Dynein heavy chain axonemal

Overview
NameDynein heavy chain axonemal
Smed IDSMED30007055
Length (bp)11831
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein heavy chain axonemal (SMED30007055) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein heavy chain axonemal (SMED30007055) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein heavy chain axonemal (SMED30007055) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein heavy chain axonemal (SMED30007055) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007055

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007055SMESG000033128.1 SmedASXL_001526SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30007055SMESG000033128.1 SmedASXL_018492SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30007055SMESG000033128.1 SmedASXL_002979SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30007055SMESG000033128.1 SmedASXL_003416SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30007055SMESG000033128.1 SmedASXL_018032SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30007055SMESG000033128.1 SmedASXL_018494SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30007055SMESG000033128.1 SmedASXL_001090SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30007055SMESG000033128.1 dd_Smed_v4_19518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007055SMESG000033128.1 SMESG000065732.1 dd_Smed_v6_6941_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30007055SMESG000033128.1 SMESG000065732.1 dd_Smed_v6_6941_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 1790.78 bits (4637), Expect = 0.000e+0
Identity = 846/1214 (69.69%), Postives = 1004/1214 (82.70%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLM--SQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  MK SRFVK FE +VD WER LS I E +EM+LTVQRQW+YLENIFLGEDIRKQLP ES  FD++N  W+ IM  +N+  NA       GLL+T   MNT LEDIQKSLDMYLETKR+IFPRFYF+SNDDLLEILGQS+NP+ V PHLKKCFDNI  L+I+K+   S  +EA  MFS DGE + F   + LEGPVE+WL D+E+ MRVTLRDLLR+C +AL+K  +KRDKW+KEW+GQ+ IT+SQIQWTADVTK L    +R DKK L++MKK Q  +L K+SEAIR NLTKI RLKI +LV IE+H RD++EKLYKSG  D+N+F+WLSQLRFYWEK++DDCVI+QTNT FQY YEYLGNSGRLVITPLTDRCY+TLTTALHLHRGGSPKGPAGTGKTETVKDLGK+LG YVIVVNCSEGLDYKSMGRM+SGLAQTGAWGCFDEFNRINIEVLSVVA QIL ILSALA+     F F G  I+LV S GIFITMNPGYAGRTELP+NLKSMFRPIAMV PDS +IAEI LF EGF  CK+LAKKV+TLYSL++QQLS+QDHYDFGLRAL S+LRYAG+K+R  P + DEE+LLLSM DMN+AKLTSVD PLF  IV DLFP I+ PV+DY  ++E +E+   +  LQ T FT+TKV QLYETK SRHS MIVG T SGK+ +WR+LQ++L+ L +  +  F    EFPLNPK++SLGELYGE+DL+TNEWTDG+LSSVMR  CAD +PDEKWI+FDGPVDTLWIE+MNSVMDDNK+LTLINGERI+MPEQVSLLFEVE+L++ASPATVSRCGMVY D  DLGW+PYV+SWL+++  +  VE L RMF+K I K+  F K NC EL+     + + SLCKL+  LAT ENG +P+D +NY  ++E+ F F MIWS+C SVDE+GRK+ID+Y+RE+EG+FPNKDT+YEYFVD K +SW  +++KL   W+Y  + PFYKI+VPTVDTVRYNYLV +LV N +P++LVGPVGTGKTS+A + L  L +  W++L +NMSAQT+SNNVQ IIE+RVEKRTK  +VP GGK M+TFMDD NMPAKD FGSQPPLELIR WIDYGFWYDR KQT K I++M+L  AMGPPGGGR +IS RL+SRFN+INMTFPT+S + RIFG+MINQKLQDFEEE+KPIG+++T+AT++MYN VV +FLPTPTK+HYLFNLRDISK
Sbjct: 1410 LSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGLLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKWEAVGMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLALRKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILKVMKKNQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLT-HFHFDGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRETVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAGDPNFNIVREFPLNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWLEKRPKAE-VEPLQRMFEKLINKMLAFKKDNCKELVPLPEYSGITSLCKLYSALATPENGVNPADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRIDSYLREIEGSFPNKDTVYEYFVDPKIRSWTSFEDKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSSLVANQNPILLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRTKQTIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKMHYLFNLRDISK 2621          

HSP 2 Score: 1734.54 bits (4491), Expect = 0.000e+0
Identity = 830/1224 (67.81%), Postives = 1016/1224 (83.01%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q MLR NKD+HDTK+SITRLWIHE FRVF+DR+V   D  AF+ ++S+KLGS FD TFH++CP+K+ PIFGD++     YED+TD+  LK  M+  L+EYN +P VV M LVLFR+AIEHI++I+RVI QPRGNMLLVGIGGSGRQSL RLA+ +C+YT+FQIEV+KHYRKQEFRDD+KRLY QAGV+ K T F+F DTQ+ DESFLEDINNILSSGE+PNLYK DE +++++ + D+A+ + + +++ S+F YLI+RV+ N+H+VLC+SP+G+PFRN IR +PA VNCTTI+WFSEWP +ALLEVAE+ L  + L   G ++ +   +A IF  MH SV+  SQ+ML E++RHNYVTPT YLEL+SGYK LL EKR++L   ANKL+ GL KIDETR KV+VMS+ELE+A+KK+A FQK+C++YLV+IVQQKREAD+Q K+V    E+I V+E KC  + + A  DL +A+PALE AM+ALESLNKKDI EIKSYG+PPA V+ VM+AVMILRG EPTWAEAK+ LGEQ+FIK LINFDKDNISD+ LKKIG Y AQ DFQPD++G+VSLAAKSLCMWV AME+YGR+YRVVEPKR R+ AA + LREKQA LA AQ KL  V E+++ L+++Y+EK+ QKEELRKK+E  E  L+RA  LVSGLAGEK RWE+TV  LE  +G L GDCL+A+AFLSYMGPFL++YR+ +V + W   I + Q+P +PSF+   FL NPT++RDWNIQGLP D FS ENG+IVTRG+RW LM+DPQ QA KWIK MEG + LK+IDL M D++R+LE AI FG PVLLQNVQE LDP+L+P+LNKS+ +IGG  +M++GDKE+EYN +FRFYITTKL NPHY+PE S KT IVNFAVKEQGLEAQLLGIVVRKERPELEEQKD+LV++IAAGKRKL ELEDEILRLLNEA GSLLDD QLVNTL TSKIT+TEVTEQL+ +E TE   D+AR+ Y  CAQRASILFFVLND+G IDPMYQF+LDAYI LF +SI+KS +S K ++RI  LNDYHTYAVY Y CR LFE+HKLLFSF +CAKIL+TSGK+NMDEYNFFL+GGVVLDRE QMDNPC  WL+D  WDNI+ELDKL NFHGL+ SFEQYPRDW+LWYT+ +PE + LPGEW+NA NE QRMLIVRSLR DRV+FC TSFII NLG++F+EPPVL+MK V++DS+ ++ L+F+LSPG
Sbjct: 2624 QGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPPIFGDFLKEPKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESSDSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCLIGVDL---GTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAVEEIKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNAAPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPG 3844          

HSP 3 Score: 924.08 bits (2387), Expect = 0.000e+0
Identity = 461/1032 (44.67%), Postives = 679/1032 (65.79%), Query Frame = 3
Query: 1485 EICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALST---SIGLP--HPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQ------MRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKL-KKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            ++C+CQ HFAR+EDG +  +P F GA+G ++   +L+IE +F  N+  LR  +  ILDVK T WH+DYN+FR+G+KDLEVMTQN IT+AFE V  +  G+ +LD F  L +RE I+RT DK       K +  + L   ELAL     +   P   P + +Y+G A W   LR+RI+R M  L  A FLP   +  +    Y Q+  A++E+VRKT  E+ S LD+D ++ LD  LL  S    GMLD+NF ++LL LF E+ YWERL F+ PHY  ++  R  +LRI RE++LLV RDYNRI+  L+ +E++LFKE+I+ LDKKI PGL K+ W+ KGA  +F+ +CRI+A+++Q  V+E+K +   I    + +S  L+++I   R+Y + EF + Q  HRA V++KL+ LH +++  M  +YE+F  D  +IQQ W LYM ++D+  E+A RLNVK+SL EL+KAINGDG+  P+PLF+V + L+      +  + F PTL  L  +V  +G +    +     + ++L K KL ++ I   +  D++I KIQT I  GM + +S +Q  L  WD +REIWE+NK+ FI +Y  LNP V S  ADI+RYTEV N     E +  ++F+ LD S LK S+  HC +WQ K   LL  MA   L+ LH Y+K  +EK+S+ PQ LEELG S++L+D L  +  +++ +  P+ E F IL+KYEV   D +     +L  EW  F Q L++++QM+KK K+KFKTGL+  +DDFKK+   L+ DF+  G F +++    AL +I   ++ L +++ +E  +R  L +FKIEQPPSK++  LEK+LD ++ IW++A +WE NW +WK+GRF+ L+T  ME  A+  FR+ TK +++ KD+NWEIIE TR++++QF+RTMPLI+DLRN A+R+RHW Q+++EI+++FD+ES  FTLE+I++L  DQH E I E+S +ATKELAIE AL+ + K W+  +L+I+P+KD  K H  L G ++++Q L+DN+  LS 
Sbjct:  390 KVCDCQYHFARWEDGKQGPLPCFFGAQGPQITRNLLEIEDIFHKNLHTLRAVRGGILDVKNTCWHEDYNKFRAGIKDLEVMTQNLITSAFELVRDVPHGVLLLDTFHRLASREAIKRTYDK-------KAVDLYMLFNSELALVNRERNKKWPDLEPYVAQYSGKARWVHILRRRIDRVMTCLAGAHFLPRIGTGKESVHTYQQMVQAIDELVRKTFQEWTSSLDKDCIRRLDTPLLRISQEKAGMLDVNFDKSLLILFAEIDYWERLLFETPHYVVNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRLLDKKIHPGLKKLHWALKGASAFFITECRIHASKVQMIVNEFKASTLTIGWRAQEMSEKLLVRISGKRVYRDLEFEEDQREHRAAVQQKLMNLHQDVVTIMTNSYEVFKNDGPEIQQQWMLYMIRLDRMMEDALRLNVKWSLLELSKAINGDGKTSPNPLFQVLVILKNDLQGSVAQVEFSPTLQTLAGVVNDIGNHLFSTISVFCHLPDILTKRKLHREPIQTVVEQDEDIKKIQTQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIHRYQRLNPPVSSFVADIARYTEVANNVQKEETVTNIQFVLLDCSHLKFSLVQHCNEWQNKFATLLREMAAGRLLELHTYLKENAEKISRPPQTLEELGVSLQLVDALKHDLANVETQIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQMLKKHKEKFKTGLIHSADDFKKKAHTLLEDFEFKGHFTSNVGYMSALDQITQVRAMLMAMREEENSLRANLGIFKIEQPPSKDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETMETTAHGLFRRLTKLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKD--KGHHRLRGTEEVFQALEDNQVALST 1412          

HSP 4 Score: 301.982 bits (772), Expect = 1.119e-80
Identity = 156/327 (47.71%), Postives = 213/327 (65.14%), Query Frame = 3
Query:  270 DEEKSVIDLIRQRIRLSGYVEIENWTADHALQVQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSN 1250
            + E  V  L   R  L+G  +   WT +H   ++         +L  ++    GL+L+   P    N+LVYFI++       I  ENF   +Q GTV G  I +LLR++ G++AP  F+NT WP+SI+N F+  L +F++ LTD R+KLEG TVLYIPAEA     E   K+K+ + R+E  MIHWTRQIKE+LSAQ   E  E+ GPL+EIE+W+NRC DLSGISKQL K GVKH+  IL  AKSSY+  F+KLA +I+  ++QAQSNL FL+ LK+   +L+  KP+DI S L KLI+ IR+IWVNS HYN+R+ +T +FRK+ +
Sbjct:   71 EPEADVKPLFLSRAALTGLAD-AVWTQEHDAILEHFAQDPTESILTIFIDPCFGLKLELGMPVQTQNQLVYFIRQAPVP---ITWENFEATVQFGTVRGPYIPALLRLLGGVFAPQIFANTGWPESIRNHFASHLHKFLACLTDTRYKLEGHTVLYIPAEAMNMKPEMVIKDKELVQRLETSMIHWTRQIKEMLSAQETVETGENLGPLEEIEFWRNRCMDLSGISKQLVKKGVKHVESILHLAKSSYLAPFMKLAQQIQDGSRQAQSNLTFLSILKEPYQELAFMKPKDISSKLPKLISLIRIIWVNSPHYNTRERLTSLFRKVCD 393          
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 1790.78 bits (4637), Expect = 0.000e+0
Identity = 846/1214 (69.69%), Postives = 1004/1214 (82.70%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLM--SQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  MK SRFVK FE +VD WER LS I E +EM+LTVQRQW+YLENIFLGEDIRKQLP ES  FD++N  W+ IM  +N+  NA       GLL+T   MNT LEDIQKSLDMYLETKR+IFPRFYF+SNDDLLEILGQS+NP+ V PHLKKCFDNI  L+I+K+   S  +EA  MFS DGE + F   + LEGPVE+WL D+E+ MRVTLRDLLR+C +AL+K  +KRDKW+KEW+GQ+ IT+SQIQWTADVTK L    +R DKK L++MKK Q  +L K+SEAIR NLTKI RLKI +LV IE+H RD++EKLYKSG  D+N+F+WLSQLRFYWEK++DDCVI+QTNT FQY YEYLGNSGRLVITPLTDRCY+TLTTALHLHRGGSPKGPAGTGKTETVKDLGK+LG YVIVVNCSEGLDYKSMGRM+SGLAQTGAWGCFDEFNRINIEVLSVVA QIL ILSALA+     F F G  I+LV S GIFITMNPGYAGRTELP+NLKSMFRPIAMV PDS +IAEI LF EGF  CK+LAKKV+TLYSL++QQLS+QDHYDFGLRAL S+LRYAG+K+R  P + DEE+LLLSM DMN+AKLTSVD PLF  IV DLFP I+ PV+DY  ++E +E+   +  LQ T FT+TKV QLYETK SRHS MIVG T SGK+ +WR+LQ++L+ L +  +  F    EFPLNPK++SLGELYGE+DL+TNEWTDG+LSSVMR  CAD +PDEKWI+FDGPVDTLWIE+MNSVMDDNK+LTLINGERI+MPEQVSLLFEVE+L++ASPATVSRCGMVY D  DLGW+PYV+SWL+++  +  VE L RMF+K I K+  F K NC EL+     + + SLCKL+  LAT ENG +P+D +NY  ++E+ F F MIWS+C SVDE+GRK+ID+Y+RE+EG+FPNKDT+YEYFVD K +SW  +++KL   W+Y  + PFYKI+VPTVDTVRYNYLV +LV N +P++LVGPVGTGKTS+A + L  L +  W++L +NMSAQT+SNNVQ IIE+RVEKRTK  +VP GGK M+TFMDD NMPAKD FGSQPPLELIR WIDYGFWYDR KQT K I++M+L  AMGPPGGGR +IS RL+SRFN+INMTFPT+S + RIFG+MINQKLQDFEEE+KPIG+++T+AT++MYN VV +FLPTPTK+HYLFNLRDISK
Sbjct: 1410 LSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGLLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKWEAVGMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLALRKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILKVMKKNQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLT-HFHFDGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRETVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAGDPNFNIVREFPLNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWLEKRPKAE-VEPLQRMFEKLINKMLAFKKDNCKELVPLPEYSGITSLCKLYSALATPENGVNPADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRIDSYLREIEGSFPNKDTVYEYFVDPKIRSWTSFEDKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSSLVANQNPILLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRTKQTIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKMHYLFNLRDISK 2621          

HSP 2 Score: 1734.54 bits (4491), Expect = 0.000e+0
Identity = 830/1224 (67.81%), Postives = 1016/1224 (83.01%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q MLR NKD+HDTK+SITRLWIHE FRVF+DR+V   D  AF+ ++S+KLGS FD TFH++CP+K+ PIFGD++     YED+TD+  LK  M+  L+EYN +P VV M LVLFR+AIEHI++I+RVI QPRGNMLLVGIGGSGRQSL RLA+ +C+YT+FQIEV+KHYRKQEFRDD+KRLY QAGV+ K T F+F DTQ+ DESFLEDINNILSSGE+PNLYK DE +++++ + D+A+ + + +++ S+F YLI+RV+ N+H+VLC+SP+G+PFRN IR +PA VNCTTI+WFSEWP +ALLEVAE+ L  + L   G ++ +   +A IF  MH SV+  SQ+ML E++RHNYVTPT YLEL+SGYK LL EKR++L   ANKL+ GL KIDETR KV+VMS+ELE+A+KK+A FQK+C++YLV+IVQQKREAD+Q K+V    E+I V+E KC  + + A  DL +A+PALE AM+ALESLNKKDI EIKSYG+PPA V+ VM+AVMILRG EPTWAEAK+ LGEQ+FIK LINFDKDNISD+ LKKIG Y AQ DFQPD++G+VSLAAKSLCMWV AME+YGR+YRVVEPKR R+ AA + LREKQA LA AQ KL  V E+++ L+++Y+EK+ QKEELRKK+E  E  L+RA  LVSGLAGEK RWE+TV  LE  +G L GDCL+A+AFLSYMGPFL++YR+ +V + W   I + Q+P +PSF+   FL NPT++RDWNIQGLP D FS ENG+IVTRG+RW LM+DPQ QA KWIK MEG + LK+IDL M D++R+LE AI FG PVLLQNVQE LDP+L+P+LNKS+ +IGG  +M++GDKE+EYN +FRFYITTKL NPHY+PE S KT IVNFAVKEQGLEAQLLGIVVRKERPELEEQKD+LV++IAAGKRKL ELEDEILRLLNEA GSLLDD QLVNTL TSKIT+TEVTEQL+ +E TE   D+AR+ Y  CAQRASILFFVLND+G IDPMYQF+LDAYI LF +SI+KS +S K ++RI  LNDYHTYAVY Y CR LFE+HKLLFSF +CAKIL+TSGK+NMDEYNFFL+GGVVLDRE QMDNPC  WL+D  WDNI+ELDKL NFHGL+ SFEQYPRDW+LWYT+ +PE + LPGEW+NA NE QRMLIVRSLR DRV+FC TSFII NLG++F+EPPVL+MK V++DS+ ++ L+F+LSPG
Sbjct: 2624 QGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPPIFGDFLKEPKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESSDSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCLIGVDL---GTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAVEEIKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNAAPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPG 3844          

HSP 3 Score: 924.08 bits (2387), Expect = 0.000e+0
Identity = 461/1032 (44.67%), Postives = 679/1032 (65.79%), Query Frame = 3
Query: 1485 EICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALST---SIGLP--HPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQ------MRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKL-KKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            ++C+CQ HFAR+EDG +  +P F GA+G ++   +L+IE +F  N+  LR  +  ILDVK T WH+DYN+FR+G+KDLEVMTQN IT+AFE V  +  G+ +LD F  L +RE I+RT DK       K +  + L   ELAL     +   P   P + +Y+G A W   LR+RI+R M  L  A FLP   +  +    Y Q+  A++E+VRKT  E+ S LD+D ++ LD  LL  S    GMLD+NF ++LL LF E+ YWERL F+ PHY  ++  R  +LRI RE++LLV RDYNRI+  L+ +E++LFKE+I+ LDKKI PGL K+ W+ KGA  +F+ +CRI+A+++Q  V+E+K +   I    + +S  L+++I   R+Y + EF + Q  HRA V++KL+ LH +++  M  +YE+F  D  +IQQ W LYM ++D+  E+A RLNVK+SL EL+KAINGDG+  P+PLF+V + L+      +  + F PTL  L  +V  +G +    +     + ++L K KL ++ I   +  D++I KIQT I  GM + +S +Q  L  WD +REIWE+NK+ FI +Y  LNP V S  ADI+RYTEV N     E +  ++F+ LD S LK S+  HC +WQ K   LL  MA   L+ LH Y+K  +EK+S+ PQ LEELG S++L+D L  +  +++ +  P+ E F IL+KYEV   D +     +L  EW  F Q L++++QM+KK K+KFKTGL+  +DDFKK+   L+ DF+  G F +++    AL +I   ++ L +++ +E  +R  L +FKIEQPPSK++  LEK+LD ++ IW++A +WE NW +WK+GRF+ L+T  ME  A+  FR+ TK +++ KD+NWEIIE TR++++QF+RTMPLI+DLRN A+R+RHW Q+++EI+++FD+ES  FTLE+I++L  DQH E I E+S +ATKELAIE AL+ + K W+  +L+I+P+KD  K H  L G ++++Q L+DN+  LS 
Sbjct:  390 KVCDCQYHFARWEDGKQGPLPCFFGAQGPQITRNLLEIEDIFHKNLHTLRAVRGGILDVKNTCWHEDYNKFRAGIKDLEVMTQNLITSAFELVRDVPHGVLLLDTFHRLASREAIKRTYDK-------KAVDLYMLFNSELALVNRERNKKWPDLEPYVAQYSGKARWVHILRRRIDRVMTCLAGAHFLPRIGTGKESVHTYQQMVQAIDELVRKTFQEWTSSLDKDCIRRLDTPLLRISQEKAGMLDVNFDKSLLILFAEIDYWERLLFETPHYVVNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRLLDKKIHPGLKKLHWALKGASAFFITECRIHASKVQMIVNEFKASTLTIGWRAQEMSEKLLVRISGKRVYRDLEFEEDQREHRAAVQQKLMNLHQDVVTIMTNSYEVFKNDGPEIQQQWMLYMIRLDRMMEDALRLNVKWSLLELSKAINGDGKTSPNPLFQVLVILKNDLQGSVAQVEFSPTLQTLAGVVNDIGNHLFSTISVFCHLPDILTKRKLHREPIQTVVEQDEDIKKIQTQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIHRYQRLNPPVSSFVADIARYTEVANNVQKEETVTNIQFVLLDCSHLKFSLVQHCNEWQNKFATLLREMAAGRLLELHTYLKENAEKISRPPQTLEELGVSLQLVDALKHDLANVETQIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQMLKKHKEKFKTGLIHSADDFKKKAHTLLEDFEFKGHFTSNVGYMSALDQITQVRAMLMAMREEENSLRANLGIFKIEQPPSKDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETMETTAHGLFRRLTKLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKD--KGHHRLRGTEEVFQALEDNQVALST 1412          

HSP 4 Score: 301.982 bits (772), Expect = 1.119e-80
Identity = 156/327 (47.71%), Postives = 213/327 (65.14%), Query Frame = 3
Query:  270 DEEKSVIDLIRQRIRLSGYVEIENWTADHALQVQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSN 1250
            + E  V  L   R  L+G  +   WT +H   ++         +L  ++    GL+L+   P    N+LVYFI++       I  ENF   +Q GTV G  I +LLR++ G++AP  F+NT WP+SI+N F+  L +F++ LTD R+KLEG TVLYIPAEA     E   K+K+ + R+E  MIHWTRQIKE+LSAQ   E  E+ GPL+EIE+W+NRC DLSGISKQL K GVKH+  IL  AKSSY+  F+KLA +I+  ++QAQSNL FL+ LK+   +L+  KP+DI S L KLI+ IR+IWVNS HYN+R+ +T +FRK+ +
Sbjct:   71 EPEADVKPLFLSRAALTGLAD-AVWTQEHDAILEHFAQDPTESILTIFIDPCFGLKLELGMPVQTQNQLVYFIRQAPVP---ITWENFEATVQFGTVRGPYIPALLRLLGGVFAPQIFANTGWPESIRNHFASHLHKFLACLTDTRYKLEGHTVLYIPAEAMNMKPEMVIKDKELVQRLETSMIHWTRQIKEMLSAQETVETGENLGPLEEIEFWRNRCMDLSGISKQLVKKGVKHVESILHLAKSSYLAPFMKLAQQIQDGSRQAQSNLTFLSILKEPYQELAFMKPKDISSKLPKLISLIRIIWVNSPHYNTRERLTSLFRKVCD 393          
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 1163.67 bits (3009), Expect = 0.000e+0
Identity = 569/832 (68.39%), Postives = 676/832 (81.25%), Query Frame = 3
Query: 9342 KIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            KIDETR KV+VMS+ELE+A+KK+A FQK+C++YLV+IVQQKREAD+Q K                                       ALESLNKKDI EIKSYG+PPA V+ VM+AVMILRG EPTWAEAK+ LGEQ+FIK LINFDKDNISD+ LKKIG Y AQ DFQPD++G+VSLAAKSLCMWV AME+YGR+YRVVEPKR R+ AA + LREKQA LA AQ KL  V E+++ L+++Y+EK+ QKEELRKK+E  E  L+RA  LVSGLAGEK RWE+TV  LE  +G L GDCL+A+AFLSYMGPFL++YR+ +V + W   I + Q+P +PSF+   FL NPT++RDWNIQGLP D FS ENG+IVTRG+RW LM+DPQ QA KWIK MEG + LK+IDL M D++R+LE AI FG PVLLQNVQE LDP+L+P+LNKS+ +IGG  +M++GDKE+EYN +FRFYITTKL NPHY+PE S KT IVNFAVKEQGLEAQLLGIVVRKERPELEEQKD+LV++IAAGKRKL ELEDEILRLLNEA GSLLDD QLVNTL TSKIT+TEVTEQL+ +E TE   D+AR+ Y  CAQRASILFFVLND+G IDPMYQF+LDAYI LF +SI+KS +S K ++RI  LNDYHTYAVY Y CR LFE+HKLLFSF +CAKIL+TSGK+NMDEYNFFL+GGVVLDRE QMDNPC  WL+D  WDNI+ELDKL NFHGL+ SFEQYPRDW+LWYT+ +PE + LPGEW+NA NE QRMLIVRSLR DRV+FC TSFII NLG++F+EPPVL+MK V++DS+ ++ L+F+LSPG
Sbjct:    1 KIDETREKVQVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQK---------------------------------------ALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNAAPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPG 793          
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 1061.6 bits (2744), Expect = 0.000e+0
Identity = 543/1240 (43.79%), Postives = 787/1240 (63.47%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKI-----------------EKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASK-RDKWI-KEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSK-ERESQFEKALE-FPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLK---RKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPS-DTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM-----EGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDI-WTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            + +SR++ P +  VD+W++ L+   +T+E  LT QR WLYLE+IF   DI++QLP E+  F +++K W+ IM ++N++ NA     + GLLETF   N  L+ IQK L+ YLE+KR IFPRFYF+SND+LLEIL Q++NP  V PHL+KCFD+I+ L+                  EK+ +    A  M S +GE V   + L+  G VE WL  +E+ M  +LR L   C+ A+     K R  W+      Q+ +T SQI W  D+T+ L+     N  + L+  +K     L   +  ++ +L K+ R  + +L+ I+VH RDI+ +L +S    + +F+W  QLR+YW+ ++D+CV +   + + YGYEYLG   RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK MGR FSGLAQ+GAW CFDEFNRI+IEVLSV+AQQ+++I +A A+    +FMF+GR I LV +   FITMNPGYAGRTELPDNLK++FRP AM+ P+ A+IAE+ L++EGF   K+LA+K+  +Y L  +QLS+QDHYDFG+RA+ SVL  AG  KR NP + ++ +L+ ++ D NL K  + D  LF GI+SDLFPG+  P  DY  ++  I    +   LQP    + KV+Q YET   RH VM+VG T  GK+T +R+L   L  L K   E+ F +A++ + LNPKS+++GELYGE +  T EW DG+++  +R    DT  D KWII DGPVD LWIE+MN+V+DDNK+L L N ERI +  Q+ +LFEV++L VASPATVSRCGMV+ D  +L W PYV++W+K   +K+     E +  +F +Y+++  +FI   C + I     + V +LC L + L   ++G + + +    + ++   F FC +WS+  ++ E+     D +IR       +   PN   ++   +D   K    W E++   +KYN  VPF++++VPT DTVRY YL++ L+   H V+  G  G GK+ +A   LN++     +  + +N SAQTSS   Q+IIE+++E++ K+     G KR++ F+DD NMP  D +GSQPP+EL+RQ+ D+G +YDR K   K I+D+ +  A  PPGGGR  ++ R    F+++ +  P+E +LK+IF +++N  L DF   +K     I +A++E+YN + +  LPTP K HY+FNLRD+SK
Sbjct: 1071 LASSRYLGPLKTRVDEWQKQLALFNQTLEEWLTCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPAEGKIPGIDGEPEKVYTNDILA--MLSPEGERVSLGKGLKARGNVEEWLGKVEEAMFTSLRRL---CKAAIADYQGKLRTDWVVAGHPSQVILTVSQIMWCRDLTECLE-TEHSNHIQALKNFEKVNFERLNALAAIVQGSLPKLHRNILTALITIDVHARDIVTELVQSKVETVESFDWQRQLRYYWDIDLDNCVARMALSQYTYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKL-SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLNEDVVLIRALQDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVDVMNRQNLQPEMCMVRKVIQFYETMLVRHGVMLVGPTGGGKTTVYRILAETLGNLQKLGIENSFYQAVKTYVLNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMKGISKKLTEETQEYILNLFQRYVDEGLHFINKKCSQAIPQVDISKVTTLCCLLESLILGKDGVNLAMEQTKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIRTQFDDNPDARLPNSGDLWSIHMDFDTKRLDPW-ERIIPTFKYNRDVPFFEMLVPTTDTVRYGYLMEKLLAVKHSVLFTGITGVGKSVIAKGLLNKIQESAGYVPVYLNFSAQTSSARTQEIIESKLERKRKNILGAPGNKRIVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIISACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLSDFPPAVKQTASSIVEASVEIYNKMSVDLLPTPAKSHYVFNLRDLSK 2302          

HSP 2 Score: 979.163 bits (2530), Expect = 0.000e+0
Identity = 524/1239 (42.29%), Postives = 786/1239 (63.44%), Query Frame = 3
Query: 8214 ITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMS-----STDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGI-EDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQE---RIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDK-LANFHGL------------ITSFEQY--PRDWNLWYTSDSPETSSLPGE--------WDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            I RL+ HE  RVF DR++ ++DK  F  +L+E     F           +  IFGD++      +   Y+D+ DIEK    +++ LD+YN T    ++ LV F+DAIEH+S+I R+IRQ RGN LLVG+GG+G+QSLTRLAA++C Y   QIE+S+ Y    F +DL++LY  AGV++K  +FLF DTQ+V E FLEDINNIL+SGE+PNL+++DE++ +       AK  GI E     +F Y I +VR  +H+VLCMSPVGE FR+R RMFP+ VNC TIDWF +WP +ALL V++ +    Q+  G EE  +K  L  +   +H SVS M++R  +E++R  Y TPT+YLEL++ Y  +L EKRKQ+  + +++KNGL K+ ET   V+ M ++L  A + + + + E  + L+  +   +E+ DQ ++ +Q  E   ++K +E + +   + A  DL +A+PAL+AA +AL+SL+K DI+EI+ + KPP LV  VMEA+ IL  A+P W  AK+ LG+ +F+K+L+ +DK+NI  + L K+  Y+   DF P+ V KVS A KS+CMWV AM++Y RV +VVEPKRQ+L+AA++ L    A L   QA L  V ++++ LQ EY++ + +KE L K    T+  L RA KL + L  E+ RWE+++   E +I  + G+  IA+A ++Y G F + YR++L+  W +  +  +IP +PSFS I  L +P +IR WN  GLPRD  S ENG++VT+G RWPLM+DPQ QA +WI+  E K  LK+I L   +F+R+LE +I+ G PVLL+ ++E LDP+L+PIL K I   GG  +++LGD +I+Y+ +FRFY+TTK+PNPHY PE+  K  I+NF V + GLE QLL  VVR E+P LEEQ+  L++ I   K +L  +E++ILR+L  ++G++LD+E+L++TLQ SKITS  +  +L+ AE TE  I++AR+ Y   A + S+++FV+  L +IDPMYQ++L  +  LFN +I  S K+    +R+  L +      Y    RGLFE+HKL++SF +C ++++  G ++  E+NFFL+G   L++E       P WL    W    +L++    FHGL            + SFE Y  P+ W   Y+    E   +  E        W    + F ++++++  + ++V F  T F+I NLG +F+E P +D+  +  D S  T L+F+LS G
Sbjct: 2321 IFRLFCHECQRVFHDRLINNEDKHYFHVILTEMANKHFGIAIDLEYFLNKPIIFGDFIKFGADKADRIYDDMPDIEKTANVLQDYLDDYNLT-NPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCLQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDELEQVLAATRPRAKEVGISEGNRDEVFQYFISKVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKTFFS--QVDAGNEE--LKEKLPLMCVNVHLSVSSMAERYYNELRRRYYTTPTSYLELINLYLSMLSEKRKQIISARDRVKNGLTKLLETNILVDKMKLDLS-ALEPVLLAKSEDVEALMEKLAVDQESADQVRNTVQEDEATAKVKAEETQAIA--DDAQRDLDEALPALDAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDWPSAKQLLGDSNFLKRLLEYDKENIKPQILAKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKVVEPKRQKLRAAQAELDITMATLREKQALLRQVEDQIQALQDEYDKGVNEKESLAKTMALTKARLVRAGKLTAALEDEQVRWEESIQKFEEEISNITGNVFIAAACVAYYGAFTAQYRQSLIECWIQDCQSLEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKIIKLTDSNFLRILENSIRLGLPVLLEELKETLDPALEPILLKQIFISGGRLLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPRLEEQRIKLIVRINTDKNQLKTIEEKILRMLFTSEGNILDNEELIDTLQDSKITSGAIKTRLEEAESTEQMINVAREKYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSVKTENLQQRLDVLLEQTLLTAYVNVSRGLFEQHKLIYSFMLCVEMMRQQGTLSDAEWNFFLRGSAGLEKERPPKPEAP-WLPTATWFACCDLEESFPVFHGLTQNILSHPISIRLGSFETYINPQKWE-GYSKMKHEDKHMRQEKEAAHQDPWSAGLSSFHKLILIKCCKEEKVVFALTDFVIENLGKQFIETPPVDLPTLYQDMSCNTPLVFILSTG 3549          

HSP 3 Score: 87.8113 bits (216), Expect = 4.957e-16
Identity = 56/221 (25.34%), Postives = 108/221 (48.87%), Query Frame = 3
Query: 3864 NFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            N +S L  L+ +  + +     FK+E    + +  +  +L   + +W    EW+    +W   +F  L    +    +   +  T+  + L   +  ++   + +V++ +  +P+I DLRN  ++ RHW  I+  +     +     TLE++  L+     + I ++SG A+ E A+E  LK +E  W++ E  I+PH+D  K+ F+L G DD+   LDD+
Sbjct:  847 NLQSVLADLQKRAFQYKSYQKNFKVEVSKFEALEEVSAELKLKQLLWDSFSEWDKLQQEWLKSKFDCLDPEVLNGQVSKYAKFVTQLEKGLPPNS--VVPQLKYKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDATLVDAEIPLTLERLSQLHVFDFGQEIQDISGQASGEAALEAILKKVEDSWKTTEFVILPHRDS-KDVFILGGTDDIQVLLDDS 1064          
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Match: DNAH1 (dynein axonemal heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2940])

HSP 1 Score: 1027.7 bits (2656), Expect = 0.000e+0
Identity = 549/1256 (43.71%), Postives = 776/1256 (61.78%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERE---SQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLV---EELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLAT---VENGCDPSDTDNYSRVIEL---WFQFCMIWSICCSVDEDGRKKIDNYIR-EMEGT-----FPNKDTIYEYFVDNK-----NKSWGHWDEKLKAGWK--YNASVPFY--------KIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKT-SVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDR-LKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKL------QDFEEELKPIGDI------ITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            M  S + KPFE  ++ WE  L   QE +E  L  QR WLYLE IF  EDI +QLP ES  +  + + W+ IM    + R          +L++    N  L+ +QK L  YLETKR+ FPRFYF+S+D+LLEIL Q+K+P  V PHL+KCF+NI  L    L  +  E + M+S++GEEV     +     VE WL ++E+ M+ ++ D++     A       R +W+  W GQ+ I   Q  WT +V +AL+    R+   P ++ ++   LV       +R  L+++QR  +++L+VIEVH +D++ KL +     +N F+W+SQLR+YW    +D  I+  N  F YGYEYLGNSGRLVITPLTDRCY+TLT ALHL  GG+P GPAGTGKTET KDLGK+L    +V NCS+ LD+ +MG+ F GLA  GAW CFDEFNRI+IEVLSVVAQQI +I  A       +FMF+G  I LVPS  +FITMNPGYAGRTELPDNLK++FRP+AM+ PD AMI EI+L++ GF+   VLAKK+ T + LS +QLS QDHYDFG+RA+ +V+  AG  KR NP M +E I L ++ D+N+ K    DL LF GIVSDLFP I     DY  + EAI + C N  L+     +TK +QLYET   RH +M+VG T SGKST +R+L +A+  L  +       +E    + LNPKS+++G+LYGEFDL T+EWTDG+ SS +R     +  ++KW +FDGPVD +WIE+MN+V+DDNK L L +GE I + E ++++FEV++L+VASPATVSRCGMVY + + LG  P++E WL RK+  +L    E    +F  ++E+  +F++ +  E+I ++  N  +SL KL DC         G     ++  SR++EL   WF F +IWS+  + D  GR    +++R +ME       FP +  +++Y +++      N S    +E  +  W    ++S PF          IIVPT+DTV+ ++L+  L+ N  PV+ +GP GTGKT +++   L  L  D  +   +  SA+TS+N  QD I+++++KR K  F P  G+  + F+DD NMPA +T+G+QPP+EL+RQW+D+G WYDR +    K + D+    AMGPPGGGR  ++ RL   FN ++     E + KRIF +++   L      + + E +     I      + +ATI +Y  +  + LPTP K HY FNLRD+SK
Sbjct: 1207 MSFSPYKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDINQQLPVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSEYLETKRSAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARL----LFQEDLEITHMYSAEGEEVQLCFSIYPSSNVEDWLREVERSMKASVHDIIEKAIRAY--PTMPRTQWVLNWPGQVTIAGCQTYWTMEVAEALEAGNLRSQLFP-QLCQQLSDLV-----ALVRGKLSRMQRAVLSALIVIEVHAKDVVSKLIQENVVSVNDFQWISQLRYYWTN--NDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVE-RFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMITEISLYSFGFNEASVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPSMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEDTDYGILDEAIREACRNSNLKDVEGFLTKCIQLYETTVVRHGLMLVGPTGSGKSTCYRVLAAAMTSLKGQPSISGGMYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSFIRAGAITSDTNKKWYMFDGPVDAIWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFIECWL-RKLPPLLKPYEEHFKALFVSFLEESISFVRSSVKEVIASTNCNLTMSLLKLLDCFFKPFLPREGLKKIPSEKLSRIVELIEPWFIFSLIWSVGATGDSSGRTSFSHWLRLKMENEQLTLLFPEEGLVFDYRLEDAGISGTNDSEDEEEEYKQVAWVKWMDSSAPFTMVPDTNYCNIIVPTMDTVQMSHLLDMLLTNKKPVLCIGPTGTGKTLTISDKLLKNLALDYISHF-LTFSARTSANQTQDFIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNTVTPRLMRHFNYLSFAEMDEVSKKRIFSTILGNWLDGLLGEKSYRERVPGAPHIAHFTEPLVEATIMVYATITSQLLPTPAKSHYTFNLRDLSK 2445          

HSP 2 Score: 960.674 bits (2482), Expect = 0.000e+0
Identity = 523/1246 (41.97%), Postives = 772/1246 (61.96%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSS---TDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREAD--DQAKSVMQTQERIKVDEAKCLKMQELA---LADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPT--------------WAEAKKHLGEQ-DFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQME-GKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q ML  +    + +  + RLW HEN RVF DR+V ++D+  F +LL ++    ++ TF+ +CP  Q  ++GD+MS      +YE IT   K+ + ++E +++YN      ++ LVLF DA+ HI +I R +RQ  GN LL+G+GGSGR SLTRLA++M EY  FQIE+SK+Y   E+RDD+K++  +AG+ N P  FLF+DTQ+ +ESFLEDINN+L+SG+IPNLY  DE D + + +    +  G++ T  ++      RVR N+H+VLCMSP+GE FR R+R FP+ VNC TIDWF+EWP +AL  VA  +L ++      +E+     L  +   +H+SVS      L E+ RHNYVTP +YLEL+  + IL+ +K+ +L  + N++K+GL K+  T   V  M  +LE       + ++   D ++ + Q K +    ++ ++ +QT+E IK +E K  K Q +A     DL +A+PAL+AA+ +L +LNK D+TE+++  +PP  V+ V+EAV I++G +P               W   K  L +   F++ L  FDKDNI D  +K I  Y+  ++FQP  + KVS A  S+C WV AM  Y  V + VEPKRQ L  A+  L   Q  L  A+ +L  V + +  +Q +Y E + +KEEL  K E  E+ L RA KL++GL+ EK RW++TV +L+  +  + GD L+A+ F++Y+GPF   YR  L   W + ++   +P     + I  L NP +IR W I GLP D  SVENGVI     RW   +DPQ QA KWIK ME    L V  L   DF+R +E AI+FG+P LL+NV E+LDP+L+P+L K   K  G TV+KLGD  I Y+ DFR YITTKLPNPHYTPEISTK  ++NF +   GLE QLLG VV +ERP+LEE K+ L++S A  +++L ++ED+IL  L+ ++G+ +DD +L+  L+ SK+ + E+  +++IAE+TE  ID+ R  Y   A R  ILFF ++DL  +DPMYQ++L+ ++++F   I  S ++    +RISN+N Y TY++Y   CR LFEKHKL+F+F +C +I+   GK+N  E+ + L GG +       +NP P WLSD+AW +I  L  L  F    + F ++  ++ + + S  P    LPG WD   ++FQ++L++R LR D+V+     F+  NL  +F+EP   ++  V  DS++ T LIFVLSPG
Sbjct: 2448 QGMLMADPAKVEDQVQLLRLWYHENCRVFRDRLVNEEDRSWFDQLL-KRCMEQWEVTFNKVCPF-QPILYGDFMSPGSDVKSYELITSESKMMQVIEEYIEDYNQI-NTAKLKLVLFMDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWRDDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNLYTADEQDQIVSTMRPYIQEQGLQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATVFLNEIPELESSQEEIQG--LIQVCVYIHQSVSKKCIEYLAELTRHNYVTPKSYLELLHIFSILIGQKKLELKTAKNRMKSGLDKLLRTSEDVAKMQEDLESMH---PLLEEAAKDTMLTMEQIKVDTAIAEETRNSVQTEE-IKANE-KAKKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGTKVDDYWEPGKGLLQDPGHFLESLFKFDKDNIGDVVIKAIQPYIDNEEFQPATIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALLEAQDDLGVTQRILDEAKQRLREVEDGIATMQAKYRECITKKEELELKCEQCEQRLGRAGKLINGLSDEKVRWQETVENLQYMLNNISGDVLVAAGFVAYLGPFTGQYRTVLYDSWVKQLRSHNVPHTSEPTLIGTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQSQANKWIKNMEKDNGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDTVIPYHEDFRMYITTKLPNPHYTPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIISNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAIRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRISNINRYLTYSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQSEWRYLLSGGSI---SIMTENPAPDWLSDRAWRDILALSNLPTFSSFSSDFVKHLSEFRVIFDSLEPHREPLPGIWDQYLDQFQKLLVLRCLRGDKVTNAMQDFVATNLEPRFIEPQTANLSVVFKDSNSTTPLIFVLSPG 3680          

HSP 3 Score: 94.3597 bits (233), Expect = 5.966e-18
Identity = 123/579 (21.24%), Postives = 246/579 (42.49%), Query Frame = 3
Query: 2874 INGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKKSIWE--FISTDDEITKIQTN------IRHGMQDISSSIQEPL-GYWDQFREIWELNKEE---FISQYCD---LNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFI-ILDKYEVQYSDDIRLKKQNLEKEW------QEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSAL---IMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQ-WKSGRFIELKTIEMENLANSSFRKATKFSRDLKD--KNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            IN   R   +PLF + L L    + +   L +    + +L    I     +P         +L+K + E  FIS D  +  +  +      +R  +    S    PL  Y  ++R+  ELN  +   F+  Y     L   V  +     R  E+ + +L +  ++   ++  D   +K S++   +     + ++L     K +  +    +++S K+ + P ++EEL E       L E    I E+   L+E  + ++D Y+V       L   +   +W       + L  +   +Q   + ++KF+   ++  ++F++++  L   +  F  +   + +    E   ++   K  L+  +           +F +      +++ + K+     ++W  A +W   W++ W +     +   ++E     +F+   K  +  KD     E+    R R+++F+  +PLI  LRN  MR RHW  + N+I        ++ T  + +++N   H E I++V+  A KE AIE AL  MEK W ++   ++P+K  +   ++L   D+  Q LDD+
Sbjct:  647 INSPYRPRKNPLFIMDLVLDSSGVHYSTPLEQFEASLLNLFDKGILATHAVP---------QLEKLVMEDIFISGDPLLESVGLHEPLVEELRATIASAVSKAMIPLQAYAKEYRKYLELNNNDIASFLKTYQTQGLLAQEVREVVLTHLREKEILDSSLPSSIIIGPFYINTD--NVKQSLSKKRKALATSVLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAE-------LREWMKGIPERLVGLEERIVKVMDDYQVMDEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFSIHVEISRA---HEIANEVRRVKKQLKDCQQLAMLYNNRERIFSLPITNYDKLSRMVKEFQPYLDLWTTASDW-LRWSESWMNDPLSAIDAEQLEKNVVEAFKTMHKCVKQFKDMPACQEVALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININV-RPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYKATDT--YILKSPDEASQLLDDH 1200          
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 328/847 (38.72%), Postives = 482/847 (56.91%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGE-DIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEV-LFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKK------AASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWE-KEIDD---CVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKR---------ANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCD-------NFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPD---EKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVY 6981
            L  MK S + K FE     W+  L+ I    ++ + VQR+W+YLE +F G  +I   LP ES+ F  I      +M ++            +G       +   L  IQK+L  YLE +R+ FPRFYF+ ++DLLEI+G SK+  ++  HLKK F  I ++ I +   +    ++  S +GE+V L K     +  +  WL  LE  M+ TL   L        K            +W+ ++  Q+   +++I W  ++ K L       D K    +++     LE  ++++      I+R K+ +L+   VH+RD   KL        N F WL  +RFY++ K++D    CV+K  N+ F YG+EYLG   RLV TPLTDRCY+T+T ALH   GGSP GPAGTGKTE+VK LG  LG +V+V NC E  D+++MGR+  GL Q GAWGCFDEFNR+   +LS V+QQI +I  A+ +         G+ +++  ++GIFITMNPGY+GR+ LPDNLK +FR +AM  PD  +IA++ LF++GF   + LA K+  L+ L  +QLS Q HYDFGLRAL  VL  AG  KR         A   + ++++L+ S+ +  + KL + D+ L   ++SD+FPGI         +++ +   CD       + Q +  +  + KV+QLY+     H +M+VG + SGK+  W++L  AL     ER    E  +   ++ K++S   LYG  D NT EWTDG+ +SV+RK   + R +    +WIIFDG VD  W+E++NSV+DDNK+LTL NGER+S+P  V ++FEV +L  A+ ATVSRCGMV+
Sbjct: 1471 LSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINE---EDRSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLA------DGKGAENVEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKAL-----ERWENVE-GVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVW 2302          

HSP 2 Score: 89.7373 bits (221), Expect = 0.000e+0
Identity = 69/309 (22.33%), Postives = 156/309 (50.49%), Query Frame = 3
Query: 3645 LKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRR---GLNLFKIEQPPSK--EIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSNEDIS 4556
            L  +N+E EW  F + L   +  I+      +T    + +  +K+    + ++  + P   +  PQEAL  I  F++ L  L  +  ++R+    L+L      PS+  ++    ++L  ++++WK      T   + K   ++ ++  ++    +    +  +    +K + ++  E+ +  +  + +   L+ +L++EA+++RHW Q+  E+R  ++   SD TL ++ D +  +H   I ++   A  E+A+E  L+ M + W++ E+E++ +++K +   L+ G DDL+  L +++N+LS   +S
Sbjct: 1176 LYSENVEGEWSAFTEILSLRDASIQTQMMNLQTKFAQEDELVEKRTVETLTEWNKSKPVEGAQRPQEALNVITAFEAKLNKLTEERNKMRKARVALDLSDSAHAPSEGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLP--VKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWN--LSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTR---LIKGWDDLFNKLKEHQNSLSAMKLS 1477          

HSP 3 Score: 498.819 bits (1283), Expect = 3.143e-161
Identity = 323/1249 (25.86%), Postives = 624/1249 (49.96%), Query Frame = 3
Query: 8214 ITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNIC----PNKQSPIFGDYMSSTD---TYEDITDI--EKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDG-IEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEED--RMKPH-------------LATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAE--PTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWI-KQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSIN----KSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQT--SGKMNMDEYNFFLKGGVVLDRENQMDNPCPG---WLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEF-------QRMLIVRSLRPDRVSFCATSFIINNLGNKFVEP-PVLDMKQVVDDSSAKTCLIFVLS 11825
            + RLW HE  R+F DR+V ++++    E   + + +  ++ F N C      K+  ++  ++S      T E++ D    +LK F +E LD          + LVLF   ++H+ +I R+ RQ +G++LL+G  G+G+ +L+R  A++   + FQ++V   Y   +F +D++ +  +AG  N+   F+ +++ ++D  FLE +N +L++GE+P L++ DE   L  Q+ + A+R G I D+   ++ +   +V  N+HVV  M+P G   R R    PA  N   ++WF +W  +AL +V     + + L     E   R+ P              +     L+H++V   ++    +  R    TP ++L+ +  +  L  EKR  L +    L  GL KI ET  +V+ +   L+    +L   ++  +  L  ++  +++A+++ K   Q Q+ +     +  + +     DLAQ  PA+  A  A++ + K  + E+KS   PP  V+  +EA+ IL G      W   ++ + + DF+ +++ FD + ++   LK++  Y+   D++ D V + S+A   +  W  A  +Y  +   VEP R  L+  E    +K  +      ++  + E + + ++EY + + Q E +++     ++ ++R+++L+S L  E+DRW    A    Q+  L GD L++SAFL+Y G +    R+ +  KW   +    +      + IE+LS       W +  LP D    EN +++ R +R+PL++DP  QA ++I KQ  GK ++        F + LE A++FG  +L+Q+V E  DP L+P+LN+ + + GG  ++ +GD++I+ +  F+ ++ T+     ++P+I ++   VNF V    L +Q L  V+R ERP++++++++L+        +L  LE  +L  LNE++G +LDD  ++ TL+  K  + EV ++    +K    +D     Y   +   S ++  L  L +I  +Y ++LD  +++F   +      ST    +  RI   + + T  V+    RG+    K+L +  +    +++  S       ++  L     + + ++ D+  PG   +L+ +   +I++  K+  F  +    +        W T+D+PE S++P  WD+A  +          +++V +LRPDR+   A   +     + F++   V+D+  +VD+  + +  + + S
Sbjct: 2763 LVRLWAHEAIRLFQDRLVTEEER----EWTDKLVDTTAERYFGNACRLDEALKRPLLYSCWLSRNYVPVTREELQDYVSARLKGFYEEELD----------VKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQT--VFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPE-SNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCS 3993          

HSP 4 Score: 92.8189 bits (229), Expect = 3.143e-161
Identity = 66/308 (21.43%), Postives = 146/308 (47.40%), Query Frame = 1
Query: 7267 MIWSICCSVDEDGRKKIDNYIREMEGTF--PNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVE-KRTKDTFV--PVG-GKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGG-GRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            ++W+         R+ + ++IR+       PN+      +    +  W  W  K+      +  V    ++VPT+DTVR+  L+   +    P++L GP G+GKT   +  L   +     ++ +N S+ T+   +    +   E +RT +  V  PV   + ++ F D+ N+PA D +G+Q  +  +RQ ++   +Y     +   ++ +    A  PP   GR  +++R      ++ + +P +++L++I+G+  N+ +      ++ + D +T A +++Y      F     + HY+++ R++++
Sbjct: 2440 LVWAFSGDGKWKSREMMSDFIRQATTISLPPNQQACLIDYEVQLSGDWQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALR--SQQEMEVVNVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT-FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHF-TQDDQPHYVYSPRELTR 2743          
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 328/847 (38.72%), Postives = 482/847 (56.91%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGE-DIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEV-LFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKK------AASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWE-KEIDD---CVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKR---------ANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCD-------NFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPD---EKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVY 6981
            L  MK S + K FE     W+  L+ I    ++ + VQR+W+YLE +F G  +I   LP ES+ F  I      +M ++            +G       +   L  IQK+L  YLE +R+ FPRFYF+ ++DLLEI+G SK+  ++  HLKK F  I ++ I +   +    ++  S +GE+V L K     +  +  WL  LE  M+ TL   L        K            +W+ ++  Q+   +++I W  ++ K L       D K    +++     LE  ++++      I+R K+ +L+   VH+RD   KL        N F WL  +RFY++ K++D    CV+K  N+ F YG+EYLG   RLV TPLTDRCY+T+T ALH   GGSP GPAGTGKTE+VK LG  LG +V+V NC E  D+++MGR+  GL Q GAWGCFDEFNR+   +LS V+QQI +I  A+ +         G+ +++  ++GIFITMNPGY+GR+ LPDNLK +FR +AM  PD  +IA++ LF++GF   + LA K+  L+ L  +QLS Q HYDFGLRAL  VL  AG  KR         A   + ++++L+ S+ +  + KL + D+ L   ++SD+FPGI         +++ +   CD       + Q +  +  + KV+QLY+     H +M+VG + SGK+  W++L  AL     ER    E  +   ++ K++S   LYG  D NT EWTDG+ +SV+RK   + R +    +WIIFDG VD  W+E++NSV+DDNK+LTL NGER+S+P  V ++FEV +L  A+ ATVSRCGMV+
Sbjct: 1471 LSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINE---EDRSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLA------DGKGAENVEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKAL-----ERWENVE-GVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVW 2302          

HSP 2 Score: 89.7373 bits (221), Expect = 0.000e+0
Identity = 69/309 (22.33%), Postives = 156/309 (50.49%), Query Frame = 3
Query: 3645 LKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRR---GLNLFKIEQPPSK--EIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSNEDIS 4556
            L  +N+E EW  F + L   +  I+      +T    + +  +K+    + ++  + P   +  PQEAL  I  F++ L  L  +  ++R+    L+L      PS+  ++    ++L  ++++WK      T   + K   ++ ++  ++    +    +  +    +K + ++  E+ +  +  + +   L+ +L++EA+++RHW Q+  E+R  ++   SD TL ++ D +  +H   I ++   A  E+A+E  L+ M + W++ E+E++ +++K +   L+ G DDL+  L +++N+LS   +S
Sbjct: 1176 LYSENVEGEWSAFTEILSLRDASIQTQMMNLQTKFAQEDELVEKRTVETLTEWNKSKPVEGAQRPQEALNVITAFEAKLNKLTEERNKMRKARVALDLSDSAHAPSEGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLP--VKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWN--LSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTR---LIKGWDDLFNKLKEHQNSLSAMKLS 1477          

HSP 3 Score: 498.819 bits (1283), Expect = 3.143e-161
Identity = 323/1249 (25.86%), Postives = 624/1249 (49.96%), Query Frame = 3
Query: 8214 ITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNIC----PNKQSPIFGDYMSSTD---TYEDITDI--EKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDG-IEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEED--RMKPH-------------LATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAE--PTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWI-KQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSIN----KSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQT--SGKMNMDEYNFFLKGGVVLDRENQMDNPCPG---WLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEF-------QRMLIVRSLRPDRVSFCATSFIINNLGNKFVEP-PVLDMKQVVDDSSAKTCLIFVLS 11825
            + RLW HE  R+F DR+V ++++    E   + + +  ++ F N C      K+  ++  ++S      T E++ D    +LK F +E LD          + LVLF   ++H+ +I R+ RQ +G++LL+G  G+G+ +L+R  A++   + FQ++V   Y   +F +D++ +  +AG  N+   F+ +++ ++D  FLE +N +L++GE+P L++ DE   L  Q+ + A+R G I D+   ++ +   +V  N+HVV  M+P G   R R    PA  N   ++WF +W  +AL +V     + + L     E   R+ P              +     L+H++V   ++    +  R    TP ++L+ +  +  L  EKR  L +    L  GL KI ET  +V+ +   L+    +L   ++  +  L  ++  +++A+++ K   Q Q+ +     +  + +     DLAQ  PA+  A  A++ + K  + E+KS   PP  V+  +EA+ IL G      W   ++ + + DF+ +++ FD + ++   LK++  Y+   D++ D V + S+A   +  W  A  +Y  +   VEP R  L+  E    +K  +      ++  + E + + ++EY + + Q E +++     ++ ++R+++L+S L  E+DRW    A    Q+  L GD L++SAFL+Y G +    R+ +  KW   +    +      + IE+LS       W +  LP D    EN +++ R +R+PL++DP  QA ++I KQ  GK ++        F + LE A++FG  +L+Q+V E  DP L+P+LN+ + + GG  ++ +GD++I+ +  F+ ++ T+     ++P+I ++   VNF V    L +Q L  V+R ERP++++++++L+        +L  LE  +L  LNE++G +LDD  ++ TL+  K  + EV ++    +K    +D     Y   +   S ++  L  L +I  +Y ++LD  +++F   +      ST    +  RI   + + T  V+    RG+    K+L +  +    +++  S       ++  L     + + ++ D+  PG   +L+ +   +I++  K+  F  +    +        W T+D+PE S++P  WD+A  +          +++V +LRPDR+   A   +     + F++   V+D+  +VD+  + +  + + S
Sbjct: 2763 LVRLWAHEAIRLFQDRLVTEEER----EWTDKLVDTTAERYFGNACRLDEALKRPLLYSCWLSRNYVPVTREELQDYVSARLKGFYEEELD----------VKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQT--VFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPE-SNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCS 3993          

HSP 4 Score: 92.8189 bits (229), Expect = 3.143e-161
Identity = 66/308 (21.43%), Postives = 146/308 (47.40%), Query Frame = 1
Query: 7267 MIWSICCSVDEDGRKKIDNYIREMEGTF--PNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVE-KRTKDTFV--PVG-GKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGG-GRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            ++W+         R+ + ++IR+       PN+      +    +  W  W  K+      +  V    ++VPT+DTVR+  L+   +    P++L GP G+GKT   +  L   +     ++ +N S+ T+   +    +   E +RT +  V  PV   + ++ F D+ N+PA D +G+Q  +  +RQ ++   +Y     +   ++ +    A  PP   GR  +++R      ++ + +P +++L++I+G+  N+ +      ++ + D +T A +++Y      F     + HY+++ R++++
Sbjct: 2440 LVWAFSGDGKWKSREMMSDFIRQATTISLPPNQQACLIDYEVQLSGDWQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALR--SQQEMEVVNVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT-FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHF-TQDDQPHYVYSPRELTR 2743          
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 328/847 (38.72%), Postives = 482/847 (56.91%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGE-DIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEV-LFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKK------AASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWE-KEIDD---CVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKR---------ANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCD-------NFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPD---EKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVY 6981
            L  MK S + K FE     W+  L+ I    ++ + VQR+W+YLE +F G  +I   LP ES+ F  I      +M ++            +G       +   L  IQK+L  YLE +R+ FPRFYF+ ++DLLEI+G SK+  ++  HLKK F  I ++ I +   +    ++  S +GE+V L K     +  +  WL  LE  M+ TL   L        K            +W+ ++  Q+   +++I W  ++ K L       D K    +++     LE  ++++      I+R K+ +L+   VH+RD   KL        N F WL  +RFY++ K++D    CV+K  N+ F YG+EYLG   RLV TPLTDRCY+T+T ALH   GGSP GPAGTGKTE+VK LG  LG +V+V NC E  D+++MGR+  GL Q GAWGCFDEFNR+   +LS V+QQI +I  A+ +         G+ +++  ++GIFITMNPGY+GR+ LPDNLK +FR +AM  PD  +IA++ LF++GF   + LA K+  L+ L  +QLS Q HYDFGLRAL  VL  AG  KR         A   + ++++L+ S+ +  + KL + D+ L   ++SD+FPGI         +++ +   CD       + Q +  +  + KV+QLY+     H +M+VG + SGK+  W++L  AL     ER    E  +   ++ K++S   LYG  D NT EWTDG+ +SV+RK   + R +    +WIIFDG VD  W+E++NSV+DDNK+LTL NGER+S+P  V ++FEV +L  A+ ATVSRCGMV+
Sbjct:  539 LSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINE---EDRSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLA------DGKGAENVEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKAL-----ERWENVE-GVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVW 1370          

HSP 2 Score: 90.1225 bits (222), Expect = 0.000e+0
Identity = 69/309 (22.33%), Postives = 156/309 (50.49%), Query Frame = 3
Query: 3645 LKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRR---GLNLFKIEQPPSK--EIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSNEDIS 4556
            L  +N+E EW  F + L   +  I+      +T    + +  +K+    + ++  + P   +  PQEAL  I  F++ L  L  +  ++R+    L+L      PS+  ++    ++L  ++++WK      T   + K   ++ ++  ++    +    +  +    +K + ++  E+ +  +  + +   L+ +L++EA+++RHW Q+  E+R  ++   SD TL ++ D +  +H   I ++   A  E+A+E  L+ M + W++ E+E++ +++K +   L+ G DDL+  L +++N+LS   +S
Sbjct:  244 LYSENVEGEWSAFTEILSLRDASIQTQMMNLQTKFAQEDELVEKRTVETLTEWNKSKPVEGAQRPQEALNVITAFEAKLNKLTEERNKMRKARVALDLSDSAHAPSEGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLP--VKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWN--LSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTR---LIKGWDDLFNKLKEHQNSLSAMKLS 545          

HSP 3 Score: 498.434 bits (1282), Expect = 3.119e-161
Identity = 322/1237 (26.03%), Postives = 619/1237 (50.04%), Query Frame = 3
Query: 8214 ITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNIC----PNKQSPIFGDYMSSTD---TYEDITDI--EKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDG-IEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEED--RMKPH-------------LATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAE--PTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWI-KQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSIN----KSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQT--SGKMNMDEYNFFLKGGVVLDRENQMDNPCPG---WLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEF-------QRMLIVRSLRPDRVSFCATSFIINNLGNKFVEP-PVLDMKQVVDD 11789
            + RLW HE  R+F DR+V ++++    E   + + +  ++ F N C      K+  ++  ++S      T E++ D    +LK F +E LD          + LVLF   ++H+ +I R+ RQ +G++LL+G  G+G+ +L+R  A++   + FQ++V   Y   +F +D++ +  +AG  N+   F+ +++ ++D  FLE +N +L++GE+P L++ DE   L  Q+ + A+R G I D+   ++ +   +V  N+HVV  M+P G   R R    PA  N   ++WF +W  +AL +V     + + L     E   R+ P              +     L+H++V   ++    +  R    TP ++L+ +  +  L  EKR  L +    L  GL KI ET  +V+ +   L+    +L   ++  +  L  ++  +++A+++ K   Q Q+ +     +  + +     DLAQ  PA+  A  A++ + K  + E+KS   PP  V+  +EA+ IL G      W   ++ + + DF+ +++ FD + ++   LK++  Y+   D++ D V + S+A   +  W  A  +Y  +   VEP R  L+  E    +K  +      ++  + E + + ++EY + + Q E +++     ++ ++R+++L+S L  E+DRW    A    Q+  L GD L++SAFL+Y G +    R+ +  KW   +    +      + IE+LS       W +  LP D    EN +++ R +R+PL++DP  QA ++I KQ  GK ++        F + LE A++FG  +L+Q+V E  DP L+P+LN+ + + GG  ++ +GD++I+ +  F+ ++ T+     ++P+I ++   VNF V    L +Q L  V+R ERP++++++++L+        +L  LE  +L  LNE++G +LDD  ++ TL+  K  + EV ++    +K    +D     Y   +   S ++  L  L +I  +Y ++LD  +++F   +      ST    +  RI   + + T  V+    RG+    K+L +  +    +++  S       ++  L     + + ++ D+  PG   +L+ +   +I++  K+  F  +    +        W T+D+PE S++P  WD+A  +          +++V +LRPDR+   A   +     + F++   V+D+  +VD+
Sbjct: 1831 LVRLWAHEAIRLFQDRLVTEEER----EWTDKLVDTTAERYFGNACRLDEALKRPLLYSCWLSRNYVPVTREELQDYVSARLKGFYEEELD----------VKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQT--VFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPE-SNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDN 3049          

HSP 4 Score: 93.5893 bits (231), Expect = 3.119e-161
Identity = 66/308 (21.43%), Postives = 146/308 (47.40%), Query Frame = 1
Query: 7267 MIWSICCSVDEDGRKKIDNYIREMEGTF--PNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVE-KRTKDTFV--PVG-GKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGG-GRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            ++W+         R+ + ++IR+       PN+      +    +  W  W  K+      +  V    ++VPT+DTVR+  L+   +    P++L GP G+GKT   +  L   +     ++ +N S+ T+   +    +   E +RT +  V  PV   + ++ F D+ N+PA D +G+Q  +  +RQ ++   +Y     +   ++ +    A  PP   GR  +++R      ++ + +P +++L++I+G+  N+ +      ++ + D +T A +++Y      F     + HY+++ R++++
Sbjct: 1508 LVWAFSGDGKWKSREMMSDFIRQATTISLPPNQQACLIDYEVQLSGDWQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALR--SQQEMEVVNVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT-FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHF-TQDDQPHYVYSPRELTR 1811          
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 576.244 bits (1484), Expect = 2.286e-164
Identity = 362/1105 (32.76%), Postives = 594/1105 (53.76%), Query Frame = 1
Query: 4504 SIKLLMTTEILYQ-MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQ-IRNARACGK---KEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNP---GYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKE-RESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPN-KDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLV--CNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIE---ARVEKRTKDTFVPVGGKRMLTFMDDFNMPA 7773
            SI  L  ++ L Q +K+S +   F  +   WE  L+ +   +  +  +QR+W+YLE IF     R  LP E++ F +++ ++R I+ ++++  R    C +   K+ L +  + +N C    QK+L+ +LE KR  FPRFYFI +DDLLEILGQS NP  +  H+KK F  IN ++     S G    SM SS+GE V   + +R+   VE+WL +L   MR TL+DL         +A +     + ++  Q+   + +++++A +   L   +  N  K  ++++K +     K  +       K+  LK+ SL++  +H  D++++L  +    IN++ W  QLRFY        V++Q ++ F+Y YEY GN  +LV TPLTD+CY+TLT A+++  GG+P GPAGTGKTE+VK L   +G  V+V NC EG+D  SMGR+F+G+ + GAWGCFDEFNR++  VLS V+ QI +I  A+ S A     F G+ + + P+  IF+T+NP   GY GR ++PDNLK +FR + M  PD+ +I+   L++EGF     LA+K+ +++ LS Q LSKQ HYD+GLRAL  VL   G  +R      + ++++ ++    L+KLT  D   F  ++ D+F  +   +  +  + E +        ++  +  + KV QLYE    R  V++VG   SGKST W++LQ +L    K  + +QF        NPK+V+  +L G  D++T EW+DG+++   R+   DT     WI+ DG +D  W+E++NSV+DDN++LT+ +GERI     V+ LFE ++L  ASPATVSR GM+Y    D+  +  V SWL +       E+L      +IE  ++F +  C++ +R+   + + S        A ++NG     T   +   +  F   +      +V  + R++    +     + P+ K+  Y+  +D       + D+  +   K        +  V T DT RY+ ++ + +   N    ++ G  G GK  +  +     N+    + ++  SAQ+SS+++  +I+    +    T   + P     M+ F+   N+PA
Sbjct: 1259 SINSLKDSQALLQSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFG----RGALPSEASRFSRVDSEYRAILNDVSKDARLVSLCSRQSLKKSLEQIVDQLNRC----QKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFS---STGETIISMVSSEGETVPLSKAVRIVPQVESWLQELSDEMRRTLKDLT-------AQAVADAQPSLAKYPSQVLCLAEEVKFSASIENNLNGSSDLNSFKS-QLLEKLKAYTNMKVDD-------KVSDLKLKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFYLVN--GGIVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRA-GSCTFGGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRTQTNKNETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSLILTKKPLKVTQF--------NPKAVNRSKLLGNMDMDTREWSDGIITMAAREVTKDTSV-HHWIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWLVKT-----TEDLHADMPSWIE--EHFWR--CLKWVRSHKISGITS-------FAILKNGL----THLKASKTKTQFLVLLFNGFLPTVTPENRQEFAKGVVFQGMSVPDPKNICYDERIDG---IMSYTDDVSQNVTKEEVEREDLRPFVQTADTQRYSDIIGSWLQSGNRESFLITGTTGCGKQQLLKHCFQ--NDPESQLASLYCSAQSSSSHLLQLIQQNCVQASNPTGRVWRPKDRPNMILFLKGINLPA 2300          

HSP 2 Score: 346.665 bits (888), Expect = 1.048e-94
Identity = 315/1225 (25.71%), Postives = 578/1225 (47.18%), Query Frame = 3
Query: 8244 RVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSP---IFGD--YMSS-------TDTYEDITDI------EKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQ-----ERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGA-EPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQ--DDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKM-NMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKL-ANFHGLITSFE-QYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            R+FADR+  + DK+ F E+L             N+ P  Q+    IF +  Y+++       ++T   +T I      + L K +     E  N    +   L  F   I+      RV+  P G++ L G  G GR+   RL A+M     F   V+ ++  ++F ++LK    QA  +N+  + +  D Q+    FL+ IN++L+SG +P L+ Q E+D L   +S+ A +      T ++  +L  R+R  +HVVL +      F+  I   PA +    + +   +  ++L+E+ +               +M+    T    +    +D+    L  +  H  + P  Y + V  +  LL  KR  LS    +LK G+ K++E R +V  M  +  +  K LA  Q E D+ L  I +    A+DQ  S+ Q +     E ++++E K  K+ E     L +  P ++ A +A+ S+  + ++EI+S   PP  V+ +++AV++  G  + +W   +K L +      ++NFD + I++   KK+   V Q  + F+     + S AA  L  WV A   Y ++   + P           L++ + Q+      L +V E +  L++++   M++  +++   +  +  +  A  LV  L+GE +RW+  +     +   +    LI SAF++Y+G      R++L+       K   +P  P+F  + F S  T+  +W  +GLP D  S+ENG I+      PL++D   Q   ++ +   +K +      PD +  +E+AI+FG+ +++ ++ E  D +L PIL K +   G   V+  G K I++N DF+ Y  T+       P    +  IVNF      L AQLL + +  E+PELEE+  +L+      K +L  LE  +L+ L  +QG+LL++  L+++L  SK ++  +T+ +  +E+    +   +  Y   +   S LFF  ++L   +PMY ++++  + LF  +I KS +  K   R+  L       V+ +  RG+F + +L+F+    A I  T  KM    E+  F   GV++D    +      W+S    D +  L ++  +   L  +F+ Q    WN +  +   E ++ P   +     FQ++L +++++P+R+  C   F++  L    + PP  ++K +  +S +   ++F+L+ G
Sbjct: 2453 RIFADRLPTENDKLKFEEIL------------RNVIPISQANETVIFKEKVYVTTGTVVPGESNTGLPLTPINMSDFNQLLAKSINRFAFEIANFNCPLTSQLAFFCACID------RVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVALVSEAANQASF---TGALQQFLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSLVEIPKI--------------QMESQGITTTDAILTGFNDV----LVNLPEHLSIQPIKYRQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAEDQKLSMEQLKAATEKENVRIEEQKA-KIDE----QLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVLLFMGILDTSWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRIAGTLVESLSGEFERWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKSLL---KSMCKMFNMP--PTFKPLSFASLETEQLNWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQVSLFLSKFL-EKSETFKAAQPDLMTQIELAIRFGKTIIIDDIVE-FDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSKESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTI-KSCED-KSSTRVETLARQMQLTVFYHISRGIFRQDRLMFA---VAFINATMPKMFQPKEWELF--TGVLVDESTDLSALRVQWISP---DRLQSLARIRTHLPSLFNNFQIQDDATWNEFSKTLQCE-NAFPKNVELKMTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADG 3615          
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 161.77 bits (408), Expect = 8.122e-39
Identity = 107/384 (27.86%), Postives = 206/384 (53.65%), Query Frame = 3
Query: 9189 DMSQRMLDEMKRHNYV-TPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPT-------------WAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIG-TYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYRE 10295
            D   ++LD++     + T    L++VS    L  +KR+++  +  K + G+ K+     +V  M  EL   + +L     E    +  I ++  + ++  + V   + +      K   ++  + A+LA A+PALE+A++ALE++ + D++ +K+   PP  V+  MEAV IL G +P              W   +K L +  F+ ++ +F +D +S +T+K I   Y+++++F P+ V + SLAA+ LC WV A+++Y ++ ++VEPKR+RL+ AE ++++   QL   +  L  V E+++ L  ++++  ++K+EL  +    E  ++RA +LV  L+GEKD+W+  +  + ++  L     + +S  L   G    D RE
Sbjct: 2079 DQIMKVLDDLSDFKMINTRAEKLKMVSTITKLAKKKREEVRKTMTKYEKGMEKMKRAEEQVAGMQGELLRLQPQLVRTSIETSMLMSTIEKETIDVENAREVVAANENKANEAATKAQSLKAESEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPAKITNEIGEVVNDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKWKNKITYITHEDSLSVPYSVGSSLALHVFGKLPIDQRE 2462          

HSP 2 Score: 72.4034 bits (176), Expect = 1.102e-18
Identity = 87/385 (22.60%), Postives = 162/385 (42.08%), Query Frame = 1
Query: 4516 LMTTEILYQMKT----SRFVKPFEH------EVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLE----DIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSL----KIEKL-MSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLG 5613
            L+TTE+  QM+     S+ +    H       +  W   L ++   V +      +W  +E +F  EDI  Q+P E   F KI+ +W  I    NQI   R   ++  L++  N   + LE     ++     YL  KR +FPR + +S++ +L ++  S+ P     ++   F ++ +     K+E + +S   E  S+       +  +        VE W+ +L+  ++ TLR  +R     +    S  +  + E      I  + +      T  ++N  ++N    L I+  + K+ +     A+     + + L +  L  I      ++ KL       I+ + W SQLR+YW   +++  I+    S +Y YE  G
Sbjct:  779 LLTTELNVQMQAHLARSQTILSSPHAFSILDHIRHWLDTLLNLNTFVHLYKQCDTRWRKIEGVFSTEDIAYQMPHEFRTFKKISLRWLHIN---NQITEERPILEQMDLVQQLNLELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANCKSYIPLLFPSLTTFDQNTKMEIISVSTKLETISLVKPVNVNLSKRH-------VEKWMHELDSQIKYTLRTRIRLLIEKMNYKLSPVETILNE-----PIQVAAVYLKIAFTWQMENSMKQNS---LTILASELKICIRDCQHAVLHKHDRWEFLPV--LYHIYKSSTHLVNKLMNEQVIFIDDYRWTSQLRYYW--HLENVFIRVGTVSTRYDYEVQG 1141          

HSP 3 Score: 43.1282 bits (100), Expect = 1.102e-18
Identity = 24/95 (25.26%), Postives = 48/95 (50.53%), Query Frame = 3
Query: 4185 QFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKE 4469
            +F + +P++  +  +AM+DRHW  I  +       E +    E ++++NF + A+   +V   A KE  +E +++ M+  W  V    + H+  E
Sbjct:  687 EFEKLLPVLGAISCQAMKDRHWKMILQDSETSVKVEGNPLVSE-LLEMNFIEKADKFEQVGAQAEKERVLETSIEKMKSQW--VTATFVTHQGGE 778          
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Match: kl-2 (gene:FBgn0001313 transcript:FBtr0346722)

HSP 1 Score: 1441.4 bits (3730), Expect = 0.000e+0
Identity = 697/1214 (57.41%), Postives = 908/1214 (74.79%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNA-RACGKKEG--LLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMS--QGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            MK +RFV+PF   VD WE+ LS+I ET+E  LTVQRQWLYLENIF G+DIRKQLP+E+  F  I +++R I +++ Q + A +A   +    LL  F+ M+  LE IQ++L++YLE KR +FPRFYFISNDDLLEILG SK PD V  HLKK FDN+  L+++++      ++AS M S DGE V F   + ++GP E WL  +E+ M V ++++L+  R +LKK    R+KWI  W GQ+ +T++QIQWT + T++L + +  + KKPLR +KKKQ  VL K SE  R +LTK  RLK+N+L+ +E+H RD+IE++YKS C D   FEW SQLRFYW +E + CVI+QTNT   YGYEY GNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGK+LG +VIV NCSEGLDYKS+G+ FSGLAQ+G WGCFDEFNRINIEVLSVVAQQI+SI++AL++ A  + MF+G+MI L  +VG+FITMNPGYAGRTELPDNLKSMFRPI+M+ PD+ +IAE  LF++GF+  + LA+KV+TLY L+ QQLSKQ HYDFGLR++V++LRYAGRK+R  P   +EEI+ L+M DMN+A+LT+ DLPLF GI+SD+FPG+  P +DY+    AI +      LQP    + KV++L+ETK SRHSVMI+G T + KS TWR LQ+    ++ +R S +E    +P+NPK+++L ELYGE++L+T EW DGVLSS+MR  C D  P +KW++FDGPVD +WIE+MNSVMDDNK+LTL+N ERI+MP QVSLLFEV +L+VASPATVSRCGMVYND ND GW+P+V SWL+R       + L   FD  + KI +F +M C E +RT+  N V+SLCKL +   T  NG +P + +    +  LWF FC++WSIC SVDED R+++D++IRE+E  FP KDT+++YFVD   +++  WD KL + WK +   PFYKIIVPT DTVRY Y+V  L+   +PVMLVG VGTGKTS A++ +   + + + IL +NMSAQT++  +Q+ IE R EKRTK  FVP+GGKRM+ FMDDFNMPAKD +GSQPPLELIRQWIDY +W++R  Q +  +++  L  AMGPPGGGR  IS+R QSRF L+N+TFP++  + RIFG+M+ QKL+ +  E++ +   IT  TI +Y  ++ K LPTP K HYLFNLRDISK
Sbjct: 1430 MKATRFVEPFITIVDYWEKTLSYISETLEKGLTVQRQWLYLENIFQGDDIRKQLPEEAKRFATITEEFRTISSKMFQAKTAVKATNLRPPPFLLNRFSRMDERLELIQRALEIYLEAKRQLFPRFYFISNDDLLEILGNSKRPDLVQTHLKKLFDNLYKLELKRVGKTLSRWQASGMHSDDGEYVEFMMVIYIDGPSERWLKQVEEYMLVVMKEMLKLTRGSLKKLVGNREKWISLWPGQMVLTTAQIQWTTECTRSLIHCSMVDQKKPLRKLKKKQIKVLSKLSEMSRKDLTKTMRLKVNTLITLEIHGRDVIERMYKSNCKDTGHFEWFSQLRFYWHRESELCVIRQTNTEHWYGYEYTGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIWVIVTNCSEGLDYKSIGKNFSGLAQSGCWGCFDEFNRINIEVLSVVAQQIMSIMAALSTKAL-ELMFEGQMIKLKHTVGLFITMNPGYAGRTELPDNLKSMFRPISMMVPDNIIIAENLLFSDGFTNTRNLARKVYTLYELAKQQLSKQYHYDFGLRSMVALLRYAGRKRRQLPNTTEEEIVYLAMKDMNVARLTANDLPLFNGIMSDIFPGVSLPTIDYSEFNIAIYEEFREAGLQPITIAVKKVIELFETKNSRHSVMIIGDTGTAKSVTWRTLQNCFYRMNSQRFSGWEAVTVYPVNPKALNLAELYGEYNLSTGEWLDGVLSSIMRIICGDEEPTQKWLLFDGPVDAVWIENMNSVMDDNKLLTLVNSERITMPVQVSLLFEVGDLAVASPATVSRCGMVYNDYNDWGWKPFVNSWLQRLRIKEFADFLRIHFDYMVPKILDFKRMRCKEPVRTNELNGVVSLCKLLEIFGTKVNGINPINLELLEEMTRLWFMFCLVWSICSSVDEDSRQRLDSFIRELESCFPIKDTVFDYFVDPNERTFLPWDSKLLSSWKCDFESPFYKIIVPTGDTVRYEYVVSKLLAEEYPVMLVGNVGTGKTSTAISVMEACDKNKFCILAVNMSAQTTAAGLQESIENRTEKRTKTQFVPIGGKRMICFMDDFNMPAKDIYGSQPPLELIRQWIDYKYWFNRKTQQKIYVQNTLLMAAMGPPGGGRQTISSRTQSRFVLLNLTFPSQETIIRIFGTMLCQKLESYPNEVREMWLPITLCTINLYVSMISKMLPTPNKSHYLFNLRDISK 2642          

HSP 2 Score: 1274.23 bits (3296), Expect = 0.000e+0
Identity = 642/1238 (51.86%), Postives = 872/1238 (70.44%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKD--LQLFIGGEEDR-------------MKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGK-KLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +LR+ K+  + KN   RLW+HE FRVF+DR+V D D+  FV  +++ LG  F+ TFH++CP+K  P FGD+      YED+  ++ L+ FMK  L+EYNN PG+ +M+LV FR+AIEHI +I+RVI QPRG++L +GIGGSGRQ LT+LAA++ E   FQIEV+K Y+  +FR+DLK LY   G+  + T+F+F+  Q+ + SFLE  NN+LS+GEI NL+K DE D+L+ +L   AK++G+  TT+++++Y I  VR  +HV LC SP+GE FR+ IR +PA ++ TT +WF  WP +ALLEVA  +L    L + + G+ED              ++  +A +FS++H SV+ MS+ M  E+KR+NYVT  NYL+LVSG+K LL +KR ++S ++N+L+NGL KI ET+ KV +MS EL+ + +++ I  +EC+D++ +I  QK EA +Q + V      I+ DE  CL++   A ADL   MP ++AA++AL++LNKKDI+E+KSYG+PP  ++KVMEAV+IL G EPTW  AKK L E  F+  L NFD+D+ISD+TLK+I  Y    + +PD V  VSLA KSL  W+ A+E YG+VYR+V PK+++L +A   L EKQA LAAA+ KL+ +   ++ L ++  EK     ELR K E   K L+RA  LV  L+GE++RW +TV  L+     LPGDCL++ AF+SY+G F + YRE L++KW+  IK   IPA        FL +   IR+WNIQGLP D  S ENGVIVT+GSRWPL++DPQ QA  WIK ME + +L  +D  M D++R LE A++ G PVLLQNV E LD +++PIL +S     G  ++K  DK I YN  FRFYITTK+ NPHY PEIS+KT IVNFA+K+ GLEAQLLGI+VRKE+P LEEQKD LVM+IA  KR L +L++EILRLLNE++GSLLDD++L +TLQ S+ TS  V E L IAE TE  ID ARQ Y   ++RASILFFVL D+ KIDPMY F+L AYI LF  SI +S ++    ERI N+N+YH+YAVY   CRGLFE+HKLLFS  + AKIL  +GK+  +EY+F LKGG+VLD+  Q  NP P W+S+Q WDNI+ELDK++ FHG+I SFEQ+ + WN WY +  PE   L GEW++   +FQ++ ++RSLRPDR+SFC T FII  LG ++V+PPVLD+K   D+S ++T LIFVLSPG
Sbjct: 2645 QGLLRSEKELQNKKNFFLRLWVHECFRVFSDRLVDDSDQFWFVNTINDILGKHFEVTFHSLCPSKVPPFFGDFAHPQGFYEDL-QVDFLRTFMKNQLEEYNNFPGMTRMNLVFFREAIEHIVRILRVISQPRGHILNMGIGGSGRQVLTKLAAFILEMAVFQIEVTKKYKTGDFREDLKNLYKVTGIKQRLTIFIFSSDQIAEVSFLEITNNMLSTGEI-NLFKSDEFDELKPELERPAKKNGVLLTTEALYSYFILNVRDFLHVALCFSPIGENFRSYIRQYPALLSSTTPNWFRFWPQEALLEVASHFLIGFPLNVVVSGKEDEKHRESLVISTEAILQRDIAYVFSVIHSSVAKMSENMYAEVKRYNYVTSPNYLQLVSGFKKLLEKKRLEVSTASNRLRNGLSKISETQEKVSLMSEELKASSEQVKILARECEDFISMIEIQKSEATEQKEKVDAEAVLIRRDEIICLELAATARADLEVVMPMIDAAVKALDALNKKDISEVKSYGRPPMKIEKVMEAVLILLGKEPTWENAKKVLSESTFLNDLKNFDRDHISDKTLKRIAIYTKNPELEPDKVAVVSLACKSLMQWIMAIENYGKVYRIVAPKQEKLDSAMKSLEEKQAALAAAKKKLEELQVVIEELYRQLEEKTNLLNELRAKEERLRKQLERAIILVESLSGERERWIETVNQLDLSFEKLPGDCLLSVAFMSYLGAFDTKYREELLVKWSLLIKDLLIPATLELKVTYFLVDAVSIREWNIQGLPADDLSTENGVIVTQGSRWPLIIDPQMQANNWIKNMEERNQLMTLDFGMADYLRQLERALKEGLPVLLQNVGEYLDQAINPILRQSFTIQSGERLLKFNDKYISYNNSFRFYITTKISNPHYPPEISSKTTIVNFALKQDGLEAQLLGIIVRKEKPALEEQKDELVMTIARNKRTLIDLDNEILRLLNESRGSLLDDDELFSTLQKSRQTSVLVKESLSIAEVTEVEIDAARQEYKPASERASILFFVLMDMSKIDPMYVFSLAAYILLFTQSIERSPRNQLVHERIQNINEYHSYAVYRNTCRGLFERHKLLFSIHMTAKILSNAGKLLEEEYDFILKGGIVLDKLGQAPNPAPWWISEQNWDNITELDKVSGFHGIIDSFEQHYKAWNGWYATTFPEQEDLVGEWNDKLTDFQKICVLRSLRPDRISFCLTQFIITKLGPRYVDPPVLDLKATFDESISQTPLIFVLSPG 3880          

HSP 3 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 414/1441 (28.73%), Postives = 730/1441 (50.66%), Query Frame = 3
Query:  255 KSTPPDEEKSVIDLIR--QRIRLSGYVEIENWTADHALQVQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSK-PEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSK-PWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRAL-RDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPS-IPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPL-KSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKK-----SIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLS 4541
            +ST  D    +  L+   ++I     ++  +W A   + V   ++ ++ EL++   +  + L     FP   V +L YFI+      EII+  +FHD +  GTV       LL+I+  IYAP + +   W D++K  F   L +F+  LT   +K+ G TVLY+P      + E  + +++F+  +E I + W   I+ +L+ +      E     DE E+W  R + L G++ QLD+  V+ I ++L +  S Y+    +L  E      +A  N+KFL+ L   C  L  S+ P  +  ++ + I+ IR IW+NSE YN RD +TG+FR +SN+II+ C   +++++I  G     +K    CI CC  YK IYD +   H   + +  W+LD   IF  +DAF++R  D+I+ICE    F R ++      P F G  G E E     +E  F   + AL  D K  IL+V    W+++  ++R  V+ +E   Q  ++  F+ +  +++ +E L+V      R TIR+T    ++ + +  +   N +   + +       H S +P YA  A+  R    R+      L+ + +LP  S  +   +++  +    ++ V+K+  E+        L + LD  LL RS   +G+++ N  R +L + ++  ++ERL   VP     IY +   LR    SV+ V  +YN IL  L+ +ER LF+  I+  D+KI PG+ K+ +  + +  Y + DC  +  +LQ+ +D YK A  +I ++CE I    M+K + +     + F +   ++   V   L G +  I + +   ++ F     D+   W  ++N  D     AF  + K SLN L  A++ D     +P+  +  +++ R +V  P +  + N+++        ++++ PRIG    K+KL K     S  +    D E T++  NI   +      I   + +W+  R +WE  + EF  +           +A I  Y+ + +     +A+  V F+ ++ + +K+SI      WQ     +LL+ +   +  ++ YM+    K+  +P+ L+E   + +  +++  E    Q  F P  E F ILDKY+V+  ++IR+K   LE  W  +L+ L EA++M+  ++++FK  L+ Q++ FK  +   + DF    P +A+I P+ AL  +      +E     E+ + R L +F + QP S ++  L+ ++  ++NIW+L  EW+TNW  WK G F ++   EME+ A + +++ T  ++   D++WE++E T   VD FRRT+PLIT L+N  MR+RHW ++++ I   FDE S +FTLE II+L+F   +E I ++S  AT EL IEN++K +  +W+    E+  + D     + +  ++D +Q L+++   +S
Sbjct:    2 ESTETDRGSEIAGLVEYVKKITFLYSLDHRDWNA-KVINVISIWLINSTELVLTIFYDCDVLTGCLGFPVAPVIDLCYFIRS---SKEIISIHSFHDMVNFGTVQDDVDGCLLKILELIYAPIFRNFMEWGDNVKQRFCTSLDKFLGILTAIYFKMSGMTVLYVPYVVKEIAKEISSYDREFVKNLECIAVSWATLIRILLNDKTLTSPNEYISVGDEFEFWLYRFEVLQGLNAQLDQVDVQQIIRVLRSTHSVYIKQIDELIFESTHELMEAMENIKFLHLLMQPCSQLDFSESPTFVSQLIPRTIHLIRFIWLNSEQYNRRDLITGIFRNLSNQIIRFCTEKVNVEKILSGSSRFGIKICNMCIDCCLTYKGIYDIMSKTHAKINIRIGWSLDNAMIFNHVDAFMERLNDVIDICESMMVFGRLDESESIPKPQFGGTSGTEFEATADNVENEFLVTLTALCTDSKEIILNVHKNEWYEEVIKYRRTVQSMEETVQRLMSNVFQHICNVEEALESLNVMIFYSYRSTIRKT---FLRQVSSAWVFFSNEIDSSVHMLMDRSKMHESWVPYYASRALGYRVHLDRLVWLCNRLNSSDWLPNVSEASVVLKKFESVRREFDKEVKKSFDEWQKNCCSLLLNQKLDRYLLIRSKKKKGLIECNIDRTILTICEQAQHFERLGLGVPGMVRKIYEKHETLRFVYNSVVQVCLNYNHILSALSEQERKLFRALIQACDRKIAPGVFKLTYGGELSDAY-IADCAKHTNKLQETMDIYKRAIQNIARFCEKICDTPMLKFNFSGAVTISIFENHLSSYLRRVSNILRGFYSTITDLIFAVFKEFQAVIEDMPIEWYGFVNVFDDMLATAFLTSSKNSLNMLTNALHRDPDMAAAPILVMESDVRERCIVLTPDIDVIANLLSGYIDRIHNILEQFPRIG---IKMKLPKEHQYESFSKAFLEDSESTQLICNIEAEINHEREEIDGYITFWNSHRMLWETTELEFTKRVKATQMTADIFEASIEYYSAMADDISYVDAITHVYFILMNQNYIKSSILDCIEKWQALNIKILLSHSFSLIRAIYRYMRKNERKMMMVPRTLKESLLAKQFFERIINEVPLKQAGFPPTLELFAILDKYQVEIPEEIRVKVIGLEAAWHHYLKRLGEADEMLDNNREEFKKILVQQAEKFKIILKEFLDDFFLKLPTSANINPRIALKFLRIIALKIEDCFTFEESLMRDLAVFNVNQPESIDLRKLDFEVRIVKNIWELIFEWQTNWEGWKKGYFWKMNINEMEDTALNLYKEFTTLNKKFYDRHWEMLEATTKNVDSFRRTLPLITALKNPCMRERHWNRVRDVIHVNFDENSKNFTLELIINLDFQAFSEDIQDISNPATMELQIENSIKNIATIWKKQSFEMAFYHD---GIYRIKNVEDCFQLLEEHMVQIS 1428          
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Match: Dhc93AB (gene:FBgn0013812 transcript:FBtr0273236)

HSP 1 Score: 923.309 bits (2385), Expect = 0.000e+0
Identity = 504/1225 (41.14%), Postives = 729/1225 (59.51%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLG-EDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFE-ASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDN-------YIREMEGT-FPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIIT----QATIEMYNGVVIKFLPTPTKIHYLFNLRDIS 8166
            L  + TS+++  F  EV  W+  L    + + +   VQR W +LE+IF+  EDIRKQLP +S  FD I+ ++RV+M E++   N  A   + GL+E    +   L   +K+L  YLETKR  FPRFYF+S+ DLL++L     P+ V  HL K FD+I  LK  +  S     AS M++ DGE V F +   + GPVE WL  ++  MR +LR  + +  IA ++   +R++W+ ++  Q+ +  SQI W+ +V  A   + +  D   ++   KKQ   L      +   L+K  R KI ++  I+VH RD++ K+ ++     +AF W SQLR  ++    DC     +  FQY +EYLGN+ RLVITPLTDRCYITLT +LHL  GG+P GPAGTGKTET KDLG+++G  V V NCSE +DY+S G ++ GLAQTGAWGCFDEFNRI +EVLSVVA Q+ S+  A+  +   KF F G MI  VP+VGIFITMNPGYAGRTELP+NLK++FRP AMV PD  +I EI L AEGF   +VLA+K  TLY+L  + LSKQDHYD+GLRA+ SVL  AG  KR +P  P+EE+L+ ++ D N+ K+ + D+P+F G++SDLFP +D P     + +  +++   +  LQP +  I KVVQL E    RHSV IVG   +GK+  W+ L      + +       K +   LNPK+V+  EL+G  +  T EW DG+ S +MR     T    KWI+ DG +D +WIES+N+VMDDNK+LTL + ERI++   + LLFE+ NL  A+PATVSR G++Y +  DLGW PYV SW++ +        L  +FDKYI      I++   ++   +    +  LC L +C     N   P+D        EL+F F  IW+   ++ +D  + ID        ++ E +   FP   T+++YF+D++ K++  W EK+   ++ ++ +P   +IV T +++R  + +  L+   HPVMLVG  G GKT +    L  L+ + + + TI  +  T+S  +Q I+E  +EK+    + P G K +  F+DD NMP  D +G+  P  L+RQ +DYG WYDR K T K I +   +VA   P  G   I+ RLQ  F ++ ++FP   ++  ++ S++ Q   + E++  PI   +T     ATI ++N  +  FLPT  K HY+FNLRDIS
Sbjct: 1479 LQNLITSKYIAHFLEEVSTWQNKLMIADQVITVWFEVQRTWTHLESIFMSSEDIRKQLPVDSDRFDNIDAEFRVLMDEMSVSSNVVASTNRSGLIERLEHLQKELTLCEKALAEYLETKRLAFPRFYFVSSADLLDVLSNGIQPEMVTKHLTKLFDSIARLKFNRDESNEINTASGMYAKDGEYVEFNELASIRGPVEVWLNRIQAAMRASLRHYVMEAVIAYEE--KQREQWLFDYPAQVSLCGSQIWWSTEVNIAFSRLEEGYDNA-IKDYYKKQISQLSLLITLLLGELSKGDRQKIMTICTIDVHSRDVVAKMIQAKLDSGSAFMWQSQLRHRFDDVEKDCFANICDAEFQYCHEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRAIGISVYVFNCSEQMDYQSCGNIYKGLAQTGAWGCFDEFNRITVEVLSVVAVQVKSVQDAI-RDKKDKFNFMGEMISCVPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFQDARVLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPGRPEEEVLMRALRDFNIPKIITDDMPVFMGLISDLFPALDVPRKRDQDFERTVKQAASDLLLQPEDNFILKVVQLEELLEVRHSVFIVGNAGTGKTQVWKTLLRTYQNIKR-------KPIFNDLNPKAVTNDELFGIINPATREWKDGLFSVLMRDQANITGDQPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPSMRLLFEISNLRTATPATVSRAGILYINPQDLGWNPYVTSWVETRKIPAEKSNLVMLFDKYIPPSLETIRVRFKKITPVAEMAHIQMLCHLLNCFLIPANT--PADCPKEWH--ELYFVFACIWAFGSAMFQD--QAIDYRVEFSKWWVNEFKTVKFPPGGTVFDYFLDSETKTFLPWTEKI-PKFELDSDLPLQAVIVHTSESIRLRFFLDLLMDKKHPVMLVGNAGCGKTVLVNEKLQSLSEN-YAVTTIPFNYYTTSEMLQKILEKPLEKKAGRNYGPPGNKLLCYFVDDINMPEVDAYGTVQPHTLMRQHLDYGHWYDRNKLTLKDIHNCQ-YVACMNPTSGSFTINPRLQRHFCVLAVSFPGPESITVMYSSILAQHFANAEQKFTPIVTRMTPNIVAATIALHNKCLQVFLPTAIKSHYIFNLRDIS 2683          

HSP 2 Score: 764.607 bits (1973), Expect = 0.000e+0
Identity = 457/1242 (36.80%), Postives = 706/1242 (56.84%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTD--TYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDET-------RAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQE-RIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMIL---RGAEP---TWAEAKKHLGEQD-FIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKK--EQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +L ++ +       + RLW HE  RV++D++  DKD  +F ++  + +   F++   ++  +K + I+  +        Y  I    +L K ++E +  YN+   V  M+LVLF DA+ H+ +I R++  PRG+ LLVG+GGSG+QSL RLAA++      QI++ K Y   + +++   LY +AG+ N   +FL  D Q+  E FL  IN++L++GEIP+L+  DEI+++   + +E K  G+ DT ++ + + IDRVR  + +VLC SPVG   R R R FPA +N T+I+WF EWP +AL+ VA  +L   ++      D +   +A +    H SV+  S+  L   +R+NY TP +YLE ++ Y  LL  K + L     +L+NGL K+  T       + K+ V  IEL+E        + E  D L+ IV  + E     K+V   +E ++ +   +  K Q     DL +A PAL AA  AL +LNK ++TE+KS+G PP  V  V  AVM+L    G  P   +W  AK  + + D F+  LIN+DK+NI     K I  Y+   +F+P+ V   S AA  LC WV  +  +  VY  VEPKR+ L AA + L   Q +LA  + K+ ++ E++ +L  ++ +    K   +++A+ T+  +  A++LV GLA E  RW + V +   Q   LPGD L+ +AF+SY+G F   +R  L++K WT  +K     IP   +   +  L++ T I  W  +GLP D  S+EN  I++   RWPLM+DPQ Q  KWIKQ  G+ LKVI L    ++ ++E +I  G  VL++N+ E LDP LD +L ++++K G A  +K+GDKEIEYN +FR  + TKL NPHY PE+  +T ++NF V   GLE QLL  VV+ ERP+LEE K +L       K  L +LED++L  L+ A  ++L D  LV  L+T+K T++E+ +++  A+ T   ID AR+ Y   A RAS+L+F+LN+L  I+P+YQF+L A+  +F  +I K+      D R+SNL D  TY+V+ Y  RGLFE  KL+F+ Q+  +IL  + ++   E +F L+  +     + +D     +L++Q+W  I  L     F  L    E   + W     S+ PE    P EW N T   QR+ ++R+LRPDR+++    FI   LG+K+VE   ++  +  +++S  T + F+LSPG
Sbjct: 2687 QGLLFSSTECLTGSTDLIRLWQHETQRVYSDKLTDDKDIDSFTKMQHDIVKKSFEEIDESVIFDKPN-IYCHFAGGIGDPKYMPIKGWPELHKLLQEAMSSYNDL--VAAMNLVLFEDAMMHVCRINRILESPRGSALLVGVGGSGKQSLARLAAFISSLEVVQIQLKKGYGVNDLKNEFSGLYLKAGLKNVGIMFLMTDAQIPSEDFLVLINDMLATGEIPDLFPDDEIENIIAGVRNEVKGAGLVDTRENCWKFFIDRVRKQLKIVLCFSPVGSTLRVRSRKFPAIINATSINWFHEWPQEALISVAMNFLAQNKVLPENHRDSVAKFMAYV----HTSVNTTSKVYLQNERRYNYTTPKSYLEQINLYIKLLNHKNEDLQSKIERLENGLEKLRSTALQVADLKVKLAVQEIELKE--------KNEAADALIEIVGIETEKVQTEKAVADEEEMKVALIADEVSKKQRDCEEDLLKAEPALMAAQDALNTLNKANLTELKSFGSPPGAVTNVTAAVMVLLSQGGKVPKDRSWKAAKIAMAKVDTFLDSLINYDKENIHPEITKAIQPYLKDPEFEPEFVRSKSGAAAGLCAWVINIIKFYEVYCDVEPKRKALAAANAELAAAQDKLAGIKRKVMSLEEQLGKLTADFEKATADKLRCQQEADATQATIALANRLVGGLASENVRWAEAVNNFVKQGITLPGDILLITAFISYVGCFTKGFRIDLLLKMWTPFLKSIDPPIPTTENLDPLSLLTDDTTIAIWTNEGLPSDRMSIENATILSNSDRWPLMIDPQLQGVKWIKQKYGEDLKVIRLGQRSYLDIIEKSINAGCNVLIENIDENLDPVLDSLLGRNLIKKGKA--IKIGDKEIEYNSNFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKAERPDLEELKADLTKQQNDFKIMLKKLEDDLLSRLSSAGENILGDTALVENLETTKSTASEIEQKVAEAKITSKEIDKAREYYRPAAARASLLYFILNELNTINPIYQFSLKAFSVVFQKAIAKAEPGDTLDLRVSNLIDCITYSVFQYTSRGLFECDKLIFASQMTFQILLMNEEVTSAELDFLLRFPIKPHVTSPVD-----FLTNQSWGGICSLASKDEFRNLDRDIETSSKRWKKLVESELPEKEKFPQEWKNKT-ALQRLCMIRALRPDRMTYALADFIEEKLGSKYVESRAMEFAKSYEEASPSTPIFFILSPG 3905          

HSP 3 Score: 263.848 bits (673), Expect = 0.000e+0
Identity = 324/1472 (22.01%), Postives = 637/1472 (43.27%), Query Frame = 3
Query:  375 EFVTSNNEL-LVAYMHSKNGLQLDTIFPTGRV-NELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSN----TMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPA------EAALYSVENGAKEKDFI--NRMEMIMIHWTRQIKEVL--SAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLK-DMCH----DLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKP-------WNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVK----KELALSTSIG---LPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSS--NADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFD-VPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIK---IDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTL-PELTNIVTSLGKN--FIEVVKEIPRIGEVLQKVKL--KKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCD----LNP------------------HVYSIDA---DISRYTEVTNKALD-AEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKI--PQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASI-PPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLK--DKN---WEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQF--DEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            EF+  N  + L+  +     L   T FP  ++ ++ VYFIKR       I  E+  +FI +G +  R ID L  ++  +  P   SN      WP  +  D    +    S +   + ++ G+T+L +P       +AA   VE    + D    + +E ++I W  QI EV+  S  NAF + ++  P  E  +W NR  +LS I  QL    ++ +  ILE + S+Y   F  L   +     +A+    +LN LK  + H    D ++ KP  IP M     N + ++W NS +Y     +T + +++ N II +    LD   IF   I  +M++L   I   + +++++D       T+ ++P       W     ++F + +AF++R      +   Q  F    +  K E     G RG ++   I  +   F     A   +   +LD     + +D+  F++ + +L++     +  AF+    ++   +++ +   + +R  I+    +    I   L  E  + +    K++ L   +G    P+ + P  A    W   L  RI   + N  +A    I+ +  + +  ++Y  L V L     +   ++   LD    ++L  +L++R      ++ +NFS AL  + +E+HY ++++ + +P  A D   +    R    ++   +  YN I +  +  E  L + +IK +D  ++ G+ +++W+S   + Y ++  R   A LQ ++D  +     IRK   + +   + +      + +    E  D      A ++   + +H  + + M +    F  +S      W  Y++ VD    E     V  S+  L  A N D  N  +PLF+  L L   +LVF+P+L PE       +G N   IE++++I ++G +++++K   K++  E I  + +I  ++  I +G+  +          ++++  +W  ++EE +  + +    L+P                     +I+A    I  Y  + N+  D     V   + Q+D    + ++      W       L+   T SLM L ++++   E + +    ++ E L   M  L ++ E      E F P+ E   +L  Y++   +++ +  Q L ++W    +     +Q +   +      +  +   F+  +      F+T   F      P   + +I +     ES   + ++I+   +LF++  P  K +    K+L  ++ +W       T+   WK+  +   + +++EN+      +  KF++D++  DK    W+      + V     ++  + +L+N A+R+RHW Q+ N  + +F  D E+   TL +++ LN  +  E +  +   A KE+++E  L+ +   W  +E +   H     N  LL   ++L +TL+DN+  L N
Sbjct:   55 EFLDRNTPVVLIIILTPAAQLVPSTTFPLSQLKSKGVYFIKRYALP---IPREDCGNFIIYGDLATRTIDQLSALVEEVLVP-LLSNEDNYRNWPIMVAQDVQKHVHSLKSTVHQVKGQVSGETILAMPVGVEKIVKAAKELVETEQCQFDLYLKSAIEGVVIKWATQIHEVIKESPSNAFANGQNPTPHTEFTFWNNRLKNLSFIYDQLRNERIRAMALILEYSMSAYHPCFQTLFKNVVTALAEAKDITLYLNPLKRPLQHLEEIDFAECKPLLIPFM-----NTVGILWGNSRYYCQSAKITVLLQEICNLIIHQAKRYLDPSSIFHSDIDEAMQRLTLSIQILKFFRELFDYYKERLATFFTEPEERPPILWTFHPNSVFKRFNAFLER------LTTIQWFFFTVIEFLKLEKVEIGGLRGRQLSTRITDVYVEFNQYFTAFASKSYDVLDPDDHEFDEDFKGFQTRILELDMKLAAILCQAFDDCHNLESIFKLISIVGSVLDRPKIKEEFTQRYAEIVRMLDDEMTICESIYDKQMELK-KVGDNLYPNYNCPPVAAFIRWCHQLETRITAPVKNF-KALQHEITKTEKSQEIVERYEILMVKLGSCKTQFFDDWAGQLDGQIEENLKKSLIARDRRHNSLI-LNFSAALFSILREVHYMQQMKIEGIPQIAIDFAEKSDVFRSYTLNLEKTIDWYNSIQEGSSPVELRLIEPEIKMIDDLVEIGVNQLVWNSSDILSY-LDKLRKPVAALQNRMDHTQGNLRQIRKIMGVWAKQPLFERRDCKKDTVLSIDERPDRTSKRYAEIQAASIEIHKLLQDNMLQ----FDMESKQDDAVWLSYVDFVDNIVYENILKTVGVSVGYL--AENMDPENNYAPLFESRLELVEPNLVFVPSLDPE-----DPMGFNNMLIELMRDIMKMGSLIKRLKPNEKRNYVEMIKENQDIIDMRREILNGVDLVMEEASRFCRQFERYSYLWLDDREECMEYFLEYGRMLDPDEIELILINDPNQPPPQPCQPTIEAFREQIDNYESLFNEIEDIGPFQVFSSWFQVDVRPFRQALLNTVCKWGNMFKEHLVTTVTSSLMNLSHFIRKADEGLLQTVKEKDYEGLVSIMAYLMQVKERAAKTDEMFEPMQETIQLLKYYDMDIPEEVNVLLQELPEQWANTKKIASTVKQQVSPLQATEVVSIRNKIALFESHIQLFREVFKTYDFFRFDCYKPYLLMDRINDDMFLCES---EMRDIQESGSLFEVNIPEFKVLKQCRKELRMLKQLWDYVNIVATSIDDWKTTPW---RKVDVENMD----IECKKFAKDIRLLDKEMRPWDTFINLESTVKNMLTSLRAVGELQNPAIRERHWNQLMNSTKVKFIMDHET---TLAELLGLNLHECEEEVKNIVDKAVKEMSMEKILRDLNTTWTVMEFDHELHPRTGCN--LLKASEELIETLEDNQVCLQN 1481          
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Match: Dhc93AB (gene:FBgn0013812 transcript:FBtr0336774)

HSP 1 Score: 922.924 bits (2384), Expect = 0.000e+0
Identity = 504/1225 (41.14%), Postives = 729/1225 (59.51%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLG-EDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFE-ASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDN-------YIREMEGT-FPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIIT----QATIEMYNGVVIKFLPTPTKIHYLFNLRDIS 8166
            L  + TS+++  F  EV  W+  L    + + +   VQR W +LE+IF+  EDIRKQLP +S  FD I+ ++RV+M E++   N  A   + GL+E    +   L   +K+L  YLETKR  FPRFYF+S+ DLL++L     P+ V  HL K FD+I  LK  +  S     AS M++ DGE V F +   + GPVE WL  ++  MR +LR  + +  IA ++   +R++W+ ++  Q+ +  SQI W+ +V  A   + +  D   ++   KKQ   L      +   L+K  R KI ++  I+VH RD++ K+ ++     +AF W SQLR  ++    DC     +  FQY +EYLGN+ RLVITPLTDRCYITLT +LHL  GG+P GPAGTGKTET KDLG+++G  V V NCSE +DY+S G ++ GLAQTGAWGCFDEFNRI +EVLSVVA Q+ S+  A+  +   KF F G MI  VP+VGIFITMNPGYAGRTELP+NLK++FRP AMV PD  +I EI L AEGF   +VLA+K  TLY+L  + LSKQDHYD+GLRA+ SVL  AG  KR +P  P+EE+L+ ++ D N+ K+ + D+P+F G++SDLFP +D P     + +  +++   +  LQP +  I KVVQL E    RHSV IVG   +GK+  W+ L      + +       K +   LNPK+V+  EL+G  +  T EW DG+ S +MR     T    KWI+ DG +D +WIES+N+VMDDNK+LTL + ERI++   + LLFE+ NL  A+PATVSR G++Y +  DLGW PYV SW++ +        L  +FDKYI      I++   ++   +    +  LC L +C     N   P+D        EL+F F  IW+   ++ +D  + ID        ++ E +   FP   T+++YF+D++ K++  W EK+   ++ ++ +P   +IV T +++R  + +  L+   HPVMLVG  G GKT +    L  L+ + + + TI  +  T+S  +Q I+E  +EK+    + P G K +  F+DD NMP  D +G+  P  L+RQ +DYG WYDR K T K I +   +VA   P  G   I+ RLQ  F ++ ++FP   ++  ++ S++ Q   + E++  PI   +T     ATI ++N  +  FLPT  K HY+FNLRDIS
Sbjct: 1489 LQNLITSKYIAHFLEEVSTWQNKLMIADQVITVWFEVQRTWTHLESIFMSSEDIRKQLPVDSDRFDNIDAEFRVLMDEMSVSSNVVASTNRSGLIERLEHLQKELTLCEKALAEYLETKRLAFPRFYFVSSADLLDVLSNGIQPEMVTKHLTKLFDSIARLKFNRDESNEINTASGMYAKDGEYVEFNELASIRGPVEVWLNRIQAAMRASLRHYVMEAVIAYEE--KQREQWLFDYPAQVSLCGSQIWWSTEVNIAFSRLEEGYDNA-IKDYYKKQISQLSLLITLLLGELSKGDRQKIMTICTIDVHSRDVVAKMIQAKLDSGSAFMWQSQLRHRFDDVEKDCFANICDAEFQYCHEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRAIGISVYVFNCSEQMDYQSCGNIYKGLAQTGAWGCFDEFNRITVEVLSVVAVQVKSVQDAI-RDKKDKFNFMGEMISCVPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFQDARVLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPGRPEEEVLMRALRDFNIPKIITDDMPVFMGLISDLFPALDVPRKRDQDFERTVKQAASDLLLQPEDNFILKVVQLEELLEVRHSVFIVGNAGTGKTQVWKTLLRTYQNIKR-------KPIFNDLNPKAVTNDELFGIINPATREWKDGLFSVLMRDQANITGDQPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPSMRLLFEISNLRTATPATVSRAGILYINPQDLGWNPYVTSWVETRKIPAEKSNLVMLFDKYIPPSLETIRVRFKKITPVAEMAHIQMLCHLLNCFLIPANT--PADCPKEWH--ELYFVFACIWAFGSAMFQD--QAIDYRVEFSKWWVNEFKTVKFPPGGTVFDYFLDSETKTFLPWTEKI-PKFELDSDLPLQAVIVHTSESIRLRFFLDLLMDKKHPVMLVGNAGCGKTVLVNEKLQSLSEN-YAVTTIPFNYYTTSEMLQKILEKPLEKKAGRNYGPPGNKLLCYFVDDINMPEVDAYGTVQPHTLMRQHLDYGHWYDRNKLTLKDIHNCQ-YVACMNPTSGSFTINPRLQRHFCVLAVSFPGPESITVMYSSILAQHFANAEQKFTPIVTRMTPNIVAATIALHNKCLQVFLPTAIKSHYIFNLRDIS 2693          

HSP 2 Score: 764.992 bits (1974), Expect = 0.000e+0
Identity = 457/1242 (36.80%), Postives = 706/1242 (56.84%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTD--TYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDET-------RAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQE-RIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMIL---RGAEP---TWAEAKKHLGEQD-FIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKK--EQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +L ++ +       + RLW HE  RV++D++  DKD  +F ++  + +   F++   ++  +K + I+  +        Y  I    +L K ++E +  YN+   V  M+LVLF DA+ H+ +I R++  PRG+ LLVG+GGSG+QSL RLAA++      QI++ K Y   + +++   LY +AG+ N   +FL  D Q+  E FL  IN++L++GEIP+L+  DEI+++   + +E K  G+ DT ++ + + IDRVR  + +VLC SPVG   R R R FPA +N T+I+WF EWP +AL+ VA  +L   ++      D +   +A +    H SV+  S+  L   +R+NY TP +YLE ++ Y  LL  K + L     +L+NGL K+  T       + K+ V  IEL+E        + E  D L+ IV  + E     K+V   +E ++ +   +  K Q     DL +A PAL AA  AL +LNK ++TE+KS+G PP  V  V  AVM+L    G  P   +W  AK  + + D F+  LIN+DK+NI     K I  Y+   +F+P+ V   S AA  LC WV  +  +  VY  VEPKR+ L AA + L   Q +LA  + K+ ++ E++ +L  ++ +    K   +++A+ T+  +  A++LV GLA E  RW + V +   Q   LPGD L+ +AF+SY+G F   +R  L++K WT  +K     IP   +   +  L++ T I  W  +GLP D  S+EN  I++   RWPLM+DPQ Q  KWIKQ  G+ LKVI L    ++ ++E +I  G  VL++N+ E LDP LD +L ++++K G A  +K+GDKEIEYN +FR  + TKL NPHY PE+  +T ++NF V   GLE QLL  VV+ ERP+LEE K +L       K  L +LED++L  L+ A  ++L D  LV  L+T+K T++E+ +++  A+ T   ID AR+ Y   A RAS+L+F+LN+L  I+P+YQF+L A+  +F  +I K+      D R+SNL D  TY+V+ Y  RGLFE  KL+F+ Q+  +IL  + ++   E +F L+  +     + +D     +L++Q+W  I  L     F  L    E   + W     S+ PE    P EW N T   QR+ ++R+LRPDR+++    FI   LG+K+VE   ++  +  +++S  T + F+LSPG
Sbjct: 2697 QGLLFSSTECLTGSTDLIRLWQHETQRVYSDKLTDDKDIDSFTKMQHDIVKKSFEEIDESVIFDKPN-IYCHFAGGIGDPKYMPIKGWPELHKLLQEAMSSYNDL--VAAMNLVLFEDAMMHVCRINRILESPRGSALLVGVGGSGKQSLARLAAFISSLEVVQIQLKKGYGVNDLKNEFSGLYLKAGLKNVGIMFLMTDAQIPSEDFLVLINDMLATGEIPDLFPDDEIENIIAGVRNEVKGAGLVDTRENCWKFFIDRVRKQLKIVLCFSPVGSTLRVRSRKFPAIINATSINWFHEWPQEALISVAMNFLAQNKVLPENHRDSVAKFMAYV----HTSVNTTSKVYLQNERRYNYTTPKSYLEQINLYIKLLNHKNEDLQSKIERLENGLEKLRSTALQVADLKVKLAVQEIELKE--------KNEAADALIEIVGIETEKVQTEKAVADEEEMKVALIADEVSKKQRDCEEDLLKAEPALMAAQDALNTLNKANLTELKSFGSPPGAVTNVTAAVMVLLSQGGKVPKDRSWKAAKIAMAKVDTFLDSLINYDKENIHPEITKAIQPYLKDPEFEPEFVRSKSGAAAGLCAWVINIIKFYEVYCDVEPKRKALAAANAELAAAQDKLAGIKRKVMSLEEQLGKLTADFEKATADKLRCQQEADATQATIALANRLVGGLASENVRWAEAVNNFVKQGITLPGDILLITAFISYVGCFTKGFRIDLLLKMWTPFLKSIDPPIPTTENLDPLSLLTDDTTIAIWTNEGLPSDRMSIENATILSNSDRWPLMIDPQLQGVKWIKQKYGEDLKVIRLGQRSYLDIIEKSINAGCNVLIENIDENLDPVLDSLLGRNLIKKGKA--IKIGDKEIEYNSNFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKAERPDLEELKADLTKQQNDFKIMLKKLEDDLLSRLSSAGENILGDTALVENLETTKSTASEIEQKVAEAKITSKEIDKAREYYRPAAARASLLYFILNELNTINPIYQFSLKAFSVVFQKAIAKAEPGDTLDLRVSNLIDCITYSVFQYTSRGLFECDKLIFASQMTFQILLMNEEVTSAELDFLLRFPIKPHVTSPVD-----FLTNQSWGGICSLASKDEFRNLDRDIETSSKRWKKLVESELPEKEKFPQEWKNKT-ALQRLCMIRALRPDRMTYALADFIEEKLGSKYVESRAMEFAKSYEEASPSTPIFFILSPG 3915          

HSP 3 Score: 258.07 bits (658), Expect = 0.000e+0
Identity = 325/1482 (21.93%), Postives = 638/1482 (43.05%), Query Frame = 3
Query:  375 EFVTSNNEL-LVAYMHSKNGLQLDTIFPTGRV-NELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSN----TMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPA------EAALYSVENGAKEKDFI--NRMEMIMIHWTRQIKEVL--SAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLK-DMCH----DLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKP-------WNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVK----KELALSTSIG---LPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSS--NADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFD-VPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIK---IDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTL-PELTNIVTSLGKN--FIEVVKEIPRIGEVLQKVKL--KKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCD----LNP------------------HVYSIDA---DISRYTEVTNKALD-AEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKI--PQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASI-PPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLK--DKN---WEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKN----------EIRKQF--DEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            EF+  N  + L+  +     L   T FP  ++ ++ VYFIKR       I  E+  +FI +G +  R ID L  ++  +  P   SN      WP  +  D    +    S +   + ++ G+T+L +P       +AA   VE    + D    + +E ++I W  QI EV+  S  NAF + ++  P  E  +W NR  +LS I  QL    ++ +  ILE + S+Y   F  L   +     +A+    +LN LK  + H    D ++ KP  IP M     N + ++W NS +Y     +T + +++ N II +    LD   IF   I  +M++L   I   + +++++D       T+ ++P       W     ++F + +AF++R      +   Q  F    +  K E     G RG ++   I  +   F     A   +   +LD     + +D+  F++ + +L++     +  AF+    ++   +++ +   + +R  I+    +    I   L  E  + +    K++ L   +G    P+ + P  A    W   L  RI   + N  +A    I+ +  + +  ++Y  L V L     +   ++   LD    ++L  +L++R      ++ +NFS AL  + +E+HY ++++ + +P  A D   +    R    ++   +  YN I +  +  E  L + +IK +D  ++ G+ +++W+S   + Y ++  R   A LQ ++D  +     IRK   + +   + +      + +    E  D      A ++   + +H  + + M +    F  +S      W  Y++ VD    E     V  S+  L  A N D  N  +PLF+  L L   +LVF+P+L PE       +G N   IE++++I ++G +++++K   K++  E I  + +I  ++  I +G+  +          ++++  +W  ++EE +  + +    L+P                     +I+A    I  Y  + N+  D     V   + Q+D    + ++      W       L+   T SLM L ++++   E + +    ++ E L   M  L ++ E      E F P+ E   +L  Y++   +++ +  Q L ++W    +     +Q +   +      +  +   F+  +      F+T   F      P   + +I +     ES   + ++I+   +LF++  P  K +    K+L  ++ +W       T+   WK+  +   + +++EN+      +  KF++D++  DK    W+      + V     ++  + +L+N A+R+RHW Q+ N          E+  +F  D E+   TL +++ LN  +  E +  +   A KE+++E  L+ +   W  +E +   H     N  LL   ++L +TL+DN+  L N
Sbjct:   55 EFLDRNTPVVLIIILTPAAQLVPSTTFPLSQLKSKGVYFIKRYALP---IPREDCGNFIIYGDLATRTIDQLSALVEEVLVP-LLSNEDNYRNWPIMVAQDVQKHVHSLKSTVHQVKGQVSGETILAMPVGVEKIVKAAKELVETEQCQFDLYLKSAIEGVVIKWATQIHEVIKESPSNAFANGQNPTPHTEFTFWNNRLKNLSFIYDQLRNERIRAMALILEYSMSAYHPCFQTLFKNVVTALAEAKDITLYLNPLKRPLQHLEEIDFAECKPLLIPFM-----NTVGILWGNSRYYCQSAKITVLLQEICNLIIHQAKRYLDPSSIFHSDIDEAMQRLTLSIQILKFFRELFDYYKERLATFFTEPEERPPILWTFHPNSVFKRFNAFLER------LTTIQWFFFTVIEFLKLEKVEIGGLRGRQLSTRITDVYVEFNQYFTAFASKSYDVLDPDDHEFDEDFKGFQTRILELDMKLAAILCQAFDDCHNLESIFKLISIVGSVLDRPKIKEEFTQRYAEIVRMLDDEMTICESIYDKQMELK-KVGDNLYPNYNCPPVAAFIRWCHQLETRITAPVKNF-KALQHEITKTEKSQEIVERYEILMVKLGSCKTQFFDDWAGQLDGQIEENLKKSLIARDRRHNSLI-LNFSAALFSILREVHYMQQMKIEGIPQIAIDFAEKSDVFRSYTLNLEKTIDWYNSIQEGSSPVELRLIEPEIKMIDDLVEIGVNQLVWNSSDILSY-LDKLRKPVAALQNRMDHTQGNLRQIRKIMGVWAKQPLFERRDCKKDTVLSIDERPDRTSKRYAEIQAASIEIHKLLQDNMLQ----FDMESKQDDAVWLSYVDFVDNIVYENILKTVGVSVGYL--AENMDPENNYAPLFESRLELVEPNLVFVPSLDPE-----DPMGFNNMLIELMRDIMKMGSLIKRLKPNEKRNYVEMIKENQDIIDMRREILNGVDLVMEEASRFCRQFERYSYLWLDDREECMEYFLEYGRMLDPDEIELILINDPNQPPPQPCQPTIEAFREQIDNYESLFNEIEDIGPFQVFSSWFQVDVRPFRQALLNTVCKWGNMFKEHLVTTVTSSLMNLSHFIRKADEGLLQTVKEKDYEGLVSIMAYLMQVKERAAKTDEMFEPMQETIQLLKYYDMDIPEEVNVLLQELPEQWANTKKIASTVKQQVSPLQATEVVSIRNKIALFESHIQLFREVFKTYDFFRFDCYKPYLLMDRINDDMFLCES---EMRDIQESGSLFEVNIPEFKVLKQCRKELRMLKQLWDYVNIVATSIDDWKTTPW---RKVDVENMD----IECKKFAKDIRLLDKEMRPWDTFINLESTVKNMLTSLRAVGELQNPAIRERHWNQLMNSTKSLAALPKEVTVKFIMDHET---TLAELLGLNLHECEEEVKNIVDKAVKEMSMEKILRDLNTTWTVMEFDHELHPRTGCN--LLKASEELIETLEDNQVCLQN 1491          
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Match: Dhc98D (gene:FBgn0013813 transcript:FBtr0301303)

HSP 1 Score: 920.228 bits (2377), Expect = 0.000e+0
Identity = 517/1256 (41.16%), Postives = 736/1256 (58.60%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLR--------DLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCC--DNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADT-RPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFI--------KMNCIEL-IRTSPTNSVISLCKLFDCL-----ATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREME---------------GTFP-NKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQ-KRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKL--QDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  M  S+F+ PF   V+KWER L+ I E ++  L VQR+WLYLE IF+G DIR QLP+E+  FD I+K +R IM +  +           G L     +   LE+ QKSL+ YL++KR IFPRFYFIS D+LL ILG S+ P  V  H+ K +DNI SL++ K  SQ    + M SS+GE + F+   R  G VE W+ D+   MR + R        D   D +I+       R  W+  + G + + +SQ+ WTA+V +A        + + ++    K    +E+    +RSNL++  RLK  +   ++VH RDII+   +    D + F W SQLRFYW K  D+  + Q + SF +GYEY+G +GRLVITPLTDR Y+T+T AL ++ GG+P GPAGTGKTETVKDL K++G   +V NC EG+DY+++G + SGL Q GAWGCFDEFNRI+I VLSV++ Q+ +I + L      +F+F+G  I L P  G+F+TMNPGYAGRTELP+++K++FRP+  + PD  +I  I+LF++GF   KVLAKK+  LYSL+  QLSKQ HYD+GLR+L SVLR AG  KR +  +P+  +L+  + DMN  K    D+PLF G++ DLFPGID P + Y +   A+      D + L P      KVVQ+YET  +RHS M+VG T  GK+     L  A   +    +          LNPK+ S+ ELYG  D+ T +W DG+ S++ R+      R + ++  FDG VD LWIE+MNSVMDDNK+LTL NGERI +    +LLFEV NL+ ASPATVSR GMVY D  +L + P+ + W+  + +    E L+  F+K I +   FI        + N ++L I  +  N V   C L+D L        +N  +P   +  +  +E  F   +  S+   + E  +   D Y++ +                G FP +K T+Y+YF D K+  W  W E +   + ++  V F +I+VPTVD  R N  +  +     PV+LVG  GT KT+  +  L  LN  +  IL IN S++TSS +VQ  +EA VEKRTKDT+ P  GKR+  F+DD NMP  D +G+Q P+ L++ + + G  YDR K    K+ KD+  + AMG  GGGR  +  R  S F+  N+ FP + +L +I+ S+    +    F+ E   I D+I   T++++  V++   PTP+K HY+FNL+D+S+
Sbjct: 1979 LQSMGASQFIGPFLETVNKWERTLALISEIIDEWLVVQRKWLYLEGIFIGGDIRTQLPEEARKFDDIDKSYRRIMVDCAKNPLVVPFCTVPGRLVEIQGLGIGLENCQKSLNEYLDSKRRIFPRFYFISTDELLSILGSSE-PSAVQNHIIKMYDNIKSLRLVKEGSQTI-VTGMISSEGEVMEFRHSARAAGRVEYWMNDVLDEMRRSNRFINKTAIYDFGTDLQIS-------RPDWLMNYQGMVGLAASQVWWTAEVEEAFDQAQNHGNMRAMKDFLGKNNYQIEELVLKVRSNLSRNDRLKFKAQCTVDVHARDIIDNFVRDNVLDASEFSWESQLRFYWIKFYDNLHVLQCSGSFDFGYEYMGLNGRLVITPLTDRIYLTITQALLMNLGGAPAGPAGTGKTETVKDLAKAMGLLCVVTNCGEGMDYRAVGTILSGLVQCGAWGCFDEFNRIDISVLSVISTQLQTIRNGLIRKL-DRFVFEGVEIHLDPKCGVFVTMNPGYAGRTELPESVKALFRPVTCIKPDLELICLISLFSDGFLTAKVLAKKMTVLYSLAQAQLSKQCHYDWGLRSLNSVLRMAGVMKRQSEDLPEAVVLMRVLRDMNFPKFVFEDVPLFLGLIKDLFPGIDCPRIGYPDFNAAVRHVLVNDGYILLPDQ--EDKVVQMYETMMTRHSTMLVGPTGGGKTVVINALVKAQTHMGLPTKC-------LVLNPKACSVIELYGFLDMETRDWIDGLFSNIFREMNKPIEREERRYACFDGDVDALWIENMNSVMDDNKLLTLANGERIRLENYCALLFEVGNLNYASPATVSRAGMVYVDPKNLRYSPFWQRWVLTRPEPQR-ELLNDFFEKIITQSIAFILEGLDGTTQGNPLKLVIMQTDLNMVTQFCNLYDALLPNYVMDSKNYDEPVQQNYNTDSLECCFLQAVYGSMGACLVEKHQPVFDEYMKRISGFPLVQDTPENPASGGQFPQSKPTLYDYFWDVKDNVWKAW-EWVVQPYTHDPQVKFSEILVPTVDNTRTNRTLSLMSEIKRPVLLVGEAGTSKTATIMQYLRNLNPSVNVILNINFSSRTSSLDVQHTLEAAVEKRTKDTYGPPMGKRIACFIDDMNMPQVDDYGTQQPIALLKLFFERGGMYDRDKDLNWKKFKDLTFYAAMGTAGGGRNEVDPRFISMFSTYNIIFPNDESLIQIYSSIFKGHMVFVKFQPEYMLIADMIVHMTLKLFKMVIVDLPPTPSKFHYIFNLKDLSR 3213          

HSP 2 Score: 786.178 bits (2029), Expect = 0.000e+0
Identity = 416/1164 (35.74%), Postives = 681/1164 (58.51%), Query Frame = 3
Query: 8370 IFGDYMSSTD-----TYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRG-AEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISEL--DKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            +FGD+ + T+      YED+ D   +     E+L+EY       +M LVLF D +EH++++ R +R  RG++LL+G+GGSG++ +TRLAA+  E   F+I +S+ Y +  FR+DLK LY  AGV  K  +FLF   QV +E FLE INNIL+ G++P L+  ++ D + NQ+   A+ DG+  +  +++ Y +     N+HVVLCMSP G+  RNR R FP  +  T IDW   WP  AL  VA+ +L + +L      + +  H+  +    H S+   S+  L +++R+N+VTP +YL+ ++ Y+ LL EK K ++   ++L  G+ KI+E   +++ + I + E +K +A+  +EC+  LV I    ++A+ +     +    +++   +    ++ A   LA+AMPALE A  AL  L K  ITEI+S+  PPA VQ V E V IL+G  E  W  AK  + + +F+K L+  D + ++ + + +   ++   + + DM  K+S+A   L  +V A+  +  VY+ V+PK++RL         +   L     ++  + E++  L + Y   M+Q   L +  +  E+ L  + KL+SGL  E  RW K +A L  Q+    G CLI+++FL+Y G F  ++R+A+V   W E I    IP    F    +L+   +I  W+ +GLP D  S++NG++  R SR+PL +DPQ QA +WI++ E K  LKV+     DF++ LE+AI +G PVL ++V + +DP +D IL K+I   GG   + LGDKE++++  FR Y+TTK  NP + P +  K  ++N+ V + GLE QLL +VV  ERP+LE Q+++L+   +  K+ L +LED +LR L+ + G++LD+ +L+ TL+ +K  +  V EQL++A  T   I++ R GY   A+R ++LFF L+D+  ++ MYQ+AL AY+D+F  S+ K+      ++R++N+    T  VYCY C G+FE+HKLLFSFQI  K+ Q  G +   E +FF+KG + L + ++  NPC  WLS+++W+++ +L  D    F  L   F +Y  +W  W+  ++PE    PG+++   N FQ+++ +R  R DR+      +I+  +   ++ PPV+    + + +S+   + FVLS G
Sbjct: 3335 LFGDFRNFTNESEPRLYEDLLDYNSVYFLFTEILEEYCERKQ--KMTLVLFEDCLEHLTRVHRTLRMNRGHVLLIGVGGSGKKCITRLAAFAAECDVFEITISRGYNEAAFREDLKVLYTIAGVKRKKVVFLFTGAQVAEEGFLELINNILTVGQVPALFPDEDKDGIVNQVRKFAEEDGVSASKDAVWGYFLRTCAENLHVVLCMSPAGDALRNRCRNFPGLIGSTYIDWVFPWPRQALYAVAKLFLTEHRLIPASHREAIVEHVVHV----HTSIQQYSKDYLAKLRRNNFVTPKHYLDYINTYRGLLEEKAKFITQQRSRLGEGIKKIEEASVQIDELRIIVTEQKKNVAVASEECEAMLVTIESSTQKANVKKAEASEKSVEVEIKGKQIAIEKDEAEEILAEAMPALEEARLALSQLEKAQITEIRSFATPPAAVQVVCECVAILKGYKEINWKSAKGMMSDVNFLKSLMEMDCEALTQKQITQCRQHMKTGNLE-DM-AKISVAGAGLLRFVRAVLGFFDVYKEVKPKKERLDFLVEEQEVQIKLLNHLNGEIQKLEEKLNELNENYATSMKQMRALTEMMQQAERRLIASDKLISGLTSELIRWSKEMASLGQQLIDSVGGCLISASFLAYTGAFTWEFRKAMVFDDWLEDIASLGIPIQLPFKIDGYLTTDVEISQWSNEGLPPDELSIQNGILTMRASRFPLCIDPQLQALQWIRKREFKNNLKVLSFSDSDFLKQLEMAIMYGTPVLFEDVDDYIDPVIDDILQKNIRIQGGRKFVMLGDKEVDWDPSFRVYLTTKFSNPKFDPAVYAKALVINYTVTQTGLEDQLLSVVVGTERPDLEAQRESLIAQTSENKQLLQQLEDSLLRELSTSTGNMLDNVELIETLENTKTKAGVVMEQLKLAADTAADIEVLRNGYRPAAKRGAVLFFALSDMATVNSMYQYALAAYLDVFVYSLRKAVPDASLNKRLNNIIKTLTENVYCYGCTGIFERHKLLFSFQIATKLAQRDGILLQSELDFFIKGSIALTK-SERSNPCK-WLSEKSWEDVLKLAFDFPDIFGTLPDHFGRYLTEWKEWFDLENPEEVPCPGDYNIKCNAFQKLMFLRCFRVDRIFRSINQYIVETMDEFYIMPPVVSFSAIYEQTSSTIPVCFVLSAG 4488          

HSP 3 Score: 170.244 bits (430), Expect = 0.000e+0
Identity = 184/860 (21.40%), Postives = 351/860 (40.81%), Query Frame = 3
Query: 2214 INFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAH---RAVVKEKLVGLHGEIIN-----------------------------------------QMRETYE---------------IFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPR----------IGEVLQKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSI-QEPLGYWDQFRE---IWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQE-FLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANS---SFRKATKFSRDLK-DKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPH-KDKEKNHFLLSGIDDLYQTLDDNRNTLSNEDIS 4556
            +N  R +  +  E   +E L F +P       +++  L    E +  VV  Y  I+  L+  E    +  I   +  IQ G+ +  W+S   I  F +       +L   V +      D+R   ++I S  +  +D     E+T    S E++   R    ++   + GE I                                          QM++ Y+                FS  S  ++ Y+  +         E F+  V  +   L   IN    N+P  +F+V+  L M ++V  P++ EL N + +  K++I  ++   R          + E+ ++ K   + +E +     I  +  NI     D++S +  E  G+  QFR+   +W   K     ++ +    +  ID   + Y+ +     +      +K ++++   L  SI  H +DW   L   LL     ++  + N +K +S  ++K  + LE+    M  +  +       ++K H + E F IL ++++ +  +  L   +LEK W+  FL AL   E++ +  K KF     V+ D+F   ++  I D+  NGP +     +  +  +  +   +   + + +E+     LF +      E A ++ + + ++ ++KL    +     W    + +L    +     S    FRK TK  R L      EI       + QF+ T+PL+  L++EA+R+RHW Q+  +  + FD   + FTLE +  +   ++ E+  ++   A KEL IE  ++ + + W S+  +   H K  +   ++L  +D++ Q L+DN   L +   S
Sbjct: 1148 VNLKRDVFDVLFEAQQFEHLGFTLPAVLRTAIMKKDLLFKDYERMTEVVDRYRSIINNLSMSEVIFLRGHIYDTELFIQMGVGRYTWTSFN-IGKFCDQINSQLRKLTSIVSQINFIRLDLRSRIDMIKSFNLFNLDDELKVEDTS-RSSGESYLQDRKNPSQRFKSVTGETITMFSVEKDVPADEKAEQACGSGIYPCQGYFELLEASRNRKAAQMKKLYDSLGPVLVKLESLVLGTFSGRSDRMKTYYEYWEG-------ETFKCIVDMTYQNLKCYINRLLSNKP--MFEVNAVLLMSEIVLEPSVQELQNTIVTATKDYISRLRIFTRWMTGTCIACPLVEMGKQFKYNYTYYEDVIQIRSIVDLVINI----HDLASRVANEARGFVSQFRKYFNLWAFEKSFICQKFLEKQVTLIEIDEKFTFYSSIVETLANTRKFQDIKCVRINLEPLLASITQHAQDWCTTLGEELLRHVNDNMRAMRNEVKTLSLNLNKTTRELEDFKLVMTTIGTVQSSTLTNEQKIHEMQETFTILSEHKIMFPYEDMLMAHHLEKRWKRLFLSALYRYEKL-QPIKQKFADMTSVEIDEFCDDLAEFIKDYDENGPGSVGAELERGVRLMDPYGQKIAERESRREELANAERLFDMAMVDYHEFARVQTEFEGLQQLYKLYKAQKYAREGWGKTLWADLDPNVLTEGVESYLKEFRKFTKAVRTLPVGVQLEI------HMKQFKGTVPLMVSLKHEALRERHWLQLMEKTGQYFDMSPARFTLENMFAMQLHKYQEIAEQILTNAIKELQIERGVQAVIETWASMAFKTFKHFKGSDDRGWVLGPVDEIMQILEDNAMNLQSMGAS 1985          
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Match: Dhc98D (gene:FBgn0013813 transcript:FBtr0301302)

HSP 1 Score: 920.228 bits (2377), Expect = 0.000e+0
Identity = 517/1256 (41.16%), Postives = 736/1256 (58.60%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLR--------DLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCC--DNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADT-RPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFI--------KMNCIEL-IRTSPTNSVISLCKLFDCL-----ATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREME---------------GTFP-NKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQ-KRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKL--QDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  M  S+F+ PF   V+KWER L+ I E ++  L VQR+WLYLE IF+G DIR QLP+E+  FD I+K +R IM +  +           G L     +   LE+ QKSL+ YL++KR IFPRFYFIS D+LL ILG S+ P  V  H+ K +DNI SL++ K  SQ    + M SS+GE + F+   R  G VE W+ D+   MR + R        D   D +I+       R  W+  + G + + +SQ+ WTA+V +A        + + ++    K    +E+    +RSNL++  RLK  +   ++VH RDII+   +    D + F W SQLRFYW K  D+  + Q + SF +GYEY+G +GRLVITPLTDR Y+T+T AL ++ GG+P GPAGTGKTETVKDL K++G   +V NC EG+DY+++G + SGL Q GAWGCFDEFNRI+I VLSV++ Q+ +I + L      +F+F+G  I L P  G+F+TMNPGYAGRTELP+++K++FRP+  + PD  +I  I+LF++GF   KVLAKK+  LYSL+  QLSKQ HYD+GLR+L SVLR AG  KR +  +P+  +L+  + DMN  K    D+PLF G++ DLFPGID P + Y +   A+      D + L P      KVVQ+YET  +RHS M+VG T  GK+     L  A   +    +          LNPK+ S+ ELYG  D+ T +W DG+ S++ R+      R + ++  FDG VD LWIE+MNSVMDDNK+LTL NGERI +    +LLFEV NL+ ASPATVSR GMVY D  +L + P+ + W+  + +    E L+  F+K I +   FI        + N ++L I  +  N V   C L+D L        +N  +P   +  +  +E  F   +  S+   + E  +   D Y++ +                G FP +K T+Y+YF D K+  W  W E +   + ++  V F +I+VPTVD  R N  +  +     PV+LVG  GT KT+  +  L  LN  +  IL IN S++TSS +VQ  +EA VEKRTKDT+ P  GKR+  F+DD NMP  D +G+Q P+ L++ + + G  YDR K    K+ KD+  + AMG  GGGR  +  R  S F+  N+ FP + +L +I+ S+    +    F+ E   I D+I   T++++  V++   PTP+K HY+FNL+D+S+
Sbjct: 1986 LQSMGASQFIGPFLETVNKWERTLALISEIIDEWLVVQRKWLYLEGIFIGGDIRTQLPEEARKFDDIDKSYRRIMVDCAKNPLVVPFCTVPGRLVEIQGLGIGLENCQKSLNEYLDSKRRIFPRFYFISTDELLSILGSSE-PSAVQNHIIKMYDNIKSLRLVKEGSQTI-VTGMISSEGEVMEFRHSARAAGRVEYWMNDVLDEMRRSNRFINKTAIYDFGTDLQIS-------RPDWLMNYQGMVGLAASQVWWTAEVEEAFDQAQNHGNMRAMKDFLGKNNYQIEELVLKVRSNLSRNDRLKFKAQCTVDVHARDIIDNFVRDNVLDASEFSWESQLRFYWIKFYDNLHVLQCSGSFDFGYEYMGLNGRLVITPLTDRIYLTITQALLMNLGGAPAGPAGTGKTETVKDLAKAMGLLCVVTNCGEGMDYRAVGTILSGLVQCGAWGCFDEFNRIDISVLSVISTQLQTIRNGLIRKL-DRFVFEGVEIHLDPKCGVFVTMNPGYAGRTELPESVKALFRPVTCIKPDLELICLISLFSDGFLTAKVLAKKMTVLYSLAQAQLSKQCHYDWGLRSLNSVLRMAGVMKRQSEDLPEAVVLMRVLRDMNFPKFVFEDVPLFLGLIKDLFPGIDCPRIGYPDFNAAVRHVLVNDGYILLPDQ--EDKVVQMYETMMTRHSTMLVGPTGGGKTVVINALVKAQTHMGLPTKC-------LVLNPKACSVIELYGFLDMETRDWIDGLFSNIFREMNKPIEREERRYACFDGDVDALWIENMNSVMDDNKLLTLANGERIRLENYCALLFEVGNLNYASPATVSRAGMVYVDPKNLRYSPFWQRWVLTRPEPQR-ELLNDFFEKIITQSIAFILEGLDGTTQGNPLKLVIMQTDLNMVTQFCNLYDALLPNYVMDSKNYDEPVQQNYNTDSLECCFLQAVYGSMGACLVEKHQPVFDEYMKRISGFPLVQDTPENPASGGQFPQSKPTLYDYFWDVKDNVWKAW-EWVVQPYTHDPQVKFSEILVPTVDNTRTNRTLSLMSEIKRPVLLVGEAGTSKTATIMQYLRNLNPSVNVILNINFSSRTSSLDVQHTLEAAVEKRTKDTYGPPMGKRIACFIDDMNMPQVDDYGTQQPIALLKLFFERGGMYDRDKDLNWKKFKDLTFYAAMGTAGGGRNEVDPRFISMFSTYNIIFPNDESLIQIYSSIFKGHMVFVKFQPEYMLIADMIVHMTLKLFKMVIVDLPPTPSKFHYIFNLKDLSR 3220          

HSP 2 Score: 786.178 bits (2029), Expect = 0.000e+0
Identity = 416/1164 (35.74%), Postives = 681/1164 (58.51%), Query Frame = 3
Query: 8370 IFGDYMSSTD-----TYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRG-AEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISEL--DKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            +FGD+ + T+      YED+ D   +     E+L+EY       +M LVLF D +EH++++ R +R  RG++LL+G+GGSG++ +TRLAA+  E   F+I +S+ Y +  FR+DLK LY  AGV  K  +FLF   QV +E FLE INNIL+ G++P L+  ++ D + NQ+   A+ DG+  +  +++ Y +     N+HVVLCMSP G+  RNR R FP  +  T IDW   WP  AL  VA+ +L + +L      + +  H+  +    H S+   S+  L +++R+N+VTP +YL+ ++ Y+ LL EK K ++   ++L  G+ KI+E   +++ + I + E +K +A+  +EC+  LV I    ++A+ +     +    +++   +    ++ A   LA+AMPALE A  AL  L K  ITEI+S+  PPA VQ V E V IL+G  E  W  AK  + + +F+K L+  D + ++ + + +   ++   + + DM  K+S+A   L  +V A+  +  VY+ V+PK++RL         +   L     ++  + E++  L + Y   M+Q   L +  +  E+ L  + KL+SGL  E  RW K +A L  Q+    G CLI+++FL+Y G F  ++R+A+V   W E I    IP    F    +L+   +I  W+ +GLP D  S++NG++  R SR+PL +DPQ QA +WI++ E K  LKV+     DF++ LE+AI +G PVL ++V + +DP +D IL K+I   GG   + LGDKE++++  FR Y+TTK  NP + P +  K  ++N+ V + GLE QLL +VV  ERP+LE Q+++L+   +  K+ L +LED +LR L+ + G++LD+ +L+ TL+ +K  +  V EQL++A  T   I++ R GY   A+R ++LFF L+D+  ++ MYQ+AL AY+D+F  S+ K+      ++R++N+    T  VYCY C G+FE+HKLLFSFQI  K+ Q  G +   E +FF+KG + L + ++  NPC  WLS+++W+++ +L  D    F  L   F +Y  +W  W+  ++PE    PG+++   N FQ+++ +R  R DR+      +I+  +   ++ PPV+    + + +S+   + FVLS G
Sbjct: 3342 LFGDFRNFTNESEPRLYEDLLDYNSVYFLFTEILEEYCERKQ--KMTLVLFEDCLEHLTRVHRTLRMNRGHVLLIGVGGSGKKCITRLAAFAAECDVFEITISRGYNEAAFREDLKVLYTIAGVKRKKVVFLFTGAQVAEEGFLELINNILTVGQVPALFPDEDKDGIVNQVRKFAEEDGVSASKDAVWGYFLRTCAENLHVVLCMSPAGDALRNRCRNFPGLIGSTYIDWVFPWPRQALYAVAKLFLTEHRLIPASHREAIVEHVVHV----HTSIQQYSKDYLAKLRRNNFVTPKHYLDYINTYRGLLEEKAKFITQQRSRLGEGIKKIEEASVQIDELRIIVTEQKKNVAVASEECEAMLVTIESSTQKANVKKAEASEKSVEVEIKGKQIAIEKDEAEEILAEAMPALEEARLALSQLEKAQITEIRSFATPPAAVQVVCECVAILKGYKEINWKSAKGMMSDVNFLKSLMEMDCEALTQKQITQCRQHMKTGNLE-DM-AKISVAGAGLLRFVRAVLGFFDVYKEVKPKKERLDFLVEEQEVQIKLLNHLNGEIQKLEEKLNELNENYATSMKQMRALTEMMQQAERRLIASDKLISGLTSELIRWSKEMASLGQQLIDSVGGCLISASFLAYTGAFTWEFRKAMVFDDWLEDIASLGIPIQLPFKIDGYLTTDVEISQWSNEGLPPDELSIQNGILTMRASRFPLCIDPQLQALQWIRKREFKNNLKVLSFSDSDFLKQLEMAIMYGTPVLFEDVDDYIDPVIDDILQKNIRIQGGRKFVMLGDKEVDWDPSFRVYLTTKFSNPKFDPAVYAKALVINYTVTQTGLEDQLLSVVVGTERPDLEAQRESLIAQTSENKQLLQQLEDSLLRELSTSTGNMLDNVELIETLENTKTKAGVVMEQLKLAADTAADIEVLRNGYRPAAKRGAVLFFALSDMATVNSMYQYALAAYLDVFVYSLRKAVPDASLNKRLNNIIKTLTENVYCYGCTGIFERHKLLFSFQIATKLAQRDGILLQSELDFFIKGSIALTK-SERSNPCK-WLSEKSWEDVLKLAFDFPDIFGTLPDHFGRYLTEWKEWFDLENPEEVPCPGDYNIKCNAFQKLMFLRCFRVDRIFRSINQYIVETMDEFYIMPPVVSFSAIYEQTSSTIPVCFVLSAG 4495          

HSP 3 Score: 170.629 bits (431), Expect = 0.000e+0
Identity = 184/860 (21.40%), Postives = 351/860 (40.81%), Query Frame = 3
Query: 2214 INFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAH---RAVVKEKLVGLHGEIIN-----------------------------------------QMRETYE---------------IFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPR----------IGEVLQKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSI-QEPLGYWDQFRE---IWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQE-FLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANS---SFRKATKFSRDLK-DKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPH-KDKEKNHFLLSGIDDLYQTLDDNRNTLSNEDIS 4556
            +N  R +  +  E   +E L F +P       +++  L    E +  VV  Y  I+  L+  E    +  I   +  IQ G+ +  W+S   I  F +       +L   V +      D+R   ++I S  +  +D     E+T    S E++   R    ++   + GE I                                          QM++ Y+                FS  S  ++ Y+  +         E F+  V  +   L   IN    N+P  +F+V+  L M ++V  P++ EL N + +  K++I  ++   R          + E+ ++ K   + +E +     I  +  NI     D++S +  E  G+  QFR+   +W   K     ++ +    +  ID   + Y+ +     +      +K ++++   L  SI  H +DW   L   LL     ++  + N +K +S  ++K  + LE+    M  +  +       ++K H + E F IL ++++ +  +  L   +LEK W+  FL AL   E++ +  K KF     V+ D+F   ++  I D+  NGP +     +  +  +  +   +   + + +E+     LF +      E A ++ + + ++ ++KL    +     W    + +L    +     S    FRK TK  R L      EI       + QF+ T+PL+  L++EA+R+RHW Q+  +  + FD   + FTLE +  +   ++ E+  ++   A KEL IE  ++ + + W S+  +   H K  +   ++L  +D++ Q L+DN   L +   S
Sbjct: 1155 VNLKRDVFDVLFEAQQFEHLGFTLPAVLRTAIMKKDLLFKDYERMTEVVDRYRSIINNLSMSEVIFLRGHIYDTELFIQMGVGRYTWTSFN-IGKFCDQINSQLRKLTSIVSQINFIRLDLRSRIDMIKSFNLFNLDDELKVEDTS-RSSGESYLQDRKNPSQRFKSVTGETITMFSVEKDVPADEKAEQACGSGIYPCQGYFELLEASRNRKAAQMKKLYDSLGPVLVKLESLVLGTFSGRSDRMKTYYEYWEG-------ETFKCIVDMTYQNLKCYINRLLSNKP--MFEVNAVLLMSEIVLEPSVQELQNTIVTATKDYISRLRIFTRWMTGTCIACPLVEMGKQFKYNYTYYEDVIQIRSIVDLVINI----HDLASRVANEARGFVSQFRKYFNLWAFEKSFICQKFLEKQVTLIEIDEKFTFYSSIVETLANTRKFQDIKCVRINLEPLLASITQHAQDWCTTLGEELLRHVNDNMRAMRNEVKTLSLNLNKTTRELEDFKLVMTTIGTVQSSTLTNEQKIHEMQETFTILSEHKIMFPYEDMLMAHHLEKRWKRLFLSALYRYEKL-QPIKQKFADMTSVEIDEFCDDLAEFIKDYDENGPGSVGAELERGVRLMDPYGQKIAERESRREELANAERLFDMAMVDYHEFARVQTEFEGLQQLYKLYKAQKYAREGWGKTLWADLDPNVLTEGVESYLKEFRKFTKAVRTLPVGVQLEI------HMKQFKGTVPLMVSLKHEALRERHWLQLMEKTGQYFDMSPARFTLENMFAMQLHKYQEIAEQILTNAIKELQIERGVQAVIETWASMAFKTFKHFKGSDDRGWVLGPVDEIMQILEDNAMNLQSMGAS 1992          
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1784.23 bits (4620), Expect = 0.000e+0
Identity = 841/1210 (69.50%), Postives = 1004/1210 (82.98%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKL-MSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            +K SRFVK FE EVD WER LS + E +EM+LTVQRQW+YLENIFL +DIRKQL +E+A+FD +   W++IM  L++ +NA       GLLE  + MNT LE+IQKSLDMYLETKR IFPRFYF+SNDDLLEILGQS+NP+ V PHLKKCFDNI SL+I K+      EAS MFS+DGE V F   + LEGPVEAWLCD+E+ MR TL+D LR+C +ALKK   KR KW+++W GQ+ IT+SQIQWT DVT+AL    +R DK  L+ +KKKQ  +L ++SEAIR NLTKI RLKI +LV +EVH RD+I KL K GC D+NAF+WL QLR YWEK++DDC+I+QTNT F+YGYEYLGNSGRLVITPLTDRCY+TLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLG YVIVVNCSEGLD+KSMGRM+SGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSAL++     F F+GR I+L+ S GIFITMNPGYAGRTELPDNLKSMFRPI+MV PDS +IAEITLFAEGF+ CKVLAKKVFTLYSL++QQLSKQDHYDFGLRAL S+LRYAG+K+RA P + DEEILL+SM DMN+AKL+S+DLPLF GI+ DLFP +++P +DY  +KEA+E       LQ   FT+TKV+QLYETK SRHS MIVGKT SGK+ TWR LQ+ L+ L +  E  F    E PLNPK+VSLGELYGE++L+TNEWTDGVLSS+MR  CAD +PDEKWI+FDGPVDTLWIESMNSVMDDNK+LTLINGERISMPEQVSLLFEVE+LSVASPATVSRCGMVY+D +DLGW+PYV+SW++++   V  + L ++F++YI+K   F K +C EL+  +  N V SLC+L+  LAT ENG  P+D++NY R++ELWF F +IWS+C SVDE+GRKKID ++RE+EG+FPNKDTIYEY+VD KNK+W  +++KL  GW+Y ++ PFYKI+VPTVDTVRY+YLV+ LV   HPV+L GPVGTGKTSVA + L  L+N  W  LT+NMS+QTSSNNVQ+IIE+RVEKR K  +VPVGGK+M+ F+DD NMPA D FGSQPPLEL+R WIDYGFWYDR KQT K IKD++L  +MGPPGGGR  IS RLQSRFNLINMTFPTES +KRI+G+MI+QKLQ+FEEE+KPIG I+TQAT+E+Y+ +  +FLPTP KIHYLFNLRDISK
Sbjct: 1491 IKASRFVKAFEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFLADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTHHPGLLEKLSEMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGNKSEASGMFSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKMPGKRGKWVRDWPGQMLITASQIQWTTDVTRALMTSKERADKSALKSLKKKQVSMLNQYSEAIRGNLTKILRLKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLN-NFSFEGRQINLIWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRARPDIVDEEILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNGEPGFNLIRECPLNPKAVSLGELYGEYNLSTNEWTDGVLSSLMRMACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSWMEKR-QKVETDLLWQLFERYIDKTLAFKKTHCKELVAITELNGVASLCRLYQSLATAENGVKPADSENYGRMVELWFIFSLIWSVCASVDEEGRKKIDTFLREIEGSFPNKDTIYEYYVDTKNKTWASFEDKLPKGWRYASNAPFYKIMVPTVDTVRYHYLVKALVSTQHPVLLTGPVGTGKTSVAQSVLQSLDNITWATLTVNMSSQTSSNNVQEIIESRVEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDYGFWYDRQKQTLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIYGTMISQKLQEFEEEVKPIGGILTQATLELYHAITSRFLPTPAKIHYLFNLRDISK 2698          

HSP 2 Score: 1758.04 bits (4552), Expect = 0.000e+0
Identity = 845/1224 (69.04%), Postives = 1014/1224 (82.84%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +LR +KD+HDTK SITRLWIHE FRVF+DR+V   D   FV +LSEKL S FD  FH ICPNKQ P+FGD++  +  YED+ D + LK  M+  L++YN TPGVV M LVLFRDAI+H+++++RVI Q RGNMLLVGIGGSGRQSLTRLAAY+C +T FQ+EV+K YRKQEFR+D+K+LY   GV+NKPT+FLFNDTQ+VDESFLEDINNILSSGE+PNLYK DE+D++++ LSD A++D I +T  ++F YLI+RVR N+H+VLCMSPVG+PFRNRIR +PA VNCTTIDWFSEWP DALLEVAER L  L L   G +D ++  +A+IF  +H+SV+  S RM  E+KRHNYVTPTNYLELVSGYK LL EKR +L +  +KL+NGL KID+TR KVE MS+ELEEA+KK+A FQK+C++YLVVIVQQKREAD+Q K+V    E+I+ +E KC  M E A  DL +A+PALE AM+ALESLNKKD+TEIKSYG+PPALV+ VM+AVMILRG EPTWAEAK+ LGE +FIKQL+NFDKDNISDR LK IG Y  Q DFQP+++G+VSLAAKSLCMWV AMEVYGR++RVVEPKR RL  A + L EKQA LA AQ KL  V E++  L+++Y+EK+ QKEELR+K+E  E  LDRA KLVSGLAGE+ RW++TV  LE  +  L GDCL+A+AFLSYMGPFLS++R+ LV   W + +++ ++P +P FSF  FLS PT +R+WNIQGLP D FS ENGVIVTRG+RWPLMVDPQ QA KWIK ME K+ LKVIDL MPDF+R+LE A+QFG PVLLQNVQE+LDPSL PILNKS+ ++GG  ++KLGDKEIEY+ +FRFY+TTKL NPHYTPEIS+KT IVNFAVKEQGLEAQLLGIVVRKERPELEEQKD+LV++IA+GKRKL ELEDEILRLLNEA GSLLDD QLVNTLQTSK+T+TEV EQL+I+E TE+ ID AR+ Y  CAQRASILFFVLNDLG IDPMYQF+LDAYI+LF +SI  S +S K +ERI+NLN +HTYAVY Y CRGLFE HKLLFSF +CAKIL+ SGK+NMDEYNFFL+GG+VLD + QMDNPC  WLSD  WDNI+ELDKL NFH L+ SFEQYPRDW+ WYT+  PE + LPGEW+N+ NE Q+MLIVRSLR DRVS C T+F+INNLG++FVEPP+LDMK VV DS+ +T LIFVLSPG
Sbjct: 2701 QGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFLRESQIYEDLLDFKALKVHMENQLEDYNLTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARKDNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLSL---GSDDGIQTKVASIFVTVHQSVAQFSHRMKVELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAVGAHSEKIEAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITELDKLTNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPG 3921          

HSP 3 Score: 1264.21 bits (3270), Expect = 0.000e+0
Identity = 631/1430 (44.13%), Postives = 931/1430 (65.10%), Query Frame = 3
Query:  276 EKSVIDLIRQRIRLSGYVEIENWTADHALQVQDEFVT-SNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNL------QMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKL-KKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLS 4541
            +K + +  +QR+ LSG +  E+WT ++  Q  D+F++ S+  LLV Y     GL +D   P   V ++ YFI+       +I  E+F   +Q G+V G  I+ LLR+M G++ P    +T WP++ KN++S +L RF++ LTD+R+KL G TVLYIP EA  +  E   K K+ + R+EM++IHWTRQIK VLSAQ+  +  ++ GPL+EI +WK+RC DL  IS QL K GV+HI +IL+   S+Y+  F KLA +I+ ++ QAQSN+ FL+ LK+ C +L+  KP +I   L+ ++N IR+IWVNS ++N+RD +T + RK+SNEII+ CC  + L+ IF G  VSS + L +CI CC  +K++Y     +H  +SS+ W+LD+ +IFA +D+F+QRCKDLIEICECQ  FAR+EDG +  +P F G  G+EV   +L IE  F+ +++ L+  +  ILDV+  SWH+DY+RFR+ +KDLEVM QN IT+ FE V  +++G+++LDVF HL  RE I+RT D+    + N    E  LV+  L +  +  L    +P+YAG   W + L  R+ER M  L +A FLP   S  +    Y +L   L+E VR+   ++   L ++   SLD  L+ R     G+LDINF++ LLKLF E+HYW+RLQF++PH+  ++Y RR EL   RE+VLLVVRDYNRI++ LNA+E  LF E+I+ LDKKIQPGL K+ WS+KG    F+NDCR++A ++Q  VDEYK AN    K+CE IS +L++ +D   +Y + EF + Q+ H+     +L   H +II  M   Y  F  D  ++QQ+W  YM K+D+  EEAFR+N+K SL EL+KAINGDG+  P+PLF+V + L          + F P+  +L +IV S+    I+ +    R+ ++L + +  +K I   I  D+EI KIQ  I  GM   +S +Q  L  WD+ REIWE+ K+ FI +Y  LNP V S DADI+RYTEV N     E +++V+F+ LD S LK S+  HC +WQ K T LL  MA+  L  LH++++  + ++S+ PQ L +LGES++LL+ L  + N I+ +  P+ E + IL KYEV     +    + L  EW  F Q +++++ M+KK KD  K+GL++ S++F+K+    +  F +NGPF +S+ P  AL +++  ++ LE+LK +EQ I  GLN+F IEQP SK+I ALEKD+D ++ +W++A +WE  W +WK G    L+T  M+N A + F+   K SR  KDK+WEI++ +++R++QF++ +PLITDLRN A+R+RHW QI+ E+++ FD  S+DFTLEKI+ L  D HAE I+++SGAA+KEL+IE  L+G+ K W+ + L+I PHKD  K H  L G D+++Q L+DN+ TLS
Sbjct:   70 KKRLREAFKQRLALSG-ISKESWTEENE-QALDKFISDSSVRLLVVYHDPFTGLYVDYAMPAQVVEQMSYFIRAPD---SMITEESFRSSVQFGSVRGGAIEGLLRMMNGVHTPQVTLSTTWPETSKNNYSAELHRFLTKLTDSRFKLLGSTVLYIPLEALQHRPEEAVKNKNLVQRLEMVVIHWTRQIKAVLSAQSVSDIGDTLGPLEEISFWKSRCADLDSISTQLQKPGVRHIQEILQLYTSTYIPPFCKLAKQIQESSLQAQSNVTFLSLLKEPCEELAQLKPCEIAPKLAHILNLIRVIWVNSSYFNTRDRITALLRKISNEIIRLCCREISLNRIFQGYAVSSKQILNDCIQCCLAWKELYLHTSQLHHKHSSQGWSLDQISIFALVDSFMQRCKDLIEICECQQQFARWEDGERVPLPCFAGRLGSEVTQKLLYIEATFDKSLQVLQSVQD-ILDVRNPSWHEDYSRFRAKLKDLEVMMQNLITSTFEMVNCVEEGVQLLDVFQHLSGREAIKRTIDRKTVDVYNLFHSE--LVEINLVMCRTSSLIPVQMPRYAGQIHWTKALHSRVERSMEVLRRAHFLPHVRSADEMHVIYVKLCQTLDEKVRRIFTDWSQSLSKECHSSLDQPLMIRCKGKTGLLDINFNKNLLKLFNEIHYWDRLQFEIPHFVTEVYQRREELHNLRENVLLVVRDYNRIIKDLNADELGLFSERIRFLDKKIQPGLSKLHWSTKGTPSAFINDCRVHANKVQLMVDEYKAANLATSKHCEQISELLLVHLDGKTVYRDHEFQEDQQTHQHSQMLRLQNAHQDIIKIMARVYGTFHLDGPEVQQHWTSYMEKIDQMLEEAFRVNIKRSLQELSKAINGDGKISPNPLFRVEVVLTPETARSTAQVDFSPSPQKLAHIVNSISSQLIKTISGFKRLPDLLTRQQSQRKPIHSIIEQDEEICKIQGAIAAGMVTNASYLQTYLKTWDKHREIWEIEKDSFIQRYQRLNPTVTSFDADIARYTEVANNVQKEETLLSVQFVLLDCSPLKFSLLQHCNEWQSKFTQLLSLMASSKLKELHSFLQENAVRLSQPPQTLTDLGESLKLLETLQADLNKIESQIPPIHEQYAILTKYEVAVDPAVLELLEALNAEWVWFQQVVIDSDIMLKKHKDTMKSGLILSSEEFQKKTQTFLQSFSSNGPFGSSVTPHSALQQVSELRAQLEALKEEEQNICSGLNIFTIEQPASKDILALEKDVDYLQQVWEIARQWEDLWAEWKGGHLASLQTEVMDNTAQTMFKTLHKLSRAFKDKHWEIVDSSKSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIVALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKD--KGHHKLRGTDEVFQALEDNQVTLS 1489          
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1783.85 bits (4619), Expect = 0.000e+0
Identity = 841/1210 (69.50%), Postives = 1004/1210 (82.98%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKL-MSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            +K SRFVK FE EVD WER LS + E +EM+LTVQRQW+YLENIFL +DIRKQL +E+A+FD +   W++IM  L++ +NA       GLLE  + MNT LE+IQKSLDMYLETKR IFPRFYF+SNDDLLEILGQS+NP+ V PHLKKCFDNI SL+I K+      EAS MFS+DGE V F   + LEGPVEAWLCD+E+ MR TL+D LR+C +ALKK   KR KW+++W GQ+ IT+SQIQWT DVT+AL    +R DK  L+ +KKKQ  +L ++SEAIR NLTKI RLKI +LV +EVH RD+I KL K GC D+NAF+WL QLR YWEK++DDC+I+QTNT F+YGYEYLGNSGRLVITPLTDRCY+TLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLG YVIVVNCSEGLD+KSMGRM+SGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSAL++     F F+GR I+L+ S GIFITMNPGYAGRTELPDNLKSMFRPI+MV PDS +IAEITLFAEGF+ CKVLAKKVFTLYSL++QQLSKQDHYDFGLRAL S+LRYAG+K+RA P + DEEILL+SM DMN+AKL+S+DLPLF GI+ DLFP +++P +DY  +KEA+E       LQ   FT+TKV+QLYETK SRHS MIVGKT SGK+ TWR LQ+ L+ L +  E  F    E PLNPK+VSLGELYGE++L+TNEWTDGVLSS+MR  CAD +PDEKWI+FDGPVDTLWIESMNSVMDDNK+LTLINGERISMPEQVSLLFEVE+LSVASPATVSRCGMVY+D +DLGW+PYV+SW++++   V  + L ++F++YI+K   F K +C EL+  +  N V SLC+L+  LAT ENG  P+D++NY R++ELWF F +IWS+C SVDE+GRKKID ++RE+EG+FPNKDTIYEY+VD KNK+W  +++KL  GW+Y ++ PFYKI+VPTVDTVRY+YLV+ LV   HPV+L GPVGTGKTSVA + L  L+N  W  LT+NMS+QTSSNNVQ+IIE+RVEKR K  +VPVGGK+M+ F+DD NMPA D FGSQPPLEL+R WIDYGFWYDR KQT K IKD++L  +MGPPGGGR  IS RLQSRFNLINMTFPTES +KRI+G+MI+QKLQ+FEEE+KPIG I+TQAT+E+Y+ +  +FLPTP KIHYLFNLRDISK
Sbjct: 1371 IKASRFVKAFEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFLADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTHHPGLLEKLSEMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGNKSEASGMFSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKMPGKRGKWVRDWPGQMLITASQIQWTTDVTRALMTSKERADKSALKSLKKKQVSMLNQYSEAIRGNLTKILRLKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLN-NFSFEGRQINLIWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRARPDIVDEEILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNGEPGFNLIRECPLNPKAVSLGELYGEYNLSTNEWTDGVLSSLMRMACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSWMEKR-QKVETDLLWQLFERYIDKTLAFKKTHCKELVAITELNGVASLCRLYQSLATAENGVKPADSENYGRMVELWFIFSLIWSVCASVDEEGRKKIDTFLREIEGSFPNKDTIYEYYVDTKNKTWASFEDKLPKGWRYASNAPFYKIMVPTVDTVRYHYLVKALVSTQHPVLLTGPVGTGKTSVAQSVLQSLDNITWATLTVNMSSQTSSNNVQEIIESRVEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDYGFWYDRQKQTLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIYGTMISQKLQEFEEEVKPIGGILTQATLELYHAITSRFLPTPAKIHYLFNLRDISK 2578          

HSP 2 Score: 1757.27 bits (4550), Expect = 0.000e+0
Identity = 845/1224 (69.04%), Postives = 1014/1224 (82.84%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +LR +KD+HDTK SITRLWIHE FRVF+DR+V   D   FV +LSEKL S FD  FH ICPNKQ P+FGD++  +  YED+ D + LK  M+  L++YN TPGVV M LVLFRDAI+H+++++RVI Q RGNMLLVGIGGSGRQSLTRLAAY+C +T FQ+EV+K YRKQEFR+D+K+LY   GV+NKPT+FLFNDTQ+VDESFLEDINNILSSGE+PNLYK DE+D++++ LSD A++D I +T  ++F YLI+RVR N+H+VLCMSPVG+PFRNRIR +PA VNCTTIDWFSEWP DALLEVAER L  L L   G +D ++  +A+IF  +H+SV+  S RM  E+KRHNYVTPTNYLELVSGYK LL EKR +L +  +KL+NGL KID+TR KVE MS+ELEEA+KK+A FQK+C++YLVVIVQQKREAD+Q K+V    E+I+ +E KC  M E A  DL +A+PALE AM+ALESLNKKD+TEIKSYG+PPALV+ VM+AVMILRG EPTWAEAK+ LGE +FIKQL+NFDKDNISDR LK IG Y  Q DFQP+++G+VSLAAKSLCMWV AMEVYGR++RVVEPKR RL  A + L EKQA LA AQ KL  V E++  L+++Y+EK+ QKEELR+K+E  E  LDRA KLVSGLAGE+ RW++TV  LE  +  L GDCL+A+AFLSYMGPFLS++R+ LV   W + +++ ++P +P FSF  FLS PT +R+WNIQGLP D FS ENGVIVTRG+RWPLMVDPQ QA KWIK ME K+ LKVIDL MPDF+R+LE A+QFG PVLLQNVQE+LDPSL PILNKS+ ++GG  ++KLGDKEIEY+ +FRFY+TTKL NPHYTPEIS+KT IVNFAVKEQGLEAQLLGIVVRKERPELEEQKD+LV++IA+GKRKL ELEDEILRLLNEA GSLLDD QLVNTLQTSK+T+TEV EQL+I+E TE+ ID AR+ Y  CAQRASILFFVLNDLG IDPMYQF+LDAYI+LF +SI  S +S K +ERI+NLN +HTYAVY Y CRGLFE HKLLFSF +CAKIL+ SGK+NMDEYNFFL+GG+VLD + QMDNPC  WLSD  WDNI+ELDKL NFH L+ SFEQYPRDW+ WYT+  PE + LPGEW+N+ NE Q+MLIVRSLR DRVS C T+F+INNLG++FVEPP+LDMK VV DS+ +T LIFVLSPG
Sbjct: 2581 QGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFLRESQIYEDLLDFKALKVHMENQLEDYNLTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARKDNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLSL---GSDDGIQTKVASIFVTVHQSVAQFSHRMKVELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAVGAHSEKIEAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITELDKLTNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPG 3801          

HSP 3 Score: 883.634 bits (2282), Expect = 0.000e+0
Identity = 453/1052 (43.06%), Postives = 665/1052 (63.21%), Query Frame = 3
Query: 1479 LIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSR-------ALLK-------------------LFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQ---MRDLV-FIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKL-KKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLS 4541
            L +ICECQ  FAR+EDG +  +P F G  G+EV   +L IE  F+ +++ L+  +  ILDV+  SWH+DY+RFR+ +KDLEVM QN IT+ FE V  +++G+++LDVF HL  RE I+RT D+    + N    E  LV+  L +  +  L    +P+YAG   W + L  R+ER M  L +A FLP   S  +    Y +L   L+E VR+   ++   L ++   SLD  L+ R     G+LDINF++        +L+                   LF E+HYW+RLQF++PH+  ++Y RR EL   RE+VLLVVRDYNRI++ LNA+E  LF E+I+ LDKKIQPGL K+ WS+KG    F+NDCR++A ++Q  VDEYK AN    K+CE IS +L++ +D   +Y + EF + Q+ H+     +L   H +II  M   Y  F  D  ++QQ+W  YM K+D+  EEAFR+N+K SL EL+KAINGDG+  P+PLF+V + L     R  V F P+  +L +IV S+    I+ +    R+ ++L + +  +K I   I  D+EI KIQ  I  GM   +S +Q  L  WD+ REIWE+ K+ FI +Y  LNP V S DADI+RYTEV N     E +++V+F+ LD S LK S+  HC +WQ K T LL  MA+  L  LH++++  + ++S+ PQ L +LGES++LL+ L  + N I+ +  P+ E + IL KYEV     + L  + L  EW  F Q +++++ M+KK KD  K+GL++ S++F+K+    +  F +NGPF +S+ P  AL +++  ++ LE+LK +EQ I  GLN+F IEQP SK+I ALEKD+D ++ +W++A +WE  W +WK G    L+T  M+N A + F+   K SR  KDK+WEI++ +++R++QF++ +PLITDLRN A+R+RHW QI+ E+++ FD  S+DFTLEKI+ L  D HAE I+++SGAA+KEL+IE  L+G+ K W+ + L+I PHKD  K H  L G D+++Q L+DN+ TLS
Sbjct:  324 LRKICECQQQFARWEDGERVPLPCFAGRLGSEVTQKLLYIEATFDKSLQVLQSVQD-ILDVRNPSWHEDYSRFRAKLKDLEVMMQNLITSTFEMVNCVEEGVQLLDVFQHLSGREAIKRTIDRKTVDVYNLFHSE--LVEINLVMCRTSSLIPVQMPRYAGQIHWTKALHSRVERSMEVLRRAHFLPHVRSADEMHVIYVKLCQTLDEKVRRIFTDWSQSLSKECHSSLDQPLMIRCKGKTGLLDINFNKYSCIHNTCILQNRLGFFNVTNQHTESECTTLFNEIHYWDRLQFEIPHFVTEVYQRREELHNLRENVLLVVRDYNRIIKDLNADELGLFSERIRFLDKKIQPGLSKLHWSTKGTPSAFINDCRVHANKVQLMVDEYKAANLATSKHCEQISELLLVHLDGKTVYRDHEFQEDQQTHQHSQMLRLQNAHQDIIKIMARVYGTFHLDGPEVQQHWTSYMEKIDQMLEEAFRVNIKRSLQELSKAINGDGKISPNPLFRVEVVLTPETARSTVDFSPSPQKLAHIVNSISSQLIKTISGFKRLPDLLTRQQSQRKPIHSIIEQDEEICKIQGAIAAGMVTNASYLQTYLKTWDKHREIWEIEKDSFIQRYQRLNPTVTSFDADIARYTEVANNVQKEETLLSVQFVLLDCSPLKFSLLQHCNEWQSKFTQLLSLMASSKLKELHSFLQENAVRLSQPPQTLTDLGESLKLLETLQADLNKIESQIPPIHEQYAILTKYEVAVDPVLELL-EALNAEWVWFQQVVIDSDIMLKKHKDTMKSGLILSSEEFQKKTQTFLQSFSSNGPFGSSVTPHSALQQVSELRAQLEALKEEEQNICSGLNIFTIEQPASKDILALEKDVDYLQQVWEIARQWEDLWAEWKGGHLASLQTEVMDNTAQTMFKTLHKLSRAFKDKHWEIVDSSKSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIVALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKD--KGHHKLRGTDEVFQALEDNQVTLS 1369          

HSP 4 Score: 276.559 bits (706), Expect = 2.735e-73
Identity = 139/316 (43.99%), Postives = 209/316 (66.14%), Query Frame = 3
Query:  300 RQRIRLSGYVEIENWTADHALQVQDEFVT-SNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKM 1244
            +QR+ LSG +  E+WT ++  Q  D+F++ S+  LLV Y     GL +D   P   V ++ YFI+       +I  E+F   +Q G+V G  I+ LLR+M G++ P    +T WP++ KN++S +L RF++ LTD+R+KL G TVLYIP EA  +  E   K K+ + R+EM++IHWTRQIK VLSAQ+  +  ++ GPL+EI +WK+RC DL  IS QL K GV+HI +IL+   S+Y+  F KLA +I+ ++ QAQSN+ FL+ LK+ C +L+  KP +I   L+ ++N IR+IWVNS ++N+RD +T + RK+
Sbjct:   17 KQRLALSG-ISKESWTEENE-QALDKFISDSSVRLLVVYHDPFTGLYVDYAMPAQVVEQMSYFIRAPD---SMITEESFRSSVQFGSVRGGAIEGLLRMMNGVHTPQVTLSTTWPETSKNNYSAELHRFLTKLTDSRFKLLGSTVLYIPLEALQHRPEEAVKNKNLVQRLEMVVIHWTRQIKAVLSAQSVSDIGDTLGPLEEISFWKSRCADLDSISTQLQKPGVRHIQEILQLYTSTYIPPFCKLAKQIQESSLQAQSNVTFLSLLKEPCEELAQLKPCEIAPKLAHILNLIRVIWVNSSYFNTRDRITALLRKI 327          
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Match: AL807739.1 (dynein, axonemal, heavy chain 6 [Source:NCBI gene;Acc:100148193])

HSP 1 Score: 1035.02 bits (2675), Expect = 0.000e+0
Identity = 542/1260 (43.02%), Postives = 773/1260 (61.35%), Query Frame = 1
Query: 4483 FFLE*MTSIKLLMTTEIL--YQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEAS-------------SMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASK-RDKWI-KEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQ--FEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWL---KRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPS---DTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM-----EGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDI-WTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            F L     I++L+   I+    + +SR+  P +  VDKW+R L    +T++  L  QR WLYLE+IF   DI++QLP E+  F +++K W+ IM ++N++ NA     + G+L+ F   N  LE IQK L+ YLE+KR IFPRFYF+SND+LLEIL Q++NP  V PHL+KCFD I+ L+   L     E               SM S +GE+V+  + L+  G VE WL  +E+ M  +LR L    + A+    SK R +W+      Q+ +T SQ+ W  D+   L+   + +  + L+  +      L   +  +R NL  + R  I +L+ I+VH RDI+  L K      + FEW  QLR+YW+ ++DDCV +   + + YGYEYLG   RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK MG  FSGLAQ+GAW CFDEFNRINIEVLSV+AQQ+++I +A A+    +FMF+GR I LV +   FITMNPGYAGRTELPDNLK++FRPIAM+ P+ A+IAE+ L++EGF   K LA+K+  +Y L  +QLS+QDHYDFG+RA+ SVL  AG  KR NP + ++ +L+ ++ D NL K    D  LF GI+SDLFPG+  P  DY  ++  I        LQP    I+KV+QLYET   RH VM+VG T SGK+T +R+L   L  L         F     + LNPKSVS+GELYGE +  T EW DG+++  +R    D   D KW+I DGPVD LWIE+MN+V+DDNK+L L N ERI +   + ++FEV++L+VASPATVSRCGMVY D  +L W PYV++WL     K+   +   L  +F++Y+EK   F   +C++ +     + V +LC L + L   +    PS   ++   + V+   F FC +W++  ++ E      D ++R+      +   P+   ++  +++   K    W E++   + YN+ +PF++++VPT DTVRY YL++ L+   H V+  G  G GK+ VA   LN +     +  + IN SAQTSS   Q+IIE+++EK+ K+       K+++ F+DD NMP  D++GSQPP+EL+RQ+ D+  +YDR K   K I DM +  A  PPGGGR  ++ R    F+++ +  P+ES+LK+IF +++   L +F   +K   D I  A +E+Y+ + +  LPTP K HY+FNLRD+SK
Sbjct: 1056 FILGGTDDIQVLLDDSIVNVATVASSRYAGPIKARVDKWQRQLLLFNQTLDEWLLCQRSWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRMPNALRAATQTGILDVFQNNNALLERIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAISQLEFATLTPTTPEGDDTVEKIQYTNDILSMVSPEGEKVVLGKGLKARGNVEDWLGKVEEAMFSSLRRL---SKAAIADYQSKPRVEWVVAGHPSQVVLTISQLMWCRDMDNCLE--GEHDHFQALQEFEITNFERLNALAALVRGNLPSLHRNIITALITIDVHARDIVTDLVKEQVDSSDNFEWQRQLRYYWDVDLDDCVARMALSQYIYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGTFFSGLAQSGAWCCFDEFNRINIEVLSVIAQQLITIRNAKAAKL-SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSKTLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPNLSEDVVLIRALRDSNLPKFLKDDAALFSGILSDLFPGVTIPEHDYGVLQSTIHSSLCQRSLQPLPSIISKVIQLYETMLVRHGVMLVGPTGSGKTTVYRVLADTLDTLHHAGHPNPFFRPVKTYVLNPKSVSMGELYGEVNPLTLEWRDGLMALCVRAAVQDFSDDHKWVISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPSIYMMFEVQDLAVASPATVSRCGMVYIDPEELKWMPYVQTWLTGFAEKISDPVRGYLMELFEQYVEKGLQFASKHCLQAVAQVDISKVTTLCCLLEALLFSDGA--PSLKMESSKLNNVLCQTFVFCYLWAVGGNLIESHWDTFDTFVRQQFEDNTDAKLPSVGDLWSVYMNFDIKCLEPW-ERIIPVFSYNSEIPFFEMLVPTTDTVRYGYLMEKLLSVNHSVLFTGITGVGKSVVARALLNSVQEKAGYVPVYINFSAQTSSARTQEIIESKLEKKRKNILGAPANKKIVVFVDDLNMPKLDSYGSQPPIELLRQFQDFHGFYDREKFFWKEIHDMTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSESSLKQIFKAILGGFLTEFSTAVKQAADSIVDAAVEIYHRMSVDLLPTPAKSHYVFNLRDLSK 2306          

HSP 2 Score: 974.541 bits (2518), Expect = 0.000e+0
Identity = 528/1254 (42.11%), Postives = 777/1254 (61.96%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMS-----STDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGI-EDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECD-DYLVVIVQQKREADDQAKSVMQTQERI-KVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISEL-DKLANFHGL---ITS-----------FEQYPRDWNLWYTSDSPETSSLP--------GEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q ML+        +  I RL+ HE  RVF DR++ ++DK  F  ++SE     F           Q  IFGD++      +   YED+TD++K+++ +++ LD+YN T    +  LV F+DAIEH+S+I R+IRQ RGN LLVG+GG+G+QSLTRLAA+MC Y  FQIE+S+ Y    F +DL++LY  AGV+ +  +FLF DTQ+V E FLEDINN+L+SGE+PNL+++DE+  +   +S +AK  GI E     +F + I RVR  +H+VLCMSPVG+ FR+R RMFP+ VNC TIDWF +WP +ALL V++ + ++++   G EE  MK   + +   +H SV+DM++R   E++RH Y TPT+YLEL++ Y  +L EKR+QL  + +++KNGL K+ ET   V+ M  +L      LA  QK  D   L+  +   +E  DQ + V++  E + KV   +   + + A  DL +A+PAL++A +AL +L+K DI+E++ + KPP LV  VMEAV IL   +  WA AK+ LG+ +F+K+L+++DKDNI  + L+K+  Y++  DF P+ V KVS A KS+CMWV AM++Y RV + V PKR++L AA+  L    + L   Q KL  V  ++K LQ+++   M +KE L K    TE  L R+ KL S L  E+ RW++++   E +I  + G+  IA+A ++Y G F S YR+ L+  W    +   IP + +FS I  L +P +IR WN +GLPRD  S ENG++V RG RWPLM+DPQ QA +WI+  E K  LKVI L    F+R LE AI+ G PVLL+ ++E LDP+L+PIL K     GG T+++LGD +I+Y+ +FRFY+TTK+ NPHY PE+  K  I+NF V + GLE Q+L  VVR ERP+LEEQ+  L++ I A + +L  +ED IL+LL  ++G++LD+E+LV TLQ SK+TS  +  +L  AE TE  I+ AR+ Y   A R SI++FV+  L +IDPMYQF+L  +  LFN +I  + K      R+  L D    + Y    RGLFE+HK ++SF +C +I+   G+++  E+ +FL+G   + R+   + P   WLSD AW+    L D+L  F+G+   I S               P  W+ + T   P +  +P        G W+     FQ++++++S   ++V    T F+I  LG +FVE P +D+  +  D S    L+F+LS G
Sbjct: 2309 QGMLQCEPTTVRDQTHIFRLFCHECQRVFHDRLINNEDKSYFNTMISEMASKYFSINIEPAYFVNQPIIFGDFIKVGADKADRVYEDLTDMDKIRQVLQDYLDDYNTT-FAKETKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHMCGYRCFQIELSRGYNYDSFHEDLRKLYRMAGVEGQDMVFLFTDTQIVVEEFLEDINNMLNSGEVPNLFEKDELKQVLAAISPKAKEAGISEGNRDEVFQFFISRVREKLHIVLCMSPVGDSFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSQTFFQNVEF--GSEE--MKQCFSEMCVEIHVSVTDMAERFYSELRRHYYTTPTSYLELINLYLGMLGEKRQQLQAARDRIKNGLTKLLETNELVDKMKQDLSALEPVLA--QKSIDVSALMEKLAVDQENADQVRRVVKEDEALAKVKAEETQAIADDAQRDLDEALPALDSANKALNALDKADISEMRVFTKPPDLVMTVMEAVCILLSNKTDWASAKQLLGDGNFLKKLMDYDKDNIKPQILQKLHKYISNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVLKEVGPKREKLAAAQVELDATMSTLKEKQNKLQEVENQIKVLQEQFESSMAEKETLAKTMALTEARLGRSGKLTSALGDEQVRWQESITLFEQEIHNVIGNVFIAAACVAYYGAFTSHYRQLLIDHWITRCQSLGIPISDNFSLIGILGDPYEIRQWNAEGLPRDNVSTENGILVMRGRRWPLMIDPQDQANRWIRSKETKNGLKVIKLTDAGFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRTLIRLGDSDIDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQILSDVVRLERPDLEEQRSQLIVRINADRNQLKAIEDRILKLLFTSEGNILDNEELVQTLQESKVTSQAIKSRLVEAETTEEMINRAREKYRPVATRGSIMYFVIASLSEIDPMYQFSLKYFKQLFNNTIESAEKHKDLSLRLQILLDQTLLSAYTNVSRGLFEQHKAIYSFMLCVEIMMQRGEISQQEWLYFLRGAGGI-RKELPEKPEVPWLSDFAWETCCNLEDRLPCFNGIKKEIISTPISVKLGQLEVTVSPEHWDGYVTDLPPFSEEIPSEKQPQVRGHWNQQLGAFQKLILIKSFMEEKVVSAVTEFVITGLGQQFVENPPVDLTTLYADMSPSIPLVFILSTG 3554          

HSP 3 Score: 93.2041 bits (230), Expect = 8.674e-18
Identity = 56/199 (28.14%), Postives = 103/199 (51.76%), Query Frame = 3
Query: 3930 FKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            FK+E      +  L  ++   + +W    EWE+    W   +F EL    +    N   +  ++  + L   N  ++ + + +V+  R  +P+ITDLRN  ++ RHW  ++  +  +  EE+   TL  + +++  +    I EVSG A+ E ++EN L+ +E  W++ E  ++PH+D  K+ F+L G DD+   LDD+
Sbjct:  878 FKVEVTKYDTLEELTAEVKLKQLLWDSLEEWESLENGWLQDKFDELDPELLSKQVNRFVKYVSQLEKGLPPNN--VVPFLKAKVESMREKLPVITDLRNPCLKARHWEMLEAIVDSKLLEEAQ--TLATLQNIDIFRFGLQIQEVSGQASGEASLENILRKIEDSWKTTEFIVLPHRDT-KDVFILGGTDDIQVLLDDS 1071          
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Match: dnah6 (dynein, axonemal, heavy chain 6 [Source:ZFIN;Acc:ZDB-GENE-030616-623])

HSP 1 Score: 1032.32 bits (2668), Expect = 0.000e+0
Identity = 541/1260 (42.94%), Postives = 772/1260 (61.27%), Query Frame = 1
Query: 4483 FFLE*MTSIKLLMTTEIL--YQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEAS-------------SMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASK-RDKWI-KEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQ--FEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWL---KRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPS---DTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM-----EGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDI-WTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            F L     I++L+   I+    + +SR+  P +  VDKW+R L    +T++  L  QR WLYLE+IF   DI++QLP E+  F +++K W+ IM ++N++ NA     + G+L+ F   N  LE IQK L+ YLE+KR IFPRFYF+SND+LLEIL Q++NP  V PHL+KCFD I+ L+   L     E               SM S +GE+V+  + L+  G VE WL  +E+ M  +LR L    + A+    SK R +W+      Q+ +T SQ+ W  D+   L+   + +  + L+  +      L   +  +R NL  + R  I +L+ I+VH RDI+  L K      + FEW  QLR+YW+ ++DDCV +   + + YGYEYLG   RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK MG  FSGLAQ+GAW CFDEFNRINIEVLSV+AQQ+++I +A A+    +FMF+GR I LV +   FITMNPGYAGRTELPDNLK++FRPIAM+ P+ A+IAE+ L++EGF   K LA+K+  +Y L  +QLS+QDHYDFG+RA+ SVL  AG  KR NP + ++ +L+ ++ D NL K    D  LF GI+SDLFPG+  P  DY  ++  I        LQP    I+KV+QLYET   RH VM+VG T SGK+T +R+L   L  L         F     + LNPKSVS+GELYGE +  T EW DG+++  +R    D   D KW+I DGPVD LWIE+MN+V+DDNK+L L N ERI +   + ++FEV++L+VASPATVSRCGMVY D  +L W PYV++WL     K+   +   L  +F++Y+EK   F   +C++ +     + V +LC L + L   +    PS   ++   + V+   F FC +W++  ++ E      D ++R+      +    +   ++  +++   K    W E++   + YN+ +PF++++VPT DTVRY YL++ L+   H V+  G  G GK+ VA   LN +     +  + IN SAQTSS   Q+IIE+++EK+ K+       K+++ F+DD NMP  D++GSQPP+EL+RQ+ D+  +YDR K   K I DM +  A  PPGGGR  ++ R    F+++ +  P+ES+LK+IF +++   L +F   +K   D I  A +E+Y+ + +  LPTP K HY+FNLRD+SK
Sbjct: 1056 FILGGTDDIQVLLDDSIVNVATVASSRYAGPIKARVDKWQRQLLLFNQTLDEWLLCQRSWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRMPNALRAATQTGILDVFQNNNALLERIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAISQLEFATLTPTTPEGDDTVEKIQYTNDILSMVSPEGEKVVLGKGLKARGNVEDWLGKVEEAMFSSLRRL---SKAAIADYQSKPRVEWVVAGHPSQVVLTISQLMWCRDMDNCLE--GEHDHFQALQEFEITNFERLNALAALVRGNLPSLHRNIITALITIDVHARDIVTDLVKEQVDSSDNFEWQRQLRYYWDVDLDDCVARMALSQYIYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGTFFSGLAQSGAWCCFDEFNRINIEVLSVIAQQLITIRNAKAAKL-SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSKTLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPNLSEDVVLIRALRDSNLPKFLKDDAALFSGILSDLFPGVTIPEHDYGVLQSTIHSSLCQRSLQPLPSIISKVIQLYETMLVRHGVMLVGPTGSGKTTVYRVLADTLDTLHHAGHPNPFFRPVKTYVLNPKSVSMGELYGEVNPLTLEWRDGLMALCVRAAVQDFSDDHKWVISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPSIHMMFEVQDLAVASPATVSRCGMVYIDPEELKWMPYVQTWLTGFAEKISDPVRGYLMELFEQYVEKGLQFASKHCVQAVAQVDISKVTTLCCLLEALLFSDGA--PSLKMESSKLNNVLCQTFVFCYLWAVGGNLIESHWDTFDTFVRQQFEDNTDAKLSSVGDLWSVYMNFDIKCLEPW-ERIIPVFSYNSEIPFFEMLVPTTDTVRYGYLMEKLLSVNHSVLFTGITGVGKSVVARALLNSVQEKAGYVPVYINFSAQTSSARTQEIIESKLEKKRKNILGAPANKKIVVFVDDLNMPKLDSYGSQPPIELLRQFQDFHGFYDREKFFWKEIHDMTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSESSLKQIFKAILGGFLTEFSTAVKQAADSIVDAAVEIYHRMSVDLLPTPAKSHYVFNLRDLSK 2306          

HSP 2 Score: 973.385 bits (2515), Expect = 0.000e+0
Identity = 527/1254 (42.03%), Postives = 777/1254 (61.96%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMS-----STDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGI-EDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECD-DYLVVIVQQKREADDQAKSVMQTQERI-KVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISEL-DKLANFHGL---ITS-----------FEQYPRDWNLWYTSDSPETSSLP--------GEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q ML+        +  I RL+ HE  RVF DR++ ++DK  F  ++SE     F           Q  IFGD++      +   YED+TD++K+++ +++ LD+YN T    +  LV F+DAIEH+S+I R+IRQ RGN LLVG+GG+G+QSLTRLAA+MC Y  FQIE+S+ Y    F +DL++LY  AGV+ +  +FLF DTQ+V E FLEDINN+L+SGE+PNL+++DE+  +   +S +AK  GI E     ++ + I RVR  +H+VLCMSPVG+ FR+R RMFP+ VNC TIDWF +WP +ALL V++ + ++++   G EE  MK   + +   +H SV+DM++R   E++RH Y TPT+YLEL++ Y  +L EKR+QL  + +++KNGL K+ ET   V+ M  +L      LA  QK  D   L+  +   +E  DQ + V++  E + KV   +   + + A  DL +A+PAL++A +AL +L+K DI+E++ + KPP LV  VMEAV IL   +  WA AK+ LG+ +F+K+L+++DKDNI  + L+K+  Y++  DF P+ V KVS A KS+CMWV AM++Y RV + V PKR++L AA+  L    + L   Q KL  V  ++K LQ ++   M +KE L K    TE  L R+ KL S L  E+ RW++++   E +I  + G+  IA+A ++Y G F S YR+ L+  W    +   IP + +FS I  L +P +IR WN +GLPRD  S ENG++V RG RWPLM+DPQ QA +WI+  E K  LKVI L    F+R LE AI+ G PVLL+ ++E LDP+L+PIL K     GG T+++LGD +I+Y+ +FRFY+TTK+ NPHY PE+  K  I+NF V + GLE Q+L  VVR ERP+LEEQ+  L++ I A + +L  +ED IL+LL  ++G++LD+E+LV TLQ SK+TS  +  +L  AE TE  I+ AR+ Y   A R SI++FV+  L +IDPMYQF+L  +  LFN +I  + K      R+  L D    + Y    RGLFE+HK ++SF +C +I+   G+++  E+ +FL+G   + R+   + P   WLSD AW+    L D+L  F+G+   I S               P  W+ + T   P +  +P        G W+     FQ++++++S   ++V    T F+I  LG +FVE P++D+  +  D S    L+F+LS G
Sbjct: 2309 QGMLQCEPTTVRDQTHIFRLFCHECQRVFHDRLINNEDKSYFNTMISEMASKYFSINIEPAYFVNQPIIFGDFIKVGADKADRVYEDLTDMDKIRQVLQDYLDDYNTT-FAKETKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHMCGYRCFQIELSRGYNYDSFHEDLRKLYRMAGVEGQDMVFLFTDTQIVVEEFLEDINNMLNSGEVPNLFEKDELKQVLAAISPKAKEAGISEGNRDEVYQFFITRVREKLHIVLCMSPVGDSFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSQTFFQNVEF--GSEE--MKQCFSEMCVEIHVSVTDMAERFYSELRRHYYTTPTSYLELINLYLGMLGEKRQQLQAARDRIKNGLTKLLETNELVDKMKQDLSALEPVLA--QKSIDVSALMEKLAVDQENADQVRRVVKEDEALAKVKAEETQAIADDAQRDLDEALPALDSANKALNALDKADISEMRVFTKPPDLVMTVMEAVCILLSNKTDWASAKQLLGDGNFLKKLMDYDKDNIKPQILQKLHKYISNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVLKEVGPKREKLAAAQVELDATMSTLKEKQNKLQEVENQIKVLQDQFESSMAEKETLAKTMALTEARLGRSGKLTSALGDEQVRWQESITLFEQEIHNVIGNVFIAAACVAYYGAFTSHYRQLLIDHWITRCQSLGIPISDNFSLIGILGDPYEIRQWNAEGLPRDNVSTENGILVMRGRRWPLMIDPQDQANRWIRSKETKNGLKVIKLTDAGFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRTLIRLGDSDIDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQILSDVVRLERPDLEEQRSQLIVRINADRNQLKAIEDRILKLLFTSEGNILDNEELVQTLQESKVTSQAIKSRLVEAETTEEMINRAREKYRPVATRGSIMYFVIASLSEIDPMYQFSLKYFKQLFNNTIESAEKHKDLSLRLQILLDQTLLSAYTNVSRGLFEQHKAIYSFMLCVEIMMQRGEISQQEWLYFLRGAGGI-RKELPEKPEVPWLSDFAWETCCNLEDRLPCFNGIKKEIISTPISVKLGQLEVTVNPEHWDGYVTDLPPFSEEIPSEKQPQVRGHWNQQLGAFQKLILIKSFMEEKVVSAVTEFVITGLGQQFVENPLVDLATLYADMSPSIPLVFILSTG 3554          

HSP 3 Score: 93.2041 bits (230), Expect = 8.821e-18
Identity = 56/199 (28.14%), Postives = 103/199 (51.76%), Query Frame = 3
Query: 3930 FKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            FK+E      +  L  ++   + +W    EWE+    W   +F EL    +    N   +  ++  + L   N  ++ + + +V+  R  +P+ITDLRN  ++ RHW  ++  +  +  EE+   TL  + +++  +    I EVSG A+ E ++EN L+ +E  W++ E  ++PH+D  K+ F+L G DD+   LDD+
Sbjct:  878 FKVEVTKYDTLEELTAEVKLKQLLWDSLEEWESLENGWLQDKFDELDPELLSKQVNRFVKYVSQLEKGLPPNN--VVPFLKAKVESMREKLPVITDLRNPCLKARHWEMLEAIVDSKLLEEAQ--TLATLQNIDIFRFGLQIQEVSGQASGEASLENILRKIEDSWKTTEFIVLPHRDT-KDVFILGGTDDIQVLLDDS 1071          
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Match: dnah6 (dynein, axonemal, heavy chain 6 [Source:ZFIN;Acc:ZDB-GENE-030616-623])

HSP 1 Score: 1023.85 bits (2646), Expect = 0.000e+0
Identity = 541/1272 (42.53%), Postives = 772/1272 (60.69%), Query Frame = 1
Query: 4483 FFLE*MTSIKLLMTTEIL--YQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEAS-------------SMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASK-RDKWI-KEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLT------------DRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQ--FEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWL---KRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPS---DTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM-----EGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDI-WTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            F L     I++L+   I+    + +SR+  P +  VDKW+R L    +T++  L  QR WLYLE+IF   DI++QLP E+  F +++K W+ IM ++N++ NA     + G+L+ F   N  LE IQK L+ YLE+KR IFPRFYF+SND+LLEIL Q++NP  V PHL+KCFD I+ L+   L     E               SM S +GE+V+  + L+  G VE WL  +E+ M  +LR L    + A+    SK R +W+      Q+ +T SQ+ W  D+   L+   + +  + L+  +      L   +  +R NL  + R  I +L+ I+VH RDI+  L K      + FEW  QLR+YW+ ++DDCV +   + + YGYEYLG   RLVITPLT            DRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK MG  FSGLAQ+GAW CFDEFNRINIEVLSV+AQQ+++I +A A+    +FMF+GR I LV +   FITMNPGYAGRTELPDNLK++FRPIAM+ P+ A+IAE+ L++EGF   K LA+K+  +Y L  +QLS+QDHYDFG+RA+ SVL  AG  KR NP + ++ +L+ ++ D NL K    D  LF GI+SDLFPG+  P  DY  ++  I        LQP    I+KV+QLYET   RH VM+VG T SGK+T +R+L   L  L         F     + LNPKSVS+GELYGE +  T EW DG+++  +R    D   D KW+I DGPVD LWIE+MN+V+DDNK+L L N ERI +   + ++FEV++L+VASPATVSRCGMVY D  +L W PYV++WL     K+   +   L  +F++Y+EK   F   +C++ +     + V +LC L + L   +    PS   ++   + V+   F FC +W++  ++ E      D ++R+      +    +   ++  +++   K    W E++   + YN+ +PF++++VPT DTVRY YL++ L+   H V+  G  G GK+ VA   LN +     +  + IN SAQTSS   Q+IIE+++EK+ K+       K+++ F+DD NMP  D++GSQPP+EL+RQ+ D+  +YDR K   K I DM +  A  PPGGGR  ++ R    F+++ +  P+ES+LK+IF +++   L +F   +K   D I  A +E+Y+ + +  LPTP K HY+FNLRD+SK
Sbjct: 1056 FILGGTDDIQVLLDDSIVNVATVASSRYAGPIKARVDKWQRQLLLFNQTLDEWLLCQRSWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRMPNALRAATQTGILDVFQNNNALLERIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAISQLEFATLTPTTPEGDDTVEKIQYTNDILSMVSPEGEKVVLGKGLKARGNVEDWLGKVEEAMFSSLRRL---SKAAIADYQSKPRVEWVVAGHPSQVVLTISQLMWCRDMDNCLE--GEHDHFQALQEFEITNFERLNALAALVRGNLPSLHRNIITALITIDVHARDIVTDLVKEQVDSSDNFEWQRQLRYYWDVDLDDCVARMALSQYIYGYEYLGACPRLVITPLTVHIHLNFFFLMMDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGTFFSGLAQSGAWCCFDEFNRINIEVLSVIAQQLITIRNAKAAKLS-RFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSKTLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPNLSEDVVLIRALRDSNLPKFLKDDAALFSGILSDLFPGVTIPEHDYGVLQSTIHSSLCQRSLQPLPSIISKVIQLYETMLVRHGVMLVGPTGSGKTTVYRVLADTLDTLHHAGHPNPFFRPVKTYVLNPKSVSMGELYGEVNPLTLEWRDGLMALCVRAAVQDFSDDHKWVISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPSIHMMFEVQDLAVASPATVSRCGMVYIDPEELKWMPYVQTWLTGFAEKISDPVRGYLMELFEQYVEKGLQFASKHCVQAVAQVDISKVTTLCCLLEALLFSDGA--PSLKMESSKLNNVLCQTFVFCYLWAVGGNLIESHWDTFDTFVRQQFEDNTDAKLSSVGDLWSVYMNFDIKCLEPW-ERIIPVFSYNSEIPFFEMLVPTTDTVRYGYLMEKLLSVNHSVLFTGITGVGKSVVARALLNSVQEKAGYVPVYINFSAQTSSARTQEIIESKLEKKRKNILGAPANKKIVVFVDDLNMPKLDSYGSQPPIELLRQFQDFHGFYDREKFFWKEIHDMTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSESSLKQIFKAILGGFLTEFSTAVKQAADSIVDAAVEIYHRMSVDLLPTPAKSHYVFNLRDLSK 2318          

HSP 2 Score: 970.304 bits (2507), Expect = 0.000e+0
Identity = 528/1254 (42.11%), Postives = 779/1254 (62.12%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMS-----STDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGI-EDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECD-DYLVVIVQQKREADDQAKSVMQTQERI-KVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISEL-DKLANFHGL---ITS-----------FEQYPRDWNLWYTSDSPETSSLP--------GEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q ML+        +  I RL+ HE  RVF DR++ ++DK  F  ++SE     +   F N     Q  IFGD++      +   YED+TD++K+++ +++ LD+YN T    +  LV F+DAIEH+S+I R+IRQ RGN LLVG+GG+G+QSLTRLAA+MC Y  FQIE+S+ Y    F +DL++LY  AGV+ +  +FLF DTQ+V E FLEDINN+L+SGE+PNL+++DE+  +   +S +AK  GI E     ++ + I RVR  +H+VLCMSPVG+ FR+R RMFP+ VNC TIDWF +WP +ALL V++ + ++++   G EE  MK   + +   +H SV+DM++R   E++RH Y TPT+YLEL++ Y  +L EKR+QL  + +++KNGL K+ ET   V+ M  +L      LA  QK  D   L+  +   +E  DQ + V++  E + KV   +   + + A  DL +A+PAL++A +AL +L+K DI+E++ + KPP LV  VMEAV IL   +  WA AK+ LG+ +F+K+L+++DKDNI  + L+K+  Y++  DF P+ V KVS A KS+CMWV AM++Y RV + V PKR++L AA+  L    + L   Q KL  V  ++K LQ ++   M +KE L K    TE  L R+ KL S L  E+ RW++++   E +I  + G+  IA+A ++Y G F S YR+ L+  W    +   IP + +FS I  L +P +IR WN +GLPRD  S ENG++V RG RWPLM+DPQ QA +WI+  E K  LKVI L    F+R LE AI+ G PVLL+ ++E LDP+L+PIL K     GG T+++LGD +I+Y+ +FRFY+TTK+ NPHY PE+  K  I+NF V + GLE Q+L  VVR ERP+LEEQ+  L++ I A + +L  +ED IL+LL  ++G++LD+E+LV TLQ SK+TS  +  +L  AE TE  I+ AR+ Y   A R SI++FV+  L +IDPMYQF+L  +  LFN +I  + K      R+  L D    + Y    RGLFE+HK ++SF +C +I+   G+++  E+ +FL+G   + R+   + P   WLSD AW+    L D+L  F+G+   I S               P  W+ + T   P +  +P        G W+     FQ++++++S   ++V    T F+I  LG +FVE P++D+  +  D S    L+F+LS G
Sbjct: 2321 QGMLQCEPTTVRDQTHIFRLFCHECQRVFHDRLINNEDKSYFNTMISEMAKPAY---FVN-----QPIIFGDFIKVGADKADRVYEDLTDMDKIRQVLQDYLDDYNTT-FAKETKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHMCGYRCFQIELSRGYNYDSFHEDLRKLYRMAGVEGQDMVFLFTDTQIVVEEFLEDINNMLNSGEVPNLFEKDELKQVLAAISPKAKEAGISEGNRDEVYQFFITRVREKLHIVLCMSPVGDSFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSQTFFQNVEF--GSEE--MKQCFSEMCVEIHVSVTDMAERFYSELRRHYYTTPTSYLELINLYLGMLGEKRQQLQAARDRIKNGLTKLLETNELVDKMKQDLSALEPVLA--QKSIDVSALMEKLAVDQENADQVRRVVKEDEALAKVKAEETQAIADDAQRDLDEALPALDSANKALNALDKADISEMRVFTKPPDLVMTVMEAVCILLSNKTDWASAKQLLGDGNFLKKLMDYDKDNIKPQILQKLHKYISNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVLKEVGPKREKLAAAQVELDATMSTLKEKQNKLQEVENQIKVLQDQFESSMAEKETLAKTMALTEARLGRSGKLTSALGDEQVRWQESITLFEQEIHNVIGNVFIAAACVAYYGAFTSHYRQLLIDHWITRCQSLGIPISDNFSLIGILGDPYEIRQWNAEGLPRDNVSTENGILVMRGRRWPLMIDPQDQANRWIRSKETKNGLKVIKLTDAGFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRTLIRLGDSDIDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQILSDVVRLERPDLEEQRSQLIVRINADRNQLKAIEDRILKLLFTSEGNILDNEELVQTLQESKVTSQAIKSRLVEAETTEEMINRAREKYRPVATRGSIMYFVIASLSEIDPMYQFSLKYFKQLFNNTIESAEKHKDLSLRLQILLDQTLLSAYTNVSRGLFEQHKAIYSFMLCVEIMMQRGEISQQEWLYFLRGAGGI-RKELPEKPEVPWLSDFAWETCCNLEDRLPCFNGIKKEIISTPISVKLGQLEVTVNPEHWDGYVTDLPPFSEEIPSEKQPQVRGHWNQQLGAFQKLILIKSFMEEKVVSAVTEFVITGLGQQFVENPLVDLATLYADMSPSIPLVFILSTG 3558          

HSP 3 Score: 93.2041 bits (230), Expect = 8.556e-18
Identity = 56/199 (28.14%), Postives = 103/199 (51.76%), Query Frame = 3
Query: 3930 FKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            FK+E      +  L  ++   + +W    EWE+    W   +F EL    +    N   +  ++  + L   N  ++ + + +V+  R  +P+ITDLRN  ++ RHW  ++  +  +  EE+   TL  + +++  +    I EVSG A+ E ++EN L+ +E  W++ E  ++PH+D  K+ F+L G DD+   LDD+
Sbjct:  878 FKVEVTKYDTLEELTAEVKLKQLLWDSLEEWESLENGWLQDKFDELDPELLSKQVNRFVKYVSQLEKGLPPNN--VVPFLKAKVESMREKLPVITDLRNPCLKARHWEMLEAIVDSKLLEEAQ--TLATLQNIDIFRFGLQIQEVSGQASGEASLENILRKIEDSWKTTEFIVLPHRDT-KDVFILGGTDDIQVLLDDS 1071          
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Match: DNAH2 (dynein, axonemal, heavy chain 2 [Source:NCBI gene;Acc:100170584])

HSP 1 Score: 1733 bits (4487), Expect = 0.000e+0
Identity = 822/1213 (67.77%), Postives = 986/1213 (81.29%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKL-MSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  MK S FVK FE +VD+WER LSHI E +EM+LTVQRQWLYLENIF GEDIRKQLP+ESA+FD IN  W+VIM  L +  NA       GLLE    MN  LE IQKSLDMYLETKR+IFPRFYFISNDDLLEILGQS+NPD V PHLKKCFDNI SLKI+K  +   +EA+ MFS++GE V F   + LEGPVEAWLCD+E+ MR TL++LLR+CR+ALKK +SKRDKW+KEW+GQ+ ITSSQIQWTADVTK+L    +R +KK L+IMKKKQ  +L K+S+AIR NLTK  RLK+ +LV +EVH RD+I+K+ KSGC D+ +FEWLSQLR YW+K++DDC+I+QTNT FQYGYEYLGNSGRLVITPLTDRCY+TLTTALHLHRGGSPKGPAGTGKTETVKDLGK+LG YVIVVNCSEGLDYKSMGRM+SGLAQTGAWGCFDEFNRINIEVLSVVAQQILSIL+AL++N   +F+F+GR I+LV S GIFITMNPGYAGRTELPDNLKSMFRPI+MV PDS +IAEI LF EGF+ CKVLAKKV+TLYSL++QQLSKQDHYDFGLRAL S+LRY+GRK+R  P + DEE+L+++M DMN+AKLTSVDLPLF GI+ DLFPGI++P +DY  ++E IE+      LQ T FT++KV+QLYETKTSRHS M+VG+T SGK+T WR LQ AL+ L+K  +  + +  +FPLNPK++SLGELYGE+DL TNEWTDG+LSS+MR  CAD RP+EKWI+FDGPVDTLWIESMNSVMDDNK+LTLINGERI+MPEQVSLLFEV +L+VASPATVSRCGMVY D   LGWRPYV+SWL++                                 + +P+                    DP   ++Y R+ ELWF FC++WS+C SVDE+GR+KIDNY+REMEG+FP+KDT+YEY+VD K K+W  +++KL  GW+   + PFYKI+VPTVDTVRY ++V  LV +  PV+LVGPVGTGKTS+A + L  L++  W +LT+NMSAQT++NNVQDIIE+RVEKRTK  +VP GGKR++TF+DD NMPAKDTFGSQPPLEL+R WIDYGFWYDR  Q+ K IKDM++  AMGPPGGGR  IS+RLQSRFNLINMTFP+ES ++RIFG+M++QKLQDF+EE+KP+GD+ITQAT+E+YN +  +FLPTP KIHYLFNLRDISK
Sbjct: 1373 LSTMKASPFVKAFEQDVDRWERCLSHILEVIEMILTVQRQWLYLENIFTGEDIRKQLPQESAEFDDINVSWKVIMGRLTKDNNALRGTHHPGLLEKLGEMNGVLEGIQKSLDMYLETKRHIFPRFYFISNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLKIQKAGIGSKYEAAGMFSAEGEