Dihydrofolate reductase

Overview
NameDihydrofolate reductase
Smed IDSMED30007059
Length (bp)740
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dihydrofolate reductase (SMED30007059) t-SNE clustered cells

Violin plots show distribution of expression levels for Dihydrofolate reductase (SMED30007059) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dihydrofolate reductase (SMED30007059) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dihydrofolate reductase (SMED30007059) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007059

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30007059SMESG000061712.1 dd_Smed_v4_7808_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007059SMESG000061712.1 dd_Smed_v4_7808_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007059SMESG000061712.1 Contig44416newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007059SMESG000061712.1 Contig44416uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30007059SMESG000061712.1 dd_Smed_v4_7808_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dihydrofolate reductase vs. Ensembl Human
Match: DHFR (dihydrofolate reductase [Source:HGNC Symbol;Acc:HGNC:2861])

HSP 1 Score: 105.531 bits (262), Expect = 1.768e-27
Identity = 67/159 (42.14%), Postives = 103/159 (64.78%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTND-ELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSV-KLDHVPSEVQQENGIRYQFMVLDR 635
            RNE +YF  +TT+ S   KQN+VIMG+ TW SIP K RP+  RIN+V+S  L          +L  +L +AL  T   EL++KV+ V+++GGSS+YK A++    L+L+ T+I +  + DTFFP  + E++K + +   V S+VQ+E GI+Y+F V ++
Sbjct:   29 RNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKEPPQG--AHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEK 185          
BLAST of Dihydrofolate reductase vs. Ensembl Human
Match: DHFR (dihydrofolate reductase [Source:HGNC Symbol;Acc:HGNC:2861])

HSP 1 Score: 105.531 bits (262), Expect = 1.768e-27
Identity = 67/159 (42.14%), Postives = 103/159 (64.78%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTND-ELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSV-KLDHVPSEVQQENGIRYQFMVLDR 635
            RNE +YF  +TT+ S   KQN+VIMG+ TW SIP K RP+  RIN+V+S  L          +L  +L +AL  T   EL++KV+ V+++GGSS+YK A++    L+L+ T+I +  + DTFFP  + E++K + +   V S+VQ+E GI+Y+F V ++
Sbjct:   29 RNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKEPPQG--AHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEK 185          
BLAST of Dihydrofolate reductase vs. Ensembl Human
Match: DHFR2 (dihydrofolate reductase 2 [Source:HGNC Symbol;Acc:HGNC:27309])

HSP 1 Score: 97.4413 bits (241), Expect = 1.925e-24
Identity = 64/159 (40.25%), Postives = 100/159 (62.89%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFT-NDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSV-KLDHVPSEVQQENGIRYQFMVLDR 635
            RNE +YF  +TT+ S   KQN+VIMGR TW SIP K RP+  RIN+V+S  L          +L  +L +AL  T   EL++KV+ ++++GGSS+YK A++    L+L+ T+I +  + DTFF   + E++K + +   V S+VQ+   I+Y+F V ++
Sbjct:   29 RNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINLVLSRELKEPPQG--AHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEK 185          
BLAST of Dihydrofolate reductase vs. Ensembl Human
Match: DHFR2 (dihydrofolate reductase 2 [Source:HGNC Symbol;Acc:HGNC:27309])

HSP 1 Score: 97.4413 bits (241), Expect = 1.925e-24
Identity = 64/159 (40.25%), Postives = 100/159 (62.89%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFT-NDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSV-KLDHVPSEVQQENGIRYQFMVLDR 635
            RNE +YF  +TT+ S   KQN+VIMGR TW SIP K RP+  RIN+V+S  L          +L  +L +AL  T   EL++KV+ ++++GGSS+YK A++    L+L+ T+I +  + DTFF   + E++K + +   V S+VQ+   I+Y+F V ++
Sbjct:   29 RNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINLVLSRELKEPPQG--AHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEK 185          
BLAST of Dihydrofolate reductase vs. Ensembl Human
Match: DHFR2 (dihydrofolate reductase 2 [Source:HGNC Symbol;Acc:HGNC:27309])

HSP 1 Score: 97.4413 bits (241), Expect = 1.925e-24
Identity = 64/159 (40.25%), Postives = 100/159 (62.89%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFT-NDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSV-KLDHVPSEVQQENGIRYQFMVLDR 635
            RNE +YF  +TT+ S   KQN+VIMGR TW SIP K RP+  RIN+V+S  L          +L  +L +AL  T   EL++KV+ ++++GGSS+YK A++    L+L+ T+I +  + DTFF   + E++K + +   V S+VQ+   I+Y+F V ++
Sbjct:   29 RNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINLVLSRELKEPPQG--AHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEK 185          
BLAST of Dihydrofolate reductase vs. Ensembl Celegans
Match: dhfr-1 (Putative dihydrofolate reductase [Source:UniProtKB/Swiss-Prot;Acc:Q93341])

HSP 1 Score: 75.8702 bits (185), Expect = 1.078e-16
Identity = 49/156 (31.41%), Postives = 91/156 (58.33%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTND-ELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSVKLDHVP---SEVQQENGIRYQF 620
            + +M+YF ++T +VSD +K+N V+MGR  WESIP   RP+  R+NIV+S  L     +     + N+L  A+   ++    D +E ++ IGG+ +Y  AL  +    ++ T+IF++ + D    + ++ + + V+   V    SE+ +ENG++++F
Sbjct:   27 KKDMQYFASVTKNVSDQSKRNAVLMGRKCWESIPVTRRPLAGRLNIVLSRQLPAQKSD--DYIVVNSLEAAMKLLSEPPFVDSIETIWNIGGAEIYDLALRENLVDEIHLTRIFKNFEADVHLKSLDFSKMEKVQNAEVSSENSEIFEENGLKFEF 180          
BLAST of Dihydrofolate reductase vs. Ensembl Fly
Match: Dhfr (gene:FBgn0004087 transcript:FBtr0083295)

