A-kinase anchor protein 14-like

Overview
NameA-kinase anchor protein 14-like
Smed IDSMED30007064
Length (bp)1103
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of A-kinase anchor protein 14-like (SMED30007064) t-SNE clustered cells

Violin plots show distribution of expression levels for A-kinase anchor protein 14-like (SMED30007064) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of A-kinase anchor protein 14-like (SMED30007064) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for A-kinase anchor protein 14-like (SMED30007064) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007064

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007064SMESG000061885.1 SmedASXL_009046SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30007064SMESG000061885.1 dd_Smed_v4_9117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30007064SMESG000061885.1 dd_Smed_v6_9117_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007064SMESG000061885.1 dd_Smed_v4_9117_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of A-kinase anchor protein 14-like vs. Ensembl Human
Match: AKAP14 (A-kinase anchoring protein 14 [Source:HGNC Symbol;Acc:HGNC:24061])

HSP 1 Score: 78.9518 bits (193), Expect = 1.293e-16
Identity = 53/189 (28.04%), Postives = 87/189 (46.03%), Query Frame = 3
Query:  402 NIQISGQYDSSEQEAFLLVDKALNNAIRRLEDESKENLNKIDGNSKNQKLHLANEKISVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF 968
            N Q     D   Q A  LV+  +N A++ +E+E                      +  + NI+W +   FT + G ++I+E+       + W H ++++   +      + Y V +SI T+  P+   SA  YFT+  SK KPP   + V YV +   L+HRPG   F E W + + D KY+ ++ F F
Sbjct:   26 NTQDKNYEDELTQVALALVEDVINYAVKIVEEE----------------------RNPLKNIKWMTHGEFTVEKGLKQIDEYFSKCVSKKCWAHGVEFVERKDLIHSFLYIYYVHWSISTADLPVARISAGTYFTMKVSKTKPPDAPIVVSYVGDHQALVHRPGMVRFRENWQKNLTDAKYSFMESFPF 192          
BLAST of A-kinase anchor protein 14-like vs. Ensembl Zebrafish
Match: si:dkeyp-81f3.4 (si:dkeyp-81f3.4 [Source:ZFIN;Acc:ZDB-GENE-160113-129])

HSP 1 Score: 98.9821 bits (245), Expect = 1.619e-24
Identity = 52/138 (37.68%), Postives = 79/138 (57.25%), Query Frame = 3
Query:  558 ANEKISVANIQWPSIATFTEQLGERKINEFVILWRLGE-DWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF 968
            AN    + NI W S   FT ++GE++I +++  W +    WL+ + +L   E  F  +++Y V++SIPT   PIP A+  VYF I  SKIKP    V+V +++ES+   H PG+  F E WL  +I+ K  L+   DF
Sbjct:   19 ANAACQIKNIDWISCKDFTIEIGEQQIRQYMATWEIQHPGWLYSLTFLQQAELEFKTQYQYEVQWSIPTRFTPIPRATTRVYFIIEISKIKPDSLPVNVHFIIESNRSKHVPGQMRFREKWLMDVIESKTLLLDTVDF 156          
BLAST of A-kinase anchor protein 14-like vs. Ensembl Xenopus
Match: AKAP14 (A-kinase anchoring protein 14 [Source:NCBI gene;Acc:100491740])

HSP 1 Score: 124.79 bits (312), Expect = 7.249e-34
Identity = 60/131 (45.80%), Postives = 81/131 (61.83%), Query Frame = 3
Query:  564 EKISVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIK 956
            EK    NI W     FT +LG ++I E++  W   E WLHC D+L   E  F K + YR R+SIPT R PIP A+A VYFTI  SK+KP    V+V ++ ES+ L+HRPG+  F E WL+ II+ K  +++
Sbjct:   42 EKYIAQNITWIPCQDFTIELGMKQIEEYISTWEFHESWLHCTDFLNEEEVEFSKLYHYRTRWSIPTRRKPIPRATACVYFTIQISKVKPLSLPVEVFFIFESTRLVHRPGQSRFREKWLKDIIESKLIMME 172          
BLAST of A-kinase anchor protein 14-like vs. Ensembl Mouse
Match: Akap14 (A kinase (PRKA) anchor protein 14 [Source:MGI Symbol;Acc:MGI:3618288])

