporulation; homolog of the human protein Dullard [Source:SGD;Acc:S000001046])

HSP 1 Score: 133.265 bits (334), Expect = 4.864e-34
Identity = 72/199 (36.18%), Postives = 112/199 (56.28%), Query Frame = 1
Query:  496 FFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTAN------INVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPT--KVFESRLFREACAFKDG-NYVKDLDIL----------GRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASS 1035
             FPK      KL+PK   N Q KK  +IDLDETL+HS+ +    +N      + V   + G++   F+ KRPY D FL ++   ++ ++FTAS+ +YADPV ++L+ +    F  R +R  C  +DG  Y+KDL I+             ++ +II+DNSPVSY ++  NA+Q+  W  D  DT L +L+P+ + +  S
Sbjct:  235 LFPK------KLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGIRTLYFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDGVGYIKDLSIVKDSEENGKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYS 427          
BLAST of CTD small phosphatase protein vs. Ensembl Yeast
Match: TIM50 (Essential component of the TIM23 complex; acts as receptor for the translocase of the inner mitochondrial membrane (TIM23) complex guiding incoming precursors from the TOM complex; may control the gating of the Tim23p-Tim17p channel [Source:SGD;Acc:S000005984])

HSP 1 Score: 100.523 bits (249), Expect = 6.200e-23
Identity = 56/156 (35.90%), Postives = 84/156 (53.85%), Query Frame = 1
Query:  568 CFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFES-RLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLAS 1032
              +I L++ LVHS +                 +H     KRP  D FL  L   +E VLF+++   Y+D +   LDP   F S  LF+E C +KDG ++KDL  L RD++ +II+D  P SY L P+NA+ +  W  + +D  +R LIP+ + LA+
Sbjct:  193 TLVITLEDFLVHSEW---------------SQKHGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKDGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADDKLVR-LIPFLEYLAT 332          
BLAST of CTD small phosphatase protein vs. Ensembl Nematostella
Match: EDO49427 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGH2])

HSP 1 Score: 214.157 bits (544), Expect = 4.050e-66
Identity = 98/172 (56.98%), Postives = 126/172 (73.26%), Query Frame = 1
Query:  511 ISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDL 1026
            + + + LLP +   + NKKC +IDLDETLVHSSFK V  A+  V V+IDG  H+V+V KRP+VDEFL  +G ++ECVLFTASL KYADPV + LD    F +RLFRE+C F  GNYVKDL  LGRD+  ++ILDNSP SY  HP+NA+ + SWFDD ND  L +LIP+ +++
Sbjct:    3 LQQCKHLLPTIQHQDLNKKCIVIDLDETLVHSSFKPVSNADFIVPVEIDGTVHQVYVLKRPHVDEFLKRVGQIYECVLFTASLAKYADPVADLLDKYNTFRARLFRESCVFHRGNYVKDLSKLGRDLKKVLILDNSPASYSFHPENAIPVTSWFDDPNDCELLELIPFLEEM 174          
BLAST of CTD small phosphatase protein vs. Ensembl Nematostella
Match: EDO48206 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK91])

HSP 1 Score: 139.043 bits (349), Expect = 5.979e-37
Identity = 74/180 (41.11%), Postives = 105/180 (58.33%), Query Frame = 1
Query:  532 LPKLSENNQNKK-------------CFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDP-TKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            +P LSE  +N+                ++DLDETLVH S   ++ A ++  V    + ++VFV  RP++  FL  +  +FE +LFTAS   YAD + N LDP  K F  RLFRE C    GNY+KDL ILGRD++  +I+DNSP ++     N + I SWF DQ D  L +L+P+ ++LA
Sbjct:   80 MPPLSEEMRNRPPVLPLRTRRTPEFSLVLDLDETLVHCSLNKLEDATLSFPVSYQDITYQVFVRTRPHLKYFLERVSKVFEVILFTASKRVYADKLLNILDPEKKYFRHRLFREHCVCVQGNYIKDLSILGRDLSKTMIVDNSPQAFAYQIFNGIPIESWFVDQTDRELVELLPFLEELA 259          
BLAST of CTD small phosphatase protein vs. Ensembl Nematostella
Match: EDO33173 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSY7])