HSP 1 Score: 110.538 bits (275), Expect = 3.309e-30
Identity = 65/158 (41.14%), Postives = 103/158 (65.19%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTNDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSVKLDH-VPSEVQQENGIRYQFMVLDR 635
            ++E+KYF+  T   SD  KQN V+MGR T+  +P   RP+P R+NIV+S+TL ++ D   G  L  NL  A+    ++  ++VE ++++GGS +Y+ A++S    RLY TKI +  DCDTFFPA   + F+ V  D  +P  VQ+ENGI++++ +L++
Sbjct:   27 KSELKYFSRTTKRTSDPTKQNAVVMGRKTYFGVPESKRPLPDRLNIVLSTTL-QESDLPKGVLLCPNLETAMKILEEQ--NEVENIWIVGGSGVYEEAMASPRCHRLYITKIMQKFDCDTFFPAIP-DSFREVAPDSDMPLGVQEENGIKFEYKILEK 180          

HSP 2 Score: 39.6614 bits (91), Expect = 3.309e-30
Identity = 18/27 (66.67%), Postives = 19/27 (70.37%), Query Frame = 2
Query:   47 MKRLNLIVAACENQGIGKNGKLPWNLK 127
            M R NLIVA CEN GIG  G LPW +K
Sbjct:    1 MLRFNLIVAVCENFGIGIRGDLPWRIK 27          
BLAST of Dihydrofolate reductase vs. Ensembl Fly
Match: Dhfr (gene:FBgn0004087 transcript:FBtr0110910)

HSP 1 Score: 110.538 bits (275), Expect = 3.309e-30
Identity = 65/158 (41.14%), Postives = 103/158 (65.19%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTNDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSVKLDH-VPSEVQQENGIRYQFMVLDR 635
            ++E+KYF+  T   SD  KQN V+MGR T+  +P   RP+P R+NIV+S+TL ++ D   G  L  NL  A+    ++  ++VE ++++GGS +Y+ A++S    RLY TKI +  DCDTFFPA   + F+ V  D  +P  VQ+ENGI++++ +L++
Sbjct:   27 KSELKYFSRTTKRTSDPTKQNAVVMGRKTYFGVPESKRPLPDRLNIVLSTTL-QESDLPKGVLLCPNLETAMKILEEQ--NEVENIWIVGGSGVYEEAMASPRCHRLYITKIMQKFDCDTFFPAIP-DSFREVAPDSDMPLGVQEENGIKFEYKILEK 180          

HSP 2 Score: 39.6614 bits (91), Expect = 3.309e-30
Identity = 18/27 (66.67%), Postives = 19/27 (70.37%), Query Frame = 2
Query:   47 MKRLNLIVAACENQGIGKNGKLPWNLK 127
            M R NLIVA CEN GIG  G LPW +K
Sbjct:    1 MLRFNLIVAVCENFGIGIRGDLPWRIK 27          
BLAST of Dihydrofolate reductase vs. Ensembl Zebrafish
Match: dhfr (dihydrofolate reductase [Source:ZFIN;Acc:ZDB-GENE-010406-5])

HSP 1 Score: 105.916 bits (263), Expect = 2.021e-28
Identity = 68/161 (42.24%), Postives = 99/161 (61.49%), Query Frame = 3
Query:  168 NEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTN-DELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSV-KLDHVPSEVQQENGIRYQFMVLDRC*H 644
            NE+K+F  +T + SD  K+NVVIMGR TW SIP   RP+  RINIV+S  L    +     YL ++ S AL   +  EL   V++V++IGGSSLYK  +  S   RL+ T+I +  DCDTF P F+ +++K + +   VP  +Q++NG++Y F V +   H
Sbjct:   32 NELKHFQKMTMTPSDEGKKNVVIMGRKTWFSIPAAHRPLKNRINIVLSRELKTAPEG--AHYLASDFSSALHLLDSGELEKLVDQVWIIGGSSLYKEVMERSGHRRLFVTRILKQFDCDTFIPNFDMDKYKLLPEFPGVPVGLQEDNGVQYVFEVYESIEH 190          

HSP 2 Score: 38.891 bits (89), Expect = 2.021e-28
Identity = 17/34 (50.00%), Postives = 23/34 (67.65%), Query Frame = 2
Query:   56 LNLIVAACENQGIGKNGKLPWNLKYIKSIVLNFQ 157
            LN IVA C + GIGKNG LPW+   + + + +FQ
Sbjct:    5 LNCIVAVCPDMGIGKNGNLPWHPIRLSNELKHFQ 38          
BLAST of Dihydrofolate reductase vs. Ensembl Zebrafish
Match: zgc:153031 (zgc:153031 [Source:ZFIN;Acc:ZDB-GENE-060929-1190])

HSP 1 Score: 71.2478 bits (173), Expect = 2.011e-17
Identity = 48/158 (30.38%), Postives = 83/158 (52.53%), Query Frame = 3
Query:  168 NEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTND-ELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSVK-LDHVPSEVQQENGIRYQFMVLDR 635
             E ++  +  T+VS   K+N+++ GRI W S P    P+   IN+V+S  +     +    YL  +    +   ++  L   VE ++++GG+ +YK +L   +   +Y T I  + +CD FFP F+   F+  K    VP E+ +ENGI++QF V  +
Sbjct:   37 KEFQFLLDTITAVSAPGKKNLIVWGRICWFSCPETVFPLANCINLVLSRKMISVPPH--AHYLCKDFDSIIRLVSEPPLCHTVEVIWILGGTEVYKESLEHPWCDLIYLTNIMANFECDVFFPEFDPNIFRKQKSFPGVPDEIIEENGIKFQFQVFKK 192          

HSP 2 Score: 36.5798 bits (83), Expect = 2.011e-17
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = 2
Query:   50 KRLNLIVAACENQGIGKNGKLPWNL 124
            K + LI AAC + GIGK+G++PW L
Sbjct:   11 KPIRLIAAACRDMGIGKDGQIPWCL 35          
BLAST of Dihydrofolate reductase vs. Ensembl Xenopus
Match: ENSXETT00000046966.1 (dihydrofolate reductase [Source:NCBI gene;Acc:100486206])