HSP 1 Score: 91.6633 bits (226), Expect = 7.930e-20
Identity = 48/131 (36.64%), Postives = 73/131 (55.73%), Query Frame = 3
Query:  576 VANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF 968
            + NI+W +   FT + G ++I +FV  W     W++  D++   +      + YRVR+S PT+  P+   SA+  FTI  +K KP    VDV Y+ E+S L+ RPGE  F E WLR I + K+ L++   F
Sbjct:  403 IKNIKWLTHGEFTPEKGRKQIEKFVSTWEFQNRWVYYADFIEKKDLIHSYHYIYRVRWSAPTAVRPMARVSANALFTIKFNKSKPADMPVDVSYIFENSELLQRPGEIRFREQWLRDITETKHILLESIPF 533          
BLAST of A-kinase anchor protein 14-like vs. UniProt/SwissProt
Match: sp|O35817|AKA14_RAT (A-kinase anchor protein 14 OS=Rattus norvegicus OX=10116 GN=Akap14 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.739e-19
Identity = 48/132 (36.36%), Postives = 74/132 (56.06%), Query Frame = 3
Query:  573 SVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF 968
             + NI+W +   FT + G ++I +FV  W     W++  D++   +      + YRVR+S PT+  P+   SA+ YFTI  +K KP    VDV Y+ E+S L+ RPG+  F E WLR I + K+ L++   F
Sbjct:  368 PIKNIKWLTHGEFTAEKGRKQIEKFVSTWEFQNRWVYYADFIEKKDLIHSFHYIYRVRWSAPTAVRPMARVSANAYFTIKFNKSKPADMPVDVSYIFENSELLQRPGKIRFREQWLRDITETKHILLESIPF 499          
BLAST of A-kinase anchor protein 14-like vs. UniProt/SwissProt
Match: sp|Q86UN6|AKA28_HUMAN (A-kinase anchor protein 14 OS=Homo sapiens OX=9606 GN=AKAP14 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 6.211e-16
Identity = 53/189 (28.04%), Postives = 87/189 (46.03%), Query Frame = 3
Query:  402 NIQISGQYDSSEQEAFLLVDKALNNAIRRLEDESKENLNKIDGNSKNQKLHLANEKISVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF 968
            N Q     D   Q A  LV+  +N A++ +E+E                      +  + NI+W +   FT + G ++I+E+       + W H ++++   +      + Y V +SI T+  P+   SA  YFT+  SK KPP   + V YV +   L+HRPG   F E W + + D KY+ ++ F F
Sbjct:   26 NTQDKNYEDELTQVALALVEDVINYAVKIVEEE----------------------RNPLKNIKWMTHGEFTVEKGLKQIDEYFSKCVSKKCWAHGVEFVERKDLIHSFLYIYYVHWSISTADLPVARISAGTYFTMKVSKTKPPDAPIVVSYVGDHQALVHRPGMVRFRENWQKNLTDAKYSFMESFPF 192          
BLAST of A-kinase anchor protein 14-like vs. TrEMBL
Match: A0A1S3JM59 (A-kinase anchor protein 14-like OS=Lingula unguis OX=7574 GN=LOC106174440 PE=4 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 7.359e-43
Identity = 89/186 (47.85%), Postives = 119/186 (63.98%), Query Frame = 3
Query:  426 DSSEQEAFL---LVDKALNNAIRRLEDESKENLNKIDGNSKNQKLHLAN--EKISVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF 968
            D+ EQ A +   LVD+ LN+A+++LE    E+L + D + +   L L N  E   V NI+W +I  FT Q GE KIN+F+  W     WL+CID+L   +  FDKR RYRVR+SIPT R PIP A+ASVYFT V SKIKP    VDV YV E++ L+H PG+  F E WL+ II++K  +++  DF
Sbjct:    2 DTGEQYAEVAHELVDQVLNSAVKKLE---SEHLLERDTSRQTTLLSLENLREDYQVKNIEWLTIEEFTIQKGEDKINDFLKTWDYEGAWLYCIDFLQEDDFEFDKRFRYRVRWSIPTRRKPIPRATASVYFTFVVSKIKPKTYPVDVYYVFETNRLVHIPGQSRFREKWLKDIIENKVLMLQAIDF 184          
BLAST of A-kinase anchor protein 14-like vs. TrEMBL
Match: A0A504YDK4 (A-kinase anchor protein 14 OS=Fasciola gigantica OX=46835 GN=FGIG_00811 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 9.385e-40
Identity = 79/185 (42.70%), Postives = 105/185 (56.76%), Query Frame = 3