HSP 1 Score: 93.9745 bits (232), Expect = 1.330e-21
Identity = 63/170 (37.06%), Postives = 92/170 (54.12%), Query Frame = 1
Query:  562 KKCFIIDLDETLVHSSFKFVKTANI------NVNVDIDGVQHEVF--VCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTK-VFESRLFREACA------FKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDL 1026
            +K  ++DLDETL+H+    V    +      +  + I   +H V   V KRP+VD FL  +   ++ V+FTAS  +Y   VT+ LD  + + + R FR+ C+      F    Y K+L  +  D  S+ ILDNSP SY  +P NA+ I SWF D +DTAL +L+P    L
Sbjct:   64 RKTLVLDLDETLIHTHHDGVVRQTVRPGTQPDFTMRIISDRHPVLFSVFKRPHVDFFLDCVSQWYDLVIFTASTEEYGAAVTDHLDNNRGILKRRYFRQHCSLEFCYNFAYKFYTKNLSSVCDDPTSVFILDNSPDSYKNNPDNAIAIKSWFADPSDTALLNLLPMLDAL 233          
BLAST of CTD small phosphatase protein vs. Ensembl Nematostella
Match: EDO35587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL29])

HSP 1 Score: 89.3521 bits (220), Expect = 2.580e-20
Identity = 45/117 (38.46%), Postives = 72/117 (61.54%), Query Frame = 1
Query:  685 KRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASS 1035
            KRP V+ FL +L  LFE V+FT  +G  A PV + +DP ++   RLFR+A  +  G +VKDL  + RD+  +I++D +  +  L+ +NA+ +  W  +  DT L DL+P  + +A+S
Sbjct:   49 KRPGVEFFLNQLAPLFEIVVFTHEVGFSASPVIDGIDPHQMIMYRLFRDATKYIKGTHVKDLSGINRDLKKVIVIDCNKAATELNERNAIILKKWEGNPADTTLVDLLPLLQTIATS 165          
BLAST of CTD small phosphatase protein vs. Ensembl Medaka
Match: ctdsplb (CTD small phosphatase-like protein [Source:NCBI gene;Acc:101163607])

HSP 1 Score: 228.024 bits (580), Expect = 1.175e-69
Identity = 109/199 (54.77%), Postives = 140/199 (70.35%), Query Frame = 1
Query:  433 TNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            T+ +P    E+ S    D     P      + LLP+ +  +  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL ++G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR++N++II+DNSP SY+ HP+NAV + SWFDD NDT L DL+P+F+ L+
Sbjct:   61 TSSTPPPVEENGSPPKCDQVEVLPVPSPPAKYLLPETTTTDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELFECVLFTASLAKYADPVADLLDQWGVFRARLFRESCVFHRGNYVKDLSRLGRELNNVIIVDNSPASYIFHPENAVPVQSWFDDMNDTELLDLLPFFEGLS 259          
BLAST of CTD small phosphatase protein vs. Ensembl Medaka
Match: ctdsplb (CTD small phosphatase-like protein [Source:NCBI gene;Acc:101163607])

HSP 1 Score: 224.557 bits (571), Expect = 9.891e-69
Identity = 103/167 (61.68%), Postives = 130/167 (77.84%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            LLP+ +  +  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL ++G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR++N++II+DNSP SY+ HP+NAV + SWFDD NDT L DL+P+F+ L+
Sbjct:   61 LLPETTTTDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELFECVLFTASLAKYADPVADLLDQWGVFRARLFRESCVFHRGNYVKDLSRLGRELNNVIIVDNSPASYIFHPENAVPVQSWFDDMNDTELLDLLPFFEGLS 227          
BLAST of CTD small phosphatase protein vs. Ensembl Medaka
Match: ctdsplb (CTD small phosphatase-like protein [Source:NCBI gene;Acc:101163607])