HSP 1 Score: 103.99 bits (258), Expect = 6.358e-27
Identity = 67/160 (41.88%), Postives = 101/160 (63.12%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGT-YLFNNLSEALSFTND-ELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSV-KLDHVPSEVQQENGIRYQFMVLDR 635
            RNE K+F  +T + +  +K+NVVIMGR TW SIP K RP+ +RINIV+S  L    +  TG  YL  +L+EA+    D EL DKV+ V+VIGGSSLY+  +      R + T+I +  +CDT+ P  +   F+ + +   +  E+Q+ENG++Y+F V ++
Sbjct:   31 RNEFKHFQRLTMTPTVEDKKNVVIMGRKTWFSIPEKNRPLKERINIVLSKELK---EPPTGAHYLSKSLAEAIDLLEDPELKDKVDLVWVIGGSSLYQELMEKPVNQRWFVTRILQEFECDTYLPEIDLNSFRLLPEYPGISPELQEENGVQYKFEVYEK 187          
BLAST of Dihydrofolate reductase vs. Ensembl Xenopus
Match: dhfr (dihydrofolate reductase [Source:NCBI gene;Acc:733465])

HSP 1 Score: 83.1889 bits (204), Expect = 7.078e-19
Identity = 56/159 (35.22%), Postives = 87/159 (54.72%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSF-TNDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFK-SVKLDHVPSEVQQENGIRYQFMVLDR 635
            RNE KY  +  T V+   K+N+++ GR ++E+      P+P  I  ++S  LS     +  +YL  N  E L F +   L+D++E ++V+GG   YK  +   +   +Y+TKI    +CDTFFP F+   FK       VPS +Q+ENG++Y F V  R
Sbjct:   41 RNEFKYLLDTITRVTQPGKKNLLLWGRQSFETFDESLLPLPNCIIALLSRKLSTVPPYV--SYLCKNEEEILKFASTPPLNDEIETIWVLGGVESYKNLMQHPWCNHIYFTKIMADFECDTFFPEFDKNIFKLKENFPGVPSGIQEENGVKYVFQVYQR 197          
BLAST of Dihydrofolate reductase vs. Ensembl Xenopus
Match: dhfr (dihydrofolate reductase [Source:NCBI gene;Acc:733465])

HSP 1 Score: 82.8037 bits (203), Expect = 7.935e-19
Identity = 56/159 (35.22%), Postives = 87/159 (54.72%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSF-TNDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFK-SVKLDHVPSEVQQENGIRYQFMVLDR 635
            RNE KY  +  T V+   K+N+++ GR ++E+      P+P  I  ++S  LS     +  +YL  N  E L F +   L+D++E ++V+GG   YK  +   +   +Y+TKI    +CDTFFP F+   FK       VPS +Q+ENG++Y F V  R
Sbjct:   40 RNEFKYLLDTITRVTQPGKKNLLLWGRQSFETFDESLLPLPNCIIALLSRKLSTVPPYV--SYLCKNEEEILKFASTPPLNDEIETIWVLGGVESYKNLMQHPWCNHIYFTKIMADFECDTFFPEFDKNIFKLKENFPGVPSGIQEENGVKYVFQVYQR 196          
BLAST of Dihydrofolate reductase vs. Ensembl Mouse
Match: Dhfr (dihydrofolate reductase [Source:MGI Symbol;Acc:MGI:94890])

HSP 1 Score: 106.686 bits (265), Expect = 4.516e-28
Identity = 69/159 (43.40%), Postives = 100/159 (62.89%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTND-ELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSV-KLDHVPSEVQQENGIRYQFMVLDR 635
            RNE KYF  +TT+ S   KQN+VIMGR TW SIP K RP+  RINIV+S  L          +L  +L +AL      EL+ KV+ V+++GGSS+Y+ A++    LRL+ T+I +  + DTFFP  +  ++K + +   V SEVQ+E GI+Y+F V ++
Sbjct:   29 RNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPRG--AHFLAKSLDDALRLIEQPELASKVDMVWIVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKFEVYEK 185          
BLAST of Dihydrofolate reductase vs. UniProt/SwissProt
Match: sp|P00377|DYR_PIG (Dihydrofolate reductase OS=Sus scrofa OX=9823 GN=DHFR PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.657e-30
Identity = 72/159 (45.28%), Postives = 103/159 (64.78%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTND-ELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSV-KLDHVPSEVQQENGIRYQFMVLDR 635
            RNE KYF  +TT+ S   KQN+VIMGR TW SIP K RP+  RINIV+S  L          +L  +L +AL  T   EL DKV+ V+++GGSS+YK A++    +RL+ T+I +  + DTFFP  + E++K + +   VPS+VQ+E GI+Y+F V ++
Sbjct:   28 RNEYKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPQG--AHFLAKSLDDALKLTEQPELKDKVDMVWIVGGSSVYKEAMNKPGHIRLFVTRIMKEFESDTFFPEIDLEKYKLLSECSGVPSDVQEEKGIKYKFEVYEK 184          
BLAST of Dihydrofolate reductase vs. UniProt/SwissProt
Match: sp|P04753|DYR_MESAU (Dihydrofolate reductase OS=Mesocricetus auratus OX=10036 GN=DHFR PE=2 SV=4)

HSP 1 Score: 112.079 bits (279), Expect = 2.070e-29
Identity = 72/159 (45.28%), Postives = 102/159 (64.15%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTND-ELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSV-KLDHVPSEVQQENGIRYQFMVLDR 635
            RNE KYF  +TT+ S   KQN+VIMGR TW SIP K RP+  RINIV+S  L          +L  +L +AL      EL+DKV+ V+++GGSS+YK A++    LRL+ T+I +  + DTFFP  + E++K + +   V SEVQ+E GI+Y+F V ++
Sbjct:   29 RNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPQG--AHFLAKSLDDALKLIEQPELADKVDMVWIVGGSSVYKEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEVQEEKGIKYKFEVYEK 185          
BLAST of Dihydrofolate reductase vs. UniProt/SwissProt
Match: sp|P17719|DYR_DROME (Dihydrofolate reductase OS=Drosophila melanogaster OX=7227 GN=Dhfr PE=1 SV=3)