Query:  459 DKALNNAIRRLEDESKE------NLNK---------IDGNSKNQKLHLANEKISVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF 968
            + A  +AIR   D+  E      N  K         I   +  Q + L++E     NIQWP+I  FT +LG +KI E++  W + E WLHC D L   E  +D  HRYRVR+S+PT R PIP A+ S+YFTI  SKIKP +  V V Y VE+   +HRPG   FCE WLR +ID+K  L+ + +F
Sbjct:   61 EGAFGSAIRLFNDQQTETEADQSNFMKPNTYEPTEGIFNETGKQSIQLSDEIHPTPNIQWPTIGEFTPELGLKKIEEYIQGWNIDETWLHCTDILPTEEQPYDVNHRYRVRWSMPTRRSPIPGATVSIYFTIQVSKIKPKNLEVGVYYQVETFKTMHRPGMTRFCERWLRDVIDNKKRLMSYVNF 245          
BLAST of A-kinase anchor protein 14-like vs. TrEMBL
Match: A0A0B6Z8J2 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF51222 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.209e-39
Identity = 78/180 (43.33%), Postives = 115/180 (63.89%), Query Frame = 3
Query:  426 DSSEQEAFLLVDKALNNAIRRLE---DESKENLNKIDGNSKNQKLHLANEKI-SVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALI 953
            D    EA L+V+  ++ A RRLE    + +++   I   S ++++ L  E +  + NIQW SI  FT + G+ KI+EF+  W+    WL+C+D+L   +  FD+R+ YRVR+SIPT R PIP A+ASVYFT V SKI+P    V+V YV E++ LIH+PG+  F E+WL+ II+ K  +I
Sbjct:    3 DMYMTEAKLMVNGFIDMAFRRLETSMSDREKSFESIRQLSTSREITLRKEDMYEIENIQWLSIEEFTIERGQEKIHEFIKTWKYENSWLYCVDFLTVEDCEFDRRYFYRVRWSIPTRRRPIPRATASVYFTYVVSKIRPRTSPVEVFYVFETNRLIHQPGKSRFREMWLKDIIESKVKVI 182          
BLAST of A-kinase anchor protein 14-like vs. TrEMBL
Match: A0A3S1BFR0 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_012513 PE=4 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.045e-38
Identity = 77/178 (43.26%), Postives = 111/178 (62.36%), Query Frame = 3
Query:  441 EAFLLVDKALNNAIRRLEDESKENLNKIDGNSKNQKLHLANE-------KISVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALI 953
            EA  ++D  ++ A RRLE    +     +     ++LH++ E       K +V NI+W +I  FT + GE+KI+EF+  W+    WL+C+D+L   +  FDKR+ YRVR+SIPT R PIP A+ASVYFT V SKI+P    V+V Y+ E++ LIH+PG   F E+WL+ II+ K  LI
Sbjct:    9 EAKKMIDGFIDMAFRRLETSMSDREKSFESL---KQLHMSREHTIKKEDKYAVENIEWLTIDEFTIEKGEQKIHEFIKTWQYENSWLYCVDFLNEDDHEFDKRYMYRVRWSIPTRRKPIPRATASVYFTYVVSKIRPKSNPVEVFYIFETNRLIHKPGLSRFREMWLKDIIESKVKLI 183          
BLAST of A-kinase anchor protein 14-like vs. TrEMBL
Match: A0A210Q6P0 (A-kinase anchor protein 14 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT20510 PE=4 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 6.617e-38
Identity = 73/180 (40.56%), Postives = 113/180 (62.78%), Query Frame = 3
Query:  453 LVDKALNNAIRRLE-----DESKENLNKIDGNSK---NQKLHLANEKISVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF 968
            LVD+ +++AI+RLE     +E ++    I  +S+    Q   +  E   V +++W +I  FTE+  E+KI++F+  W+    W +CID+LG     +D R+R+RVR+SIPT R PIP A+A VYF+ V S IKP H  VDVL+V E + L+H+PG+  F E WL+ II+ K  +++  +F
Sbjct:   14 LVDEVIDHAIKRLETSLSLNEREKTFESIRISSEVNSRQSTFVKEENYEVKDVKWLTIDEFTEEKAEQKIHDFIKTWQYENSWQYCIDFLGEDPHDYDTRYRFRVRWSIPTRRKPIPRATACVYFSFVVSTIKPKHYPVDVLFVFEGNRLVHKPGQSRFREKWLKDIIESKVMMMQMVEF 193          
BLAST of A-kinase anchor protein 14-like vs. Ensembl Cavefish
Match: si:dkeyp-81f3.4 (si:dkeyp-81f3.4 [Source:ZFIN;Acc:ZDB-GENE-160113-129])

HSP 1 Score: 79.337 bits (194), Expect = 6.649e-17
Identity = 42/110 (38.18%), Postives = 60/110 (54.55%), Query Frame = 3
Query:  591 WPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWL 920
            W S   FT + G  +I +++  W +   W + I +L   E  F K+  YR  +  PTSR PIP ++A+VYF I A K + P   V+V + VES+  +H PG   F E WL
Sbjct:   79 WGSCRDFTVERGRARIEDYMRTWEIHPSWRYSISFLQERELDFQKQFLYRALWGRPTSRAPIPRSTAAVYFIITAPKTRDPALPVEVRFTVESNRTLHEPGRTRFREKWL 188          
BLAST of A-kinase anchor protein 14-like vs. Ensembl Nematostella
Match: EDO43483 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYL6])

HSP 1 Score: 128.257 bits (321), Expect = 1.502e-35
Identity = 68/177 (38.42%), Postives = 103/177 (58.19%), Query Frame = 3
Query:  426 DSSEQEAFLLVDKALNNAIRRLEDESKENLNKIDGNSKNQKLHL-ANEKISVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALI 953
            D  E EA  +VD+A++NA++RL       +       + +K  +  +   ++ N++W S  +FT   G  KI EF+  W     WL+CID+L   +  + KR+RY V++SIPT R PIP A+ASVYFT+  SK KP    V V ++ E+  L+HRPG+  F E WL+ II+ K  ++
Sbjct:   17 DVYESEAHQIVDEAIDNALKRLIGSDGIRVRGESAEPEEEKDDIDPDTGATIPNVKWMSAESFTVAGGLVKIEEFIKTWERDGSWLYCIDFLREEDHPYSKRYRYAVKWSIPTRRKPIPRATASVYFTLEVSKFKPTTFPVAVYFIFETHRLVHRPGKTKFREKWLKDIIESKIKMM 193          
BLAST of A-kinase anchor protein 14-like vs. Ensembl Medaka
Match: si:dkeyp-81f3.4 (si:dkeyp-81f3.4 [Source:ZFIN;Acc:ZDB-GENE-160113-129])

HSP 1 Score: 75.485 bits (184), Expect = 6.567e-16
Identity = 42/115 (36.52%), Postives = 62/115 (53.91%), Query Frame = 3
Query:  597 SIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHK 941
            S   FT + G+ +I   +  W +   W H +D+L   E        YR RFS PT+R PI   +ASV+F +  SK  P    ++V +VVES+ L++  G++ F E WL  +ID K
Sbjct:   48 SCEDFTVEFGKEQIETLIETWGVRSCWRHSLDFLYVTELEHCGVFHYRARFSAPTARQPIS-QTASVFFGVEVSKFAPRATPLEVHFVVESNRLVNTSGKHRFRETWLTDVIDSK 161          
BLAST of A-kinase anchor protein 14-like vs. Planmine SMEST
Match: SMESG000061885.1 (SMESG000061885.1)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 291/291 (100.00%), Postives = 291/291 (100.00%), Query Frame = 3
Query:   96 MSDKENVDNTQSRPDSEASSNKSEISKTAKSIVKSTIEMAINKINARVDLERENETLLYQTNMIDDITDEFKPNFKNVVITEELNNKMRSTTSILEDDFNDKNIQISGQYDSSEQEAFLLVDKALNNAIRRLEDESKENLNKIDGNSKNQKLHLANEKISVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF 968
            MSDKENVDNTQSRPDSEASSNKSEISKTAKSIVKSTIEMAINKINARVDLERENETLLYQTNMIDDITDEFKPNFKNVVITEELNNKMRSTTSILEDDFNDKNIQISGQYDSSEQEAFLLVDKALNNAIRRLEDESKENLNKIDGNSKNQKLHLANEKISVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF
Sbjct:    1 MSDKENVDNTQSRPDSEASSNKSEISKTAKSIVKSTIEMAINKINARVDLERENETLLYQTNMIDDITDEFKPNFKNVVITEELNNKMRSTTSILEDDFNDKNIQISGQYDSSEQEAFLLVDKALNNAIRRLEDESKENLNKIDGNSKNQKLHLANEKISVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF 291          
BLAST of A-kinase anchor protein 14-like vs. Planmine SMEST
Match: SMESG000061885.1 (SMESG000061885.1)

HSP 1 Score: 504.597 bits (1298), Expect = 0.000e+0
Identity = 254/291 (87.29%), Postives = 254/291 (87.29%), Query Frame = 3
Query:   96 MSDKENVDNTQSRPDSEASSNKSEISKTAKSIVKSTIEMAINKINARVDLERENETLLYQTNMIDDITDEFKPNFKNVVITEELNNKMRSTTSILEDDFNDKNIQISGQYDSSEQEAFLLVDKALNNAIRRLEDESKENLNKIDGNSKNQKLHLANEKISVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF 968
            MSDKENVDNTQSRPDSEASSNKSEISKTAKSIVKSTIEMAINKINARVDLE                                     RSTTSILEDDFNDKNIQISGQYDSSEQEAFLLVDKALNNAIRRLEDESKENLNKIDGNSKNQKLHLANEKISVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF
Sbjct:    1 MSDKENVDNTQSRPDSEASSNKSEISKTAKSIVKSTIEMAINKINARVDLE-------------------------------------RSTTSILEDDFNDKNIQISGQYDSSEQEAFLLVDKALNNAIRRLEDESKENLNKIDGNSKNQKLHLANEKISVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF 254          
BLAST of A-kinase anchor protein 14-like vs. Planmine SMEST
Match: SMESG000043586.1 (SMESG000043586.1)

HSP 1 Score: 122.479 bits (306), Expect = 5.519e-33
Identity = 62/199 (31.16%), Postives = 120/199 (60.30%), Query Frame = 3
Query:  399 KNIQISGQYDSSEQEAFLLVDKALNNAIRRLEDESKENLNKIDGNSK-NQKLHLANEK-------ISVANIQWPSIATFTEQLGERKINEFVI-LWRLGEDWLHCIDYLGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIVDVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF 968
            +++ I  QY++     + ++++++ +A   +E E++E+   +D N    QK ++ ++        + +  I WPS A FT +LGE KI +++   W+  + W  CIDY+G  E + +  ++Y+V +S PT R PIP+ + +VYF +  SK++P +  ++V + +ESS L+HRPG+ +F E WL+++I++K  +    +F
Sbjct:   16 QSVSIRNQYNT----CYDILNRSIASAAETIEKENEESRKLLDRNKLLTQKWNIGSKSFIHHSNMLLIPTIVWPSSAIFTPELGESKILDYITKTWQYDKCWKFCIDYMGLEEDKKEINYKYKVLWSQPTIRKPIPLLTVAVYFNLYTSKVRPQNEPINVTFTIESSCLVHRPGQTVFREHWLKQVIENKAKIRSLVNF 210          
The following BLAST results are available for this feature:
BLAST of A-kinase anchor protein 14-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
AKAP141.293e-1628.04A-kinase anchoring protein 14 [Source:HGNC Symbol;... [more]
back to top
BLAST of A-kinase anchor protein 14-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of A-kinase anchor protein 14-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of A-kinase anchor protein 14-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkeyp-81f3.41.619e-2437.68si:dkeyp-81f3.4 [Source:ZFIN;Acc:ZDB-GENE-160113-1... [more]
back to top
BLAST of A-kinase anchor protein 14-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
AKAP147.249e-3445.80A-kinase anchoring protein 14 [Source:NCBI gene;Ac... [more]
back to top
BLAST of A-kinase anchor protein 14-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Akap147.930e-2036.64A kinase (PRKA) anchor protein 14 [Source:MGI Symb... [more]
back to top
BLAST of A-kinase anchor protein 14-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|O35817|AKA14_RAT3.739e-1936.36A-kinase anchor protein 14 OS=Rattus norvegicus OX... [more]
sp|Q86UN6|AKA28_HUMAN6.211e-1628.04A-kinase anchor protein 14 OS=Homo sapiens OX=9606... [more]
back to top
BLAST of A-kinase anchor protein 14-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JM597.359e-4347.85A-kinase anchor protein 14-like OS=Lingula unguis ... [more]
A0A504YDK49.385e-4042.70A-kinase anchor protein 14 OS=Fasciola gigantica O... [more]
A0A0B6Z8J21.209e-3943.33Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A3S1BFR01.045e-3843.26Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A210Q6P06.617e-3840.56A-kinase anchor protein 14 OS=Mizuhopecten yessoen... [more]
back to top
BLAST of A-kinase anchor protein 14-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkeyp-81f3.46.649e-1738.18si:dkeyp-81f3.4 [Source:ZFIN;Acc:ZDB-GENE-160113-1... [more]
back to top
BLAST of A-kinase anchor protein 14-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of A-kinase anchor protein 14-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of A-kinase anchor protein 14-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO434831.502e-3538.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of A-kinase anchor protein 14-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkeyp-81f3.46.567e-1636.52si:dkeyp-81f3.4 [Source:ZFIN;Acc:ZDB-GENE-160113-1... [more]
back to top
BLAST of A-kinase anchor protein 14-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000061885.10.000e+0100.00SMESG000061885.1[more]
SMESG000061885.10.000e+087.29SMESG000061885.1[more]
SMESG000043586.15.519e-3331.16SMESG000043586.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007064 ID=SMED30007064|Name=A-kinase anchor protein 14-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1103bp
GTTTAATTAATTTTGAAATTTGAAAATATTTAATCAGCGTTAAGATTCTT
TTTATTCGTTACTAATTATACATTTTAATAAAAATACATTATTCAATGTC
TGATAAAGAGAACGTAGATAACACTCAAAGTCGTCCGGATTCGGAGGCCT
CATCTAATAAGTCTGAAATTTCCAAAACAGCAAAATCCATCGTCAAAAGC
ACCATTGAAATGGCCATTAACAAAATAAATGCTCGTGTAGACTTAGAAAG
AGAAAATGAAACATTGCTTTACCAAACTAATATGATAGACGATATTACCG
ATGAATTCAAACCGAATTTCAAAAATGTTGTCATTACGGAAGAACTTAAT
AATAAAATGCGGTCCACAACATCAATACTAGAAGACGATTTCAATGATAA
AAATATACAAATTTCCGGTCAATATGACTCTTCGGAACAAGAAGCATTCC
TTTTAGTTGACAAGGCTCTCAACAATGCCATTCGTCGATTGGAAGATGAA
TCGAAAGAGAATTTAAACAAAATAGATGGAAATTCTAAAAATCAAAAATT
ACATTTAGCCAATGAGAAAATCTCAGTTGCGAATATCCAATGGCCTTCAA
TTGCGACTTTCACTGAACAATTAGGTGAAAGGAAAATTAATGAATTTGTT
ATATTGTGGCGTCTTGGGGAGGATTGGTTGCACTGTATCGATTATTTGGG
ATTCCTGGAAACTAGATTTGACAAGCGGCACAGATACCGTGTGAGATTCA
GTATCCCAACATCCAGGCATCCAATTCCTGTTGCGTCGGCGTCGGTATAT
TTTACAATCGTTGCTTCAAAGATAAAGCCCCCACATCGCATTGTCGATGT
GCTTTATGTTGTTGAATCGAGCCATTTGATCCATAGGCCGGGCGAGTACA
TATTCTGTGAATTGTGGCTCCGTAGAATTATTGATCACAAATACGCGTTA
ATAAAATTCTTTGACTTTTAATATTGGATTTTGTTTGGTCATTTCTTTAT
TGTTATAATTGAATTATTTTCTTTTTGGAAAGATTTGATTCAGATTTTAT
TTGGGAAAGTTTGTTACAAAAAATTCAATAGAAATAAATTTGTCACTTGT
CGG
back to top

protein sequence of SMED30007064-orf-1

>SMED30007064-orf-1 ID=SMED30007064-orf-1|Name=SMED30007064-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=292bp
MSDKENVDNTQSRPDSEASSNKSEISKTAKSIVKSTIEMAINKINARVDL
ERENETLLYQTNMIDDITDEFKPNFKNVVITEELNNKMRSTTSILEDDFN
DKNIQISGQYDSSEQEAFLLVDKALNNAIRRLEDESKENLNKIDGNSKNQ
KLHLANEKISVANIQWPSIATFTEQLGERKINEFVILWRLGEDWLHCIDY
LGFLETRFDKRHRYRVRFSIPTSRHPIPVASASVYFTIVASKIKPPHRIV
DVLYVVESSHLIHRPGEYIFCELWLRRIIDHKYALIKFFDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR025663AKAP_28
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025663A-kinase anchor protein 28kDaPFAMPF14469AKAP28coord: 166..285
e-value: 1.1E-39
score: 134.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 12..27
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..27
NoneNo IPR availablePANTHERPTHR35075FAMILY NOT NAMEDcoord: 18..291