HSP 1 Score: 224.942 bits (572), Expect = 1.478e-68
Identity = 103/167 (61.68%), Postives = 130/167 (77.84%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
            LLP+ +  +  KKC +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL ++G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR++N++II+DNSP SY+ HP+NAV + SWFDD NDT L DL+P+F+ L+
Sbjct:   82 LLPETTTTDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELFECVLFTASLAKYADPVADLLDQWGVFRARLFRESCVFHRGNYVKDLSRLGRELNNVIIVDNSPASYIFHPENAVPVQSWFDDMNDTELLDLLPFFEGLS 248          
BLAST of CTD small phosphatase protein vs. Ensembl Medaka
Match: ctdspla (CTD small phosphatase like [Source:NCBI gene;Acc:101167497])

HSP 1 Score: 223.787 bits (569), Expect = 3.395e-68
Identity = 111/208 (53.37%), Postives = 142/208 (68.27%), Query Frame = 1
Query:  406 AQPLSASNETNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLA 1029
             +P S +N+T   P    E+ S    D     P     ++ LLP++S  + +K C +IDLDETLVHSSFK +  A+  V V+IDG  H+V+V KRP+VDEFL ++G LFECVLFTASL KYADPV + LD   VF +RLFRE+C F  GNYVKDL  LGR ++ +II+DNSP SY+ HP+NAV + SWFDD  DT L DLIP F+ L+
Sbjct:   41 VEPPSTNNKTLSLPPPPEENGSPPKCDHIQTIPITCPPDKFLLPEVSIADYDKNCVVIDLDETLVHSSFKPISNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELFECVLFTASLAKYADPVADLLDQWGVFRARLFRESCVFHRGNYVKDLSRLGRKLSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPLFEGLS 248          
BLAST of CTD small phosphatase protein vs. Ensembl Medaka
Match: ctdsp2 (CTD small phosphatase 2 [Source:NCBI gene;Acc:101168784])

HSP 1 Score: 218.009 bits (554), Expect = 5.464e-66
Identity = 100/169 (59.17%), Postives = 128/169 (75.74%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASS 1035
            LLP+++  +Q K C +IDLDETLVHSSFK +  A+  V V+I+G  H+V+V KRPYVD+FL  +G LFECVLFTASL KYADPVT+ LD   VF +RLFRE+C F  G YVKDL  LGRD++  +ILDNSP SY+ HP NAV +VSWFDD +D  L +L+P F++L+ +
Sbjct:   79 LLPEVNAQDQGKICVVIDLDETLVHSSFKPISNADFIVPVEIEGTTHQVYVLKRPYVDKFLRRMGELFECVLFTASLAKYADPVTDLLDQCGVFRARLFRESCVFHQGCYVKDLSRLGRDLHKTLILDNSPASYIFHPNNAVPVVSWFDDVDDAELLNLLPVFEELSQA 247          
BLAST of CTD small phosphatase protein vs. Planmine SMEST
Match: SMESG000036352.1 (SMESG000036352.1)

HSP 1 Score: 897.116 bits (2317), Expect = 0.000e+0
Identity = 515/516 (99.81%), Postives = 515/516 (99.81%), Query Frame = 1
Query:   37 MLNSQSNPKGDGSNSAINESFSISNKPVXXXXXXXXXXXXXASRKYGISNLFRNLVCCSCFSSDHSSQKYKVPSSDHPLSPKDGXXXXXXXXXXXXXXXXALIDNGKAKSVDTIINSTTGSSIAQPLSASNETNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQNKPPESAGILGYPPSNLHWILMQTLSVSEAIVIYQQRLRESYHASGSSNVSRQSSTRGGSSDSHELHVPHHGLITQAIKANRRKSLACQEDESNRXXXXXXXXXXXXDLHLXXXXXXXXXXXXXVSMXXXXXXXXXXVDPSYQETANTTCDLVGTRLIYHSNDSKEDPVASDN 1584
            MLNSQSNPKGDGSNSAINESFSISNKPVINNIDNSDDKKNDASRKYGISNLFRNLVCCSCFSSDHSSQKYKVPSSDHPLSPKDGKIKKKYK ENTNTNKYALIDNGKAKSVDTIINSTTGSSIAQPLSASNETNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQNKPPESAGILGYPPSNLHWILMQTLSVSEAIVIYQQRLRESYHASGSSNVSRQSSTRGGSSDSHELHVPHHGLITQAIKANRRKSLACQEDESNRPPVSSPVAKPSSDLHLDDDDDGEDDDEDDVSMGEGEHGGNGGVDPSYQETANTTCDLVGTRLIYHSNDSKEDPVASDN
Sbjct:    1 MLNSQSNPKGDGSNSAINESFSISNKPVINNIDNSDDKKNDASRKYGISNLFRNLVCCSCFSSDHSSQKYKVPSSDHPLSPKDGKIKKKYKNENTNTNKYALIDNGKAKSVDTIINSTTGSSIAQPLSASNETNLSPNETNEDNSFKNSDSYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQNKPPESAGILGYPPSNLHWILMQTLSVSEAIVIYQQRLRESYHASGSSNVSRQSSTRGGSSDSHELHVPHHGLITQAIKANRRKSLACQEDESNRPPVSSPVAKPSSDLHLDDDDDGEDDDEDDVSMGEGEHGGNGGVDPSYQETANTTCDLVGTRLIYHSNDSKEDPVASDN 516          
BLAST of CTD small phosphatase protein vs. Planmine SMEST
Match: SMESG000043925.1 (SMESG000043925.1)

HSP 1 Score: 259.225 bits (661), Expect = 1.797e-76
Identity = 133/243 (54.73%), Postives = 160/243 (65.84%), Query Frame = 1
Query:  529 LLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQNKPPESAGILGYPPSNLHWILMQTLSVSEAIVIYQQRLRESYHASGSSNVSRQSSTRGGSSDSH 1257
            LL  +   +Q KKCFIIDLDETLVHSSFK V+ A+  V VDI+G  H V+V KRPYVD FL  +G +FECVLFTASL KYADPVT+FLD  +VF  RLFRE+C F  GNYVKDL +LGR  + + ILDNSP SY+ HP NAVQI SWFDD  DTAL DLIPYF+ LA++P SVP +L   KPP+ A +       +  +L    S+S   V   Q L+   H S S   S +      S+D H
Sbjct:  301 LLGTVKPADQGKKCFIIDLDETLVHSSFKMVEKADFKVGVDIEGTVHTVYVLKRPYVDVFLQRMGRIFECVLFTASLAKYADPVTDFLDKWRVFRWRLFRESCVFHRGNYVKDLSMLGRQADQVAILDNSPASYMFHPDNAVQITSWFDDPRDTALLDLIPYFEQLAAAP-SVPPFLASVKPPQRATV------PISVMLATPTSISLQPVSPHQ-LQNQQHTSSSPITSVEPCVVASSADHH 535          
BLAST of CTD small phosphatase protein vs. Planmine SMEST
Match: SMESG000001038.1 (SMESG000001038.1)

HSP 1 Score: 224.172 bits (570), Expect = 1.099e-64
Identity = 105/193 (54.40%), Postives = 142/193 (73.58%), Query Frame = 1
Query:  514 SENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQNKPPESAGI 1092
            S ++ LL  +   +++KKC +IDLDETLVHSSFK +   +  ++V+IDG  HE+++ KRPYVD FL ++ +LFECVLFTASL KYA+PV + LD + VF  RLFRE+C F  G +VKDL +LGR ++ I+I+DNSPVS++LHP+NA+QI SWFDD  D AL DLIPY + LA S  SV  +L+ + PP +A  
Sbjct:  210 SNSKYLLGPVKIEDKSKKCCVIDLDETLVHSSFKELMKYDFKISVEIDGDMHEIYILKRPYVDLFLTKMRSLFECVLFTASLAKYANPVADLLDKSDVFRYRLFRESCIFMKGGFVKDLSMLGRTLDQIVIIDNSPVSFMLHPQNAIQITSWFDDLKDRALLDLIPYLQKLAQST-SVTNYLKTDTPPITAAF 401          
BLAST of CTD small phosphatase protein vs. Planmine SMEST
Match: SMESG000043921.1 (SMESG000043921.1)

HSP 1 Score: 217.624 bits (553), Expect = 3.318e-64
Identity = 112/214 (52.34%), Postives = 137/214 (64.02%), Query Frame = 1
Query:  616 FVKTANINVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQNKPPESAGILGYPPSNLHWILMQTLSVSEAIVIYQQRLRESYHASGSSNVSRQSSTRGGSSDSH 1257
             V+ A+  V VDI+G  H V+V KRPYVD FL  +G +FECVLFTASL KYADPVT+FLD  +VF  RLFRE+C F  GNYVKDL +LGR  + + ILDNSP SY+ HP NAVQI SWFDD  DTAL DLIPYF+ LA++P SVP +L   KPP+ A +       +  +L    S+S   V   Q L+   H S S   S +      S+D H
Sbjct:    1 MVEKADFKVGVDIEGTVHTVYVLKRPYVDVFLQRMGRIFECVLFTASLAKYADPVTDFLDKWRVFRWRLFRESCVFHRGNYVKDLSMLGRQADQVAILDNSPASYMFHPDNAVQITSWFDDPRDTALLDLIPYFEQLAAAP-SVPPFLASVKPPQRATV------PISVMLATPTSISLQPVSPHQ-LQNQQHTSSSPITSVEPCVVASSADHH 206          
BLAST of CTD small phosphatase protein vs. Planmine SMEST
Match: SMESG000022866.1 (SMESG000022866.1)

HSP 1 Score: 102.834 bits (255), Expect = 1.733e-24
Identity = 60/160 (37.50%), Postives = 90/160 (56.25%), Query Frame = 1
Query:  559 NKKCFIIDLDETLVHSSFKFVKTANIN--------VNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTNFLDPTK-VFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLLHPKNAVQIVSWFDDQNDTALRDLIP 1011
             +K  ++DLDETL+HS    +    +         + V+ID      FV KRP+VD FL  +   F+ V++TASL  Y   V++ LD  + + + R +R+ C   + +Y KDL  +  ++ SI ILDNSP +Y  +P NA+ I SWF D  DT L +L+P
Sbjct:   53 RRKILVLDLDETLIHSVLDGMVRPTVKPGTPPDFVLRVEIDRHPVRFFVHKRPHVDYFLDIVSQWFDLVVYTASLELYGAAVSDKLDSGRDILKKRYYRQHCHCANNSYSKDLFPICTELQSIFILDNSPGAYRDYPDNAIPIKSWFSDPKDTELLNLLP 212          
The following BLAST results are available for this feature:
BLAST of CTD small phosphatase protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTDSP22.644e-6759.76CTD small phosphatase 2 [Source:HGNC Symbol;Acc:HG... [more]
CTDSPL3.466e-6755.26CTD small phosphatase like [Source:HGNC Symbol;Acc... [more]
CTDSPL3.597e-6661.08CTD small phosphatase like [Source:HGNC Symbol;Acc... [more]
CTDSP15.842e-6659.17CTD small phosphatase 1 [Source:HGNC Symbol;Acc:HG... [more]
CTDSP16.491e-6659.17CTD small phosphatase 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of CTD small phosphatase protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scpl-14.177e-6562.03CTD small phosphatase-like protein 1 [Source:UniP... [more]
scpl-15.166e-6561.64CTD small phosphatase-like protein 1 [Source:UniP... [more]
scpl-12.439e-6462.82CTD small phosphatase-like protein 1 [Source:UniP... [more]
scpl-36.085e-3039.52CTD small phosphatase-like protein 3 [Source:UniP... [more]
scpl-31.868e-2939.52CTD small phosphatase-like protein 3 [Source:UniP... [more]
back to top
BLAST of CTD small phosphatase protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG58302.798e-6557.31gene:FBgn0036556 transcript:FBtr0075521[more]
CG58305.587e-6557.31gene:FBgn0036556 transcript:FBtr0333579[more]
Dd4.766e-2638.79gene:FBgn0029067 transcript:FBtr0339623[more]
Dd6.190e-2638.79gene:FBgn0029067 transcript:FBtr0077226[more]
CG85847.215e-2234.30gene:FBgn0033322 transcript:FBtr0088724[more]
back to top
BLAST of CTD small phosphatase protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctdspla4.536e-6952.40CTD (carboxy-terminal domain, RNA polymerase II, p... [more]
ctdsp26.831e-6856.99CTD (carboxy-terminal domain, RNA polymerase II, p... [more]
ctdsp26.831e-6856.99CTD (carboxy-terminal domain, RNA polymerase II, p... [more]
ctdsp11.455e-6761.68CTD (carboxy-terminal domain, RNA polymerase II, p... [more]
ctdsplb2.016e-6761.08CTD (carboxy-terminal domain, RNA polymerase II, p... [more]
back to top
BLAST of CTD small phosphatase protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
poln1.963e-6860.95polymerase (DNA directed) nu [Source:Xenbase;Acc:X... [more]
poln3.385e-6852.07polymerase (DNA directed) nu [Source:Xenbase;Acc:X... [more]
tada18.986e-6852.86transcriptional adaptor 1 [Source:Xenbase;Acc:XB-G... [more]
tada11.143e-6751.92transcriptional adaptor 1 [Source:Xenbase;Acc:XB-G... [more]
tada16.324e-6761.68transcriptional adaptor 1 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of CTD small phosphatase protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ctdsp25.747e-6953.30CTD (carboxy-terminal domain, RNA polymerase II, p... [more]
Ctdspl6.172e-6952.97CTD (carboxy-terminal domain, RNA polymerase II, p... [more]
Ctdspl1.171e-6661.08CTD (carboxy-terminal domain, RNA polymerase II, p... [more]
Ctdsp14.948e-6659.17CTD (carboxy-terminal domain, RNA polymerase II, p... [more]
Ctdsp28.650e-4263.21CTD (carboxy-terminal domain, RNA polymerase II, p... [more]
back to top
BLAST of CTD small phosphatase protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9PTJ6|CTDSL_CHICK1.277e-6953.69CTD small phosphatase-like protein OS=Gallus gallu... [more]
sp|Q8BX07|CTDS2_MOUSE4.020e-6853.30Carboxy-terminal domain RNA polymerase II polypept... [more]
sp|P58465|CTDSL_MOUSE4.317e-6852.97CTD small phosphatase-like protein OS=Mus musculus... [more]
sp|O14595|CTDS2_HUMAN1.270e-6659.76Carboxy-terminal domain RNA polymerase II polypept... [more]
sp|O15194|CTDSL_HUMAN1.665e-6655.26CTD small phosphatase-like protein OS=Homo sapiens... [more]
back to top
BLAST of CTD small phosphatase protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J9E69.281e-7161.05CTD small phosphatase-like protein OS=Schistocepha... [more]
A0A504YMQ01.159e-7059.31CTD small phosphatase protein OS=Fasciola gigantic... [more]
A0A4S2MM951.586e-7060.41FCP1 homology domain-containing protein OS=Opistho... [more]
A0A5J4NH363.196e-7059.22Carboxy-terminal domain RNA polymerase II polypept... [more]
A0A074Z6832.183e-6962.11FCP1 homology domain-containing protein OS=Opistho... [more]
back to top
BLAST of CTD small phosphatase protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctdspla3.453e-6852.88CTD (carboxy-terminal domain, RNA polymerase II, p... [more]
ctdsplb3.762e-6852.43CTD small phosphatase-like protein [Source:NCBI ge... [more]
ctdsplb3.854e-6852.43CTD small phosphatase-like protein [Source:NCBI ge... [more]
ctdsp13.246e-6761.08carboxy-terminal domain RNA polymerase II polypept... [more]
ctdsplb8.360e-6761.08CTD small phosphatase-like protein [Source:NCBI ge... [more]
back to top
BLAST of CTD small phosphatase protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctdsp23.351e-6952.53CTD (carboxy-terminal domain, RNA polymerase II, p... [more]
ENSPMAT00000003894.17.870e-6758.76pep scaffold:Pmarinus_7.0:GL482776:1891:9390:1 gen... [more]
ENSPMAT00000005899.13.332e-5561.31pep scaffold:Pmarinus_7.0:GL476522:358859:362945:1... [more]
ENSPMAT00000001121.19.012e-4035.69pep scaffold:Pmarinus_7.0:GL485372:3962:9133:1 gen... [more]
ENSPMAT00000010797.12.446e-3840.29pep scaffold:Pmarinus_7.0:GL476346:608242:622413:1... [more]
back to top
BLAST of CTD small phosphatase protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
PSR11.283e-5653.29Plasma membrane associated protein phosphatase; in... [more]
PSR29.675e-5448.08Plasma membrane phosphatase involved in the genera... [more]
NEM14.864e-3436.18Probable catalytic subunit of Nem1p-Spo7p phosphat... [more]
TIM506.200e-2335.90Essential component of the TIM23 complex; acts as ... [more]
back to top
BLAST of CTD small phosphatase protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO494274.050e-6656.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482065.979e-3741.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331731.330e-2137.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355872.580e-2038.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CTD small phosphatase protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctdsplb1.175e-6954.77CTD small phosphatase-like protein [Source:NCBI ge... [more]
ctdsplb9.891e-6961.68CTD small phosphatase-like protein [Source:NCBI ge... [more]
ctdsplb1.478e-6861.68CTD small phosphatase-like protein [Source:NCBI ge... [more]
ctdspla3.395e-6853.37CTD small phosphatase like [Source:NCBI gene;Acc:1... [more]
ctdsp25.464e-6659.17CTD small phosphatase 2 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of CTD small phosphatase protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036352.10.000e+099.81SMESG000036352.1[more]
SMESG000043925.11.797e-7654.73SMESG000043925.1[more]
SMESG000001038.11.099e-6454.40SMESG000001038.1[more]
SMESG000043921.13.318e-6452.34SMESG000043921.1[more]
SMESG000022866.11.733e-2437.50SMESG000022866.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007070 ID=SMED30007070|Name=CTD small phosphatase protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1908bp
AATCTATATAAATCTTATATGTAAGCAAACTCAAAAATGCTAAATAGCCA
ATCTAACCCAAAAGGAGATGGGTCTAATTCGGCTATTAATGAATCATTTT
CTATATCTAATAAACCAGTTATTAATAACATTGATAATTCCGACGATAAG
AAAAACGATGCGTCTAGAAAATATGGAATCAGCAATTTGTTCAGAAATCT
AGTTTGCTGTTCATGTTTTTCATCTGATCACAGTTCTCAGAAGTATAAAG
TTCCGTCAAGTGATCATCCATTATCACCAAAAGATGGGAAAATAAAAAAA
AAGTATAAAATTGAAAATACTAACACAAATAAATACGCTTTAATTGATAA
TGGAAAAGCGAAATCTGTAGATACAATTATTAATAGCACAACAGGCTCAT
CAATTGCTCAACCTTTAAGTGCCTCTAATGAAACAAATTTATCTCCAAAT
GAAACAAATGAAGACAACAGTTTCAAAAATTCTGATAGCTACCATTTTTT
CCCAAAAAATATTTCAGAGAATGAAAAACTACTACCGAAATTGTCAGAAA
ATAATCAGAATAAGAAATGTTTCATTATTGATCTAGATGAAACATTAGTT
CATAGTTCATTTAAATTCGTGAAAACAGCGAATATCAATGTTAATGTAGA
TATCGACGGTGTTCAACATGAGGTTTTTGTCTGTAAACGGCCTTATGTCG
ATGAGTTTTTGGCAGAATTGGGCAATCTTTTTGAATGTGTTCTATTTACC
GCCAGTCTAGGAAAATATGCTGATCCTGTTACAAATTTCCTTGACCCAAC
TAAAGTTTTCGAATCCAGATTATTCAGAGAAGCATGTGCCTTCAAAGATG
GCAATTATGTCAAAGATCTCGATATATTAGGCCGAGATATCAATAGTATT
ATTATATTAGACAACTCACCCGTTTCTTACCTTCTTCATCCGAAAAATGC
AGTTCAAATTGTCTCGTGGTTTGATGATCAAAATGATACCGCGTTAAGAG
ATTTAATACCATATTTTAAAGATTTAGCCAGTAGCCCTCTTTCGGTCCCA
GAATGGTTAGAGCAAAATAAACCACCGGAATCCGCTGGTATTCTCGGATA
TCCTCCATCAAATCTTCATTGGATTTTAATGCAAACTCTGTCCGTTTCAG
AAGCTATTGTGATTTATCAACAACGATTGCGTGAGTCCTATCATGCCAGT
GGTAGTAGTAATGTCAGTCGTCAAAGTTCCACTCGCGGTGGCTCTAGTGA
TTCTCATGAGTTGCATGTACCGCATCACGGGCTTATTACACAGGCCATTA
AAGCCAATCGCCGGAAATCCCTTGCCTGTCAAGAAGATGAATCGAATCGA
CCTCCTGTCAGTAGTCCAGTTGCCAAACCGTCATCAGATTTACATCTCGA
TGATGATGACGACGGCGAAGATGATGATGAAGATGATGTTTCTATGGGAG
AAGGCGAGCATGGCGGTAACGGTGGTGTTGACCCATCATATCAGGAAACC
GCCAACACCACTTGTGACTTAGTGGGAACTCGATTAATTTATCATTCCAA
TGATTCTAAAGAGGACCCAGTTGCCTCAGACAATTGATTGAAATATATAT
TTATATAAATATAGATGGAATTATTATCACAATAATCGTCAATATACCTT
TGCACATTCAGAGCAAGAACGCGGCCGCACATTTGCTACGTGCCATAAGC
ATTATCTATGTCTAGAGTGCTTCCTTTACTTGATGCTATAATATTGATGC
TATCTCGCAATTCTATTTTATTATTAATTTTAATATTATTATTAAATAAT
TGGATTTTTCATTGCTTGTGTGATTGATTGTTCTGCAAATTTTGAATGAT
GTAGGTAATAATCCGCTAATTTTATGTAATTAGTTTTCATTGATAGTGGA
AACCATGG
back to top

protein sequence of SMED30007070-orf-1

>SMED30007070-orf-1 ID=SMED30007070-orf-1|Name=SMED30007070-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=517bp
MLNSQSNPKGDGSNSAINESFSISNKPVINNIDNSDDKKNDASRKYGISN
LFRNLVCCSCFSSDHSSQKYKVPSSDHPLSPKDGKIKKKYKIENTNTNKY
ALIDNGKAKSVDTIINSTTGSSIAQPLSASNETNLSPNETNEDNSFKNSD
SYHFFPKNISENEKLLPKLSENNQNKKCFIIDLDETLVHSSFKFVKTANI
NVNVDIDGVQHEVFVCKRPYVDEFLAELGNLFECVLFTASLGKYADPVTN
FLDPTKVFESRLFREACAFKDGNYVKDLDILGRDINSIIILDNSPVSYLL
HPKNAVQIVSWFDDQNDTALRDLIPYFKDLASSPLSVPEWLEQNKPPESA
GILGYPPSNLHWILMQTLSVSEAIVIYQQRLRESYHASGSSNVSRQSSTR
GGSSDSHELHVPHHGLITQAIKANRRKSLACQEDESNRPPVSSPVAKPSS
DLHLDDDDDGEDDDEDDVSMGEGEHGGNGGVDPSYQETANTTCDLVGTRL
IYHSNDSKEDPVASDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011948Dullard_phosphatase
IPR036412HAD-like_sf
IPR004274FCP1_dom
IPR023214HAD_sf
Vocabulary: biological process
TermDefinition
GO:0016311dephosphorylation
Vocabulary: molecular function
TermDefinition
GO:0016791phosphatase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004274FCP1 homology domainSMARTSM00577forpap2coord: 175..318
e-value: 1.3E-63
score: 227.3
IPR004274FCP1 homology domainPFAMPF03031NIFcoord: 177..332
e-value: 8.1E-49
score: 165.4
IPR004274FCP1 homology domainPROSITEPS50969FCP1coord: 172..330
score: 43.665
IPR011948Dullard phosphatase domain, eukaryoticTIGRFAMTIGR02251TIGR02251coord: 176..331
e-value: 6.1E-55
score: 183.5
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 161..345
e-value: 3.8E-66
score: 223.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 386..411
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 428..492
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 386..405
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 455..470
NoneNo IPR availablePANTHERPTHR12210NUCLEAR LIM INTERACTOR-INTERACTING FACTOR-RELATEDcoord: 124..332
NoneNo IPR availablePANTHERPTHR12210:SF50CARBOXY-TERMINAL DOMAIN RNA POLYMERASE II POLYPEPTIDE A SMALL PHOSPHATASE 2coord: 124..332
NoneNo IPR availableCDDcd07521HAD_FCP1-likecoord: 176..308
e-value: 9.92966E-54
score: 175.862
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 164..332