HSP 1 Score: 110.538 bits (275), Expect = 2.415e-29
Identity = 65/158 (41.14%), Postives = 103/158 (65.19%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTNDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSVKLDH-VPSEVQQENGIRYQFMVLDR 635
            ++E+KYF+  T   SD  KQN V+MGR T+  +P   RP+P R+NIV+S+TL ++ D   G  L  NL  A+    ++  ++VE ++++GGS +Y+ A++S    RLY TKI +  DCDTFFPA   + F+ V  D  +P  VQ+ENGI++++ +L++
Sbjct:   27 KSELKYFSRTTKRTSDPTKQNAVVMGRKTYFGVPESKRPLPDRLNIVLSTTL-QESDLPKGVLLCPNLETAMKILEEQ--NEVENIWIVGGSGVYEEAMASPRCHRLYITKIMQKFDCDTFFPAIP-DSFREVAPDSDMPLGVQEENGIKFEYKILEK 180          

HSP 2 Score: 39.6614 bits (91), Expect = 2.415e-29
Identity = 18/27 (66.67%), Postives = 19/27 (70.37%), Query Frame = 2
Query:   47 MKRLNLIVAACENQGIGKNGKLPWNLK 127
            M R NLIVA CEN GIG  G LPW +K
Sbjct:    1 MLRFNLIVAVCENFGIGIRGDLPWRIK 27          
BLAST of Dihydrofolate reductase vs. UniProt/SwissProt
Match: sp|Q9U8B8|DYR_HELVI (Dihydrofolate reductase OS=Heliothis virescens OX=7102 GN=DHFR PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 3.041e-29
Identity = 64/158 (40.51%), Postives = 97/158 (61.39%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLT-GTYLFNNLSEALSFTNDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSVKLDHVPSEVQQENGIRYQFMVLDR 635
            + EM YF  +T+ VS+  K N VIMGR TW+ IP+K+RP+  R+NIV++  +    +N+  G  +F  L EA+ +   E  + +E  +VIGGSS+Y+AA++     ++Y T+I +S DCDTFFP  + +QF  V  + +P E Q E  I Y F V  +
Sbjct:   29 KKEMAYFTTMTSKVSEPTKVNAVIMGRRTWDCIPDKYRPLQDRVNIVLTHNVDSVKENVPEGVMVFPGLDEAIKYI--EGREDIESTWVIGGSSIYRAAMTHPNCGKIYLTEIQKSFDCDTFFPNIDKQQFHLVDEEQIPGEKQVEGNISYYFRVYKK 184          

HSP 2 Score: 42.3578 bits (98), Expect = 3.041e-29
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = 2
Query:   53 RLNLIVAACENQGIGKNGKLPWNLK 127
            +LNLI AAC+N GIG NG LPW LK
Sbjct:    5 KLNLIAAACDNMGIGVNGALPWRLK 29          
BLAST of Dihydrofolate reductase vs. UniProt/SwissProt
Match: sp|Q920D2|DYR_RAT (Dihydrofolate reductase OS=Rattus norvegicus OX=10116 GN=Dhfr PE=1 SV=3)

HSP 1 Score: 109.768 bits (273), Expect = 1.943e-28
Identity = 70/159 (44.03%), Postives = 101/159 (63.52%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTND-ELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSV-KLDHVPSEVQQENGIRYQFMVLDR 635
            RNE KYF  +TT+ S   KQN+VIMGR TW SIP K RP+  RINIV+S  L          +L  +L +AL      EL+ KV+ V+V+GGSS+Y+ A++    LRL+ T+I +  + DTFFP  + E++K + +   V SE+Q+E GI+Y+F V ++
Sbjct:   29 RNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPQG--AHFLAKSLDDALKLIEQPELASKVDMVWVVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKFEVYEK 185          
BLAST of Dihydrofolate reductase vs. TrEMBL
Match: A0A504YYS5 (Viral dihydrofolate reductase OS=Fasciola gigantica OX=46835 GN=FGIG_08258 PE=4 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 1.208e-33
Identity = 69/154 (44.81%), Postives = 98/154 (63.64%), Query Frame = 3
Query:  174 MKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTNDELSDKVEEVFVIXXXXX-XXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSVKLDHVPSEVQQENGIRYQFMVLD 632
            M +F  IT S +    QN VIMG+ TWESIP+KFRP+P RINIVISST+    D   G YL  +LS+      +EL+ +V++VFVIGG     +A     +P+R+Y T + + ++CD FFP+ +WE+   V L  VP+++ +ENG  Y+F V D
Sbjct:    1 MAFFKRIT-STARPGLQNAVIMGKNTWESIPSKFRPLPGRINIVISSTMPTAPD---GVYLCRSLSDCFHILENELNTQVDQVFVIGGVRAYEEAMAQKEHPVRIYCTHVLQDVECDAFFPSTDWEKLTKVTLPDVPTDLVEENGYTYRFQVYD 150          
BLAST of Dihydrofolate reductase vs. TrEMBL
Match: V3ZI95 (DHFR domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_155225 PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.666e-33
Identity = 73/159 (45.91%), Postives = 106/159 (66.67%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTN-DELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSVK-LDHVPSEVQQENGIRYQFMVLDR 635
            + +M  F +IT+   D +KQN VIMGR TW SIP+KFRP+  R+NI++S+TLS   D   GTY+  N  +ALS  N D++  ++E V +IGGSS+YK A+ S Y  R+Y TK+    +CDTF P  E   F+ VK   ++PS+VQ+ENGI++ + + D+
Sbjct:   29 KKDMAMFRHITSDTVDESKQNAVIMGRKTWMSIPDKFRPLKNRVNIILSNTLSESPD---GTYIVKNFQQALSLVNSDKMKQQIESVHIIGGSSVYKEAMESDYDCRVYLTKVDADFECDTFLPPIEESLFQRVKNPSNIPSDVQEENGIQFTYEIYDK 184          

HSP 2 Score: 45.4394 bits (106), Expect = 2.666e-33
Identity = 18/29 (62.07%), Postives = 23/29 (79.31%), Query Frame = 2
Query:   41 LIMKRLNLIVAACENQGIGKNGKLPWNLK 127
            +  KRLN++VAAC+N GIG NG +PW LK
Sbjct:    1 MCTKRLNIVVAACKNNGIGVNGSIPWRLK 29          
BLAST of Dihydrofolate reductase vs. TrEMBL
Match: A0A4E0QYF4 (Viral dihydrofolate reductase OS=Fasciola hepatica OX=6192 GN=D915_009851 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 2.740e-33
Identity = 69/154 (44.81%), Postives = 97/154 (62.99%), Query Frame = 3
Query:  174 MKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTNDELSDKVEEVFVIXXXXX-XXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSVKLDHVPSEVQQENGIRYQFMVLD 632
            M +F  IT S +    QN VIMG+ TWESIP+KFRP+P RINIVISST+    D   G YL  +LS+      +EL+  V++VFVIGG     +A     +P+R+Y T + + ++CD FFP+ +WE+   V L  VP+++ +ENG  Y+F V D
Sbjct:    1 MAFFKRIT-STARPGLQNAVIMGKNTWESIPSKFRPLPGRINIVISSTMPTAPD---GVYLCRSLSDCFHILENELNTHVDQVFVIGGVRAYEEAMTQKEHPVRIYCTHVLQDVECDAFFPSTDWEKLTKVTLPDVPTDLVEENGYTYRFQVYD 150          
BLAST of Dihydrofolate reductase vs. TrEMBL
Match: A0A2S2P348 (Dihydrofolate reductase OS=Schizaphis graminum OX=13262 GN=Dhfr PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 2.138e-32
Identity = 74/157 (47.13%), Postives = 101/157 (64.33%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTNDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSVKLDHVPSEVQQENGIRYQFMVLDR 635
            + EM+YFN +TT V+ S  QN VIMGR TW+SIP+K+RP+  R N+VIS TL    +   G  L+ NL EAL      L+D VE ++VIGGS LY  A++     +LY TKI +   CDTFFP F+ ++F+ +    VP  +Q+ENGI+Y+F V  R
Sbjct:   32 KKEMEYFNRMTTQVNQSGVQNAVIMGRCTWQSIPDKYRPLKGRKNVVISKTLKSVPE---GVLLYPNLKEALKSL--YLNDHVENIWVIGGSGLYNEAINDKNCKKLYITKIDQEYLCDTFFPDFDLKEFEEINETSVPKGIQEENGIKYEFKVFKR 183          
BLAST of Dihydrofolate reductase vs. TrEMBL
Match: A0A2B4S0S1 (Dihydrofolate reductase OS=Stylophora pistillata OX=50429 GN=DHFR PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 3.826e-32
Identity = 71/158 (44.94%), Postives = 99/158 (62.66%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALS-FTNDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSVKLDHVPSEVQQENGIRYQFMVLDR 635
            + +MK+F+++T+ VS   KQN VIMGR TWESIP K+RP+P RINI++S  LS   +   G  L ++L  A    +     DKVE++FVIGG+++YK AL      RLY T + +  DCD  FPAF+   FK      VPS V ++NGI+++F V  R
Sbjct:   30 KEDMKFFSHLTSEVSADGKQNAVIMGRKTWESIPAKYRPLPHRINIMLSKNLS---EAPKGASLCSSLQGAFDLLSTAPYLDKVEKIFVIGGAAVYKEALQHPGAYRLYITHVMKDFDCDVHFPAFDKTVFKETSDPEVPSGVHEDNGIKFEFKVYQR 184          
BLAST of Dihydrofolate reductase vs. Ensembl Cavefish
Match: dhfr (dihydrofolate reductase [Source:NCBI gene;Acc:111191970])

HSP 1 Score: 106.686 bits (265), Expect = 3.845e-28
Identity = 68/156 (43.59%), Postives = 99/156 (63.46%), Query Frame = 3
Query:  171 EMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALS-FTNDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSV-KLDHVPSEVQQENGIRYQFMVLD 632
            E K+F  +T + +   K+NVVIMGR TW SIP + RP+  RIN+V+S  L    +     YL ++ S AL   T  ELS + ++++VIGGSSLYK A+ SS P RL+ T+I +  DCDTF P    +++K + +   VPS +Q+ENG++Y F V +
Sbjct:   33 EFKHFQKMTMTPTVEGKKNVVIMGRKTWYSIPPQNRPLKNRINVVLSRELKEPPEG--AHYLASDFSSALGLLTTPELSSEADQIWVIGGSSLYKEAMESSGPKRLFVTRILKQFDCDTFIPKINLDKYKQLTEFPGVPSGLQEENGLQYVFEVYE 186          
BLAST of Dihydrofolate reductase vs. Ensembl Cavefish
Match: zgc:153031 (dihydrofolate reductase-like [Source:NCBI gene;Acc:103042073])

HSP 1 Score: 83.5741 bits (205), Expect = 7.413e-22
Identity = 53/158 (33.54%), Postives = 89/158 (56.33%), Query Frame = 3
Query:  168 NEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTND-ELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQF-KSVKLDHVPSEVQQENGIRYQFMVLDR 635
            +E K+F +  T+VS   K+N+++ GR TW S P    P+   ++++++  L R    L   Y+  +  EA+   +   LSD +E ++VIGG+ +Y+ A+   +   +Y T I    DCD FFP F+   + K  +   VP E+Q+ENGI++QF V  +
Sbjct:   36 SEFKFFLDKITAVSKPGKKNLLVWGRYTWFSCPEGVLPLANTLHVILTKKL-RSPPELA-DYICEDFDEAIRLASQPPLSDLIETIWVIGGTEVYREAMEHPWCDLIYLTDIMADFDCDVFFPDFDRNIYRKQSRFPGVPHEIQEENGIKFQFQVFKK 191          

HSP 2 Score: 38.891 bits (89), Expect = 7.413e-22
Identity = 15/25 (60.00%), Postives = 20/25 (80.00%), Query Frame = 2
Query:   50 KRLNLIVAACENQGIGKNGKLPWNL 124
            K + LI AAC N GIGK+G+LPW++
Sbjct:   10 KPIRLIAAACNNMGIGKDGRLPWSI 34          
BLAST of Dihydrofolate reductase vs. Ensembl Cavefish
Match: zgc:153031 (dihydrofolate reductase-like [Source:NCBI gene;Acc:103042073])

HSP 1 Score: 85.8853 bits (211), Expect = 2.366e-20
Identity = 52/160 (32.50%), Postives = 89/160 (55.62%), Query Frame = 3
Query:  162 SRNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTND-ELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQF-KSVKLDHVPSEVQQENGIRYQFMVLDR 635
             R+E K+F +  T+VS   K+N+++ GR TW S P    P+   ++++++  L    +     Y+  +  EA+   +   LSD +E ++VIGG+ +Y+ A+   +   +Y T I    DCD FFP F+   + K  +   VP E+Q+ENGI++QF V  +
Sbjct:   29 CRSEFKFFLDKITAVSKPGKKNLLVWGRYTWFSCPEGVLPLANTLHVILTKKLRSPPE--LADYICEDFDEAIRLASQPPLSDLIETIWVIGGTEVYREAMEHPWCDLIYLTDIMADFDCDVFFPDFDRNIYRKQSRFPGVPHEIQEENGIKFQFQVFKK 186          
BLAST of Dihydrofolate reductase vs. Ensembl Yeast
Match: DFR1 (Dihydrofolate reductase involved in tetrahydrofolate biosynthesis; required for respiratory metabolism; mutation is functionally complemented by human DHFR [Source:SGD;Acc:S000005762])

HSP 1 Score: 79.7221 bits (195), Expect = 9.655e-19
Identity = 38/90 (42.22%), Postives = 55/90 (61.11%), Query Frame = 3
Query:  168 NEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRD--HDNLTGTYLFNNLSEALSFTNDELSDKVEEVFVI 431
            +EMKYF  +T+   D NK+N +IMGR TWESIP KFRP+P R+N++IS +   D  HD        N+L+ A+        + +E ++VI
Sbjct:   33 SEMKYFRQVTSLTKDPNKKNALIMGRKTWESIPPKFRPLPNRMNVIISRSFKDDFVHDKERSIVQSNSLANAIMNLESNFKEHLERIYVI 122          
BLAST of Dihydrofolate reductase vs. Ensembl Nematostella
Match: EDO38488 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCT0])

HSP 1 Score: 120.168 bits (300), Expect = 7.472e-34
Identity = 72/159 (45.28%), Postives = 97/159 (61.01%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALS-FTNDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSVKLDHVPSEVQQENGIRYQFMVLDRC 638
            + +MK+F   T+ V    KQN VIMGR  WESIP KFRP+  R+NIV+S TLS   +   G  L  +  +AL+  + D  + K+E VFV GGS+LYK A++ S   R+Y T I +  DCD FFP F+   +  V+   VPS   +E GI+Y+F V DRC
Sbjct:   31 KGDMKFFTEKTSEVKTEGKQNAVIMGRKVWESIPEKFRPLKGRLNIVLSRTLS---EPPQGAQLCRSFEQALTILSTDPYTKKIENVFVCGGSALYKDAMAHSACTRIYITYIDQEFDCDVFFPEFDQNTYHLVEDPDVPSVQHEEKGIKYKFCVYDRC 186          
BLAST of Dihydrofolate reductase vs. Ensembl Nematostella
Match: EDO28804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5F9])

HSP 1 Score: 109.383 bits (272), Expect = 2.982e-30
Identity = 67/142 (47.18%), Postives = 89/142 (62.68%), Query Frame = 3
Query:  216 NKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALS-FTNDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSVKLDHVPSEVQQENGIRYQFMVLDRC 638
             KQN VIMGR  WESIP KFRP+  R+NIV+S TLS   +   G  L  +  +AL+  + D  ++K+E VFV GGS+LYK A++ S   R+Y T I +  DCD FFP F+   +  V+   VPS   +E GI+Y+F V DRC
Sbjct:    1 GKQNAVIMGRKVWESIPEKFRPLKGRLNIVLSRTLS---EPPQGAQLCRSFEQALTILSTDPYTEKIENVFVCGGSALYKDAIAHSACTRIYITYIDQEFDCDVFFPEFDQNTYHLVEDPDVPSVQHEEKGIKYKFCVYDRC 139          
BLAST of Dihydrofolate reductase vs. Ensembl Nematostella
Match: EDO29275 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T439])

HSP 1 Score: 46.2098 bits (108), Expect = 2.549e-7
Identity = 16/29 (55.17%), Postives = 24/29 (82.76%), Query Frame = 3
Query:  225 NVVIMGRITWESIPNKFRPMPKRINIVIS 311
            + V+MGR TW+S+P +FRP+P R NIV++
Sbjct:   39 SAVVMGRKTWDSLPARFRPLPGRTNIVVT 67          

HSP 2 Score: 25.409 bits (54), Expect = 2.549e-7
Identity = 10/23 (43.48%), Postives = 15/23 (65.22%), Query Frame = 2
Query:   56 LNLIVAACENQGIGKNGKLPWNL 124
            ++LI A   N  IGK+  +PW+L
Sbjct:    3 IHLIYARAANGVIGKDNAMPWHL 25          
BLAST of Dihydrofolate reductase vs. Ensembl Medaka
Match: dhfr (dihydrofolate reductase [Source:NCBI gene;Acc:101166707])

HSP 1 Score: 100.523 bits (249), Expect = 8.935e-26
Identity = 60/151 (39.74%), Postives = 93/151 (61.59%), Query Frame = 3
Query:  183 FNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTNDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSV-KLDHVPSEVQQENGIRYQFMVLD 632
            F  +T++   + +QNVVIMGR TW SIP K RP+  RINIV+S  L          ++  + + AL   + EL+++ ++V++IGGSS+YK  + S  P RL  T++ +  +CDTFFP    EQF+ + +   V  E+Q+ENG+ Y+F V +
Sbjct:   37 FRKMTSTPLVAGRQNVVIMGRKTWFSIPEKNRPLQNRINIVLSRQLKAPPAG--AHFVAADFAAALRLVDSELAERADQVWIIGGSSIYKEMMESPAPRRLIVTRVQKQFECDTFFPEIRPEQFRLLPEFPGVSQELQEENGVSYKFEVYE 185          
BLAST of Dihydrofolate reductase vs. Ensembl Medaka
Match: zgc:153031 (dihydrofolate reductase [Source:NCBI gene;Acc:101161149])

HSP 1 Score: 86.6557 bits (213), Expect = 2.790e-22
Identity = 55/158 (34.81%), Postives = 89/158 (56.33%), Query Frame = 3
Query:  168 NEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTN-DELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFK-SVKLDHVPSEVQQENGIRYQFMVLDR 635
            +E +YF N  T VS     N++I GR+ W S P+   P+P  +++V+S TL+   ++    +L  +   A+       L+D +E ++V+GG+ +Y+ AL       LY+T +    DCD FFP F+ E F+   +   VPSEVQ+ENGI+++  V  R
Sbjct:   36 SEFQYFLNTITRVSRPGNVNLMIWGRLCWFSHPDDLFPLPNSLHVVLSKTLTSVPNH--AQFLCGDFESAVRLAALPPLADIIETIWVLGGTKVYEEALKHPCCDLLYFTDVMADFDCDVFFPDFDRELFRVQEEFPDVPSEVQEENGIKFKCQVFKR 191          

HSP 2 Score: 37.3502 bits (85), Expect = 2.790e-22
Identity = 15/25 (60.00%), Postives = 18/25 (72.00%), Query Frame = 2
Query:   50 KRLNLIVAACENQGIGKNGKLPWNL 124
            K + LI A C N GIGK+G LPW+L
Sbjct:   10 KPVRLIAAVCRNNGIGKDGTLPWSL 34          
BLAST of Dihydrofolate reductase vs. Planmine SMEST
Match: SMESG000061712.1 (SMESG000061712.1)

HSP 1 Score: 295.049 bits (754), Expect = 2.553e-102
Identity = 157/158 (99.37%), Postives = 158/158 (100.00%), Query Frame = 3
Query:  165 RNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTNDELSDKVEEVFVIXXXXXXXXXXXXXXPLRLYYTKIFESLDCDTFFPAFEWEQFKSVKLDHVPSEVQQENGIRYQFMVLDRC 638
            +NEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTNDELSDKVEEVFVIGGSSLYKAALSSSYPLRLYYTKIFESLDCDTFFPAFEWEQFKSVKLDHVPSEVQQENGIRYQFMVLDRC
Sbjct:   27 KNEMKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLSRDHDNLTGTYLFNNLSEALSFTNDELSDKVEEVFVIGGSSLYKAALSSSYPLRLYYTKIFESLDCDTFFPAFEWEQFKSVKLDHVPSEVQQENGIRYQFMVLDRC 184          

HSP 2 Score: 60.077 bits (144), Expect = 5.225e-11
Identity = 27/27 (100.00%), Postives = 27/27 (100.00%), Query Frame = 2
Query:   47 MKRLNLIVAACENQGIGKNGKLPWNLK 127
            MKRLNLIVAACENQGIGKNGKLPWNLK
Sbjct:    1 MKRLNLIVAACENQGIGKNGKLPWNLK 27          
The following BLAST results are available for this feature:
BLAST of Dihydrofolate reductase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DHFR1.768e-2742.14dihydrofolate reductase [Source:HGNC Symbol;Acc:HG... [more]
DHFR1.768e-2742.14dihydrofolate reductase [Source:HGNC Symbol;Acc:HG... [more]
DHFR21.925e-2440.25dihydrofolate reductase 2 [Source:HGNC Symbol;Acc:... [more]
DHFR21.925e-2440.25dihydrofolate reductase 2 [Source:HGNC Symbol;Acc:... [more]
DHFR21.925e-2440.25dihydrofolate reductase 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Dihydrofolate reductase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dhfr-11.078e-1631.41Putative dihydrofolate reductase [Source:UniProtK... [more]
back to top
BLAST of Dihydrofolate reductase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Dhfr3.309e-3041.14gene:FBgn0004087 transcript:FBtr0083295[more]
Dhfr3.309e-3041.14gene:FBgn0004087 transcript:FBtr0110910[more]
back to top
BLAST of Dihydrofolate reductase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dhfr2.021e-2842.24dihydrofolate reductase [Source:ZFIN;Acc:ZDB-GENE-... [more]
zgc:1530312.011e-1730.38zgc:153031 [Source:ZFIN;Acc:ZDB-GENE-060929-1190][more]
back to top
BLAST of Dihydrofolate reductase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000046966.16.358e-2741.88dihydrofolate reductase [Source:NCBI gene;Acc:1004... [more]
dhfr7.078e-1935.22dihydrofolate reductase [Source:NCBI gene;Acc:7334... [more]
dhfr7.935e-1935.22dihydrofolate reductase [Source:NCBI gene;Acc:7334... [more]
back to top
BLAST of Dihydrofolate reductase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Dhfr4.516e-2843.40dihydrofolate reductase [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Dihydrofolate reductase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P00377|DYR_PIG1.657e-3045.28Dihydrofolate reductase OS=Sus scrofa OX=9823 GN=D... [more]
sp|P04753|DYR_MESAU2.070e-2945.28Dihydrofolate reductase OS=Mesocricetus auratus OX... [more]
sp|P17719|DYR_DROME2.415e-2941.14Dihydrofolate reductase OS=Drosophila melanogaster... [more]
sp|Q9U8B8|DYR_HELVI3.041e-2940.51Dihydrofolate reductase OS=Heliothis virescens OX=... [more]
sp|Q920D2|DYR_RAT1.943e-2844.03Dihydrofolate reductase OS=Rattus norvegicus OX=10... [more]
back to top
BLAST of Dihydrofolate reductase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YYS51.208e-3344.81Viral dihydrofolate reductase OS=Fasciola gigantic... [more]
V3ZI952.666e-3345.91DHFR domain-containing protein OS=Lottia gigantea ... [more]
A0A4E0QYF42.740e-3344.81Viral dihydrofolate reductase OS=Fasciola hepatica... [more]
A0A2S2P3482.138e-3247.13Dihydrofolate reductase OS=Schizaphis graminum OX=... [more]
A0A2B4S0S13.826e-3244.94Dihydrofolate reductase OS=Stylophora pistillata O... [more]
back to top
BLAST of Dihydrofolate reductase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dhfr3.845e-2843.59dihydrofolate reductase [Source:NCBI gene;Acc:1111... [more]
zgc:1530317.413e-2233.54dihydrofolate reductase-like [Source:NCBI gene;Acc... [more]
zgc:1530312.366e-2032.50dihydrofolate reductase-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Dihydrofolate reductase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dihydrofolate reductase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DFR19.655e-1942.22Dihydrofolate reductase involved in tetrahydrofola... [more]
back to top
BLAST of Dihydrofolate reductase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO384887.472e-3445.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288042.982e-3047.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292752.549e-755.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dihydrofolate reductase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dhfr8.935e-2639.74dihydrofolate reductase [Source:NCBI gene;Acc:1011... [more]
zgc:1530312.790e-2234.81dihydrofolate reductase [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Dihydrofolate reductase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000061712.12.553e-10299.37SMESG000061712.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007059 ID=SMED30007059|Name=Dihydrofolate reductase|organism=Schmidtea mediterranea sexual|type=transcript|length=740bp
TTTGTTTATATATTTAAATATATTCACAAAGAATTTTATATTAATCATGA
AAAGATTAAATTTGATTGTAGCTGCATGTGAGAATCAAGGGATCGGAAAA
AATGGTAAATTACCATGGAACTTAAAGTATATTAAAAGTATTGTTTTGAA
TTTTCAAAGTTTCTAGGAATGAAATGAAATATTTCAATAACATTACAACA
TCTGTTTCGGATAGTAATAAACAGAATGTTGTTATAATGGGCCGTATTAC
TTGGGAATCAATTCCAAATAAATTTCGACCCATGCCTAAAAGAATAAATA
TTGTTATATCGTCAACACTGTCACGGGATCATGATAACTTAACTGGAACT
TATCTATTTAATAATTTAAGCGAGGCTTTATCGTTTACAAATGATGAGTT
ATCTGACAAAGTAGAAGAAGTATTTGTAATAGGAGGATCTAGTTTATATA
AGGCAGCTTTAAGTAGCTCATATCCATTGCGATTATATTATACAAAGATT
TTTGAATCACTCGATTGTGACACATTTTTCCCTGCATTCGAATGGGAACA
GTTTAAATCGGTCAAATTAGATCACGTTCCCAGTGAAGTACAACAGGAAA
ATGGCATTAGATATCAATTTATGGTGCTAGATCGCTGTTGACACATTCTT
ATATAAGATCTATTCCCATGATTGATGTCAACGCTTGAATTAATATTTTC
ACATTTTATATTAACCAATAAATGCTGACTTATTTCTTAA
back to top

protein sequence of SMED30007059-orf-1

>SMED30007059-orf-1 ID=SMED30007059-orf-1|Name=SMED30007059-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
MKYFNNITTSVSDSNKQNVVIMGRITWESIPNKFRPMPKRINIVISSTLS
RDHDNLTGTYLFNNLSEALSFTNDELSDKVEEVFVIGGSSLYKAALSSSY
PLRLYYTKIFESLDCDTFFPAFEWEQFKSVKLDHVPSEVQQENGIRYQFM
VLDRC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR012259DHFR
IPR024072DHFR-like_dom_sf
IPR001796DHFR_dom
Vocabulary: molecular function
TermDefinition
GO:0004146dihydrofolate reductase activity
GO:0050661NADP binding
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0008144drug binding
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0006545glycine biosynthetic process
GO:0009165nucleotide biosynthetic process
GO:0055114oxidation-reduction process
GO:0006730one-carbon metabolic process
GO:0031427response to methotrexate
GO:0046653tetrahydrofolate metabolic process
GO:0046654tetrahydrofolate biosynthetic process
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00070DHFRcoord: 20..31
score: 64.5
coord: 82..96
score: 43.98
NoneNo IPR availablePANTHERPTHR22778OVARIAN CANCER GENE-2 PROTEIN-RELATEDcoord: 1..153
IPR024072Dihydrofolate reductase-like domain superfamilyGENE3DG3DSA:3.40.430.10coord: 1..155
e-value: 1.4E-48
score: 167.2
IPR024072Dihydrofolate reductase-like domain superfamilySUPERFAMILYSSF53597Dihydrofolate reductase-likecoord: 1..154
IPR001796Dihydrofolate reductase domainPFAMPF00186DHFR_1coord: 16..154
e-value: 6.4E-27
score: 94.2
IPR001796Dihydrofolate reductase domainPROSITEPS51330DHFR_2coord: 1..154
score: 37.524
IPR001796Dihydrofolate reductase domainCDDcd00209DHFRcoord: 1..152
e-value: 3.83078E-43
score: 138.04
IPR012259Dihydrofolate reductasePANTHERPTHR22778:SF16DIHYDROFOLATE REDUCTASEcoord: 1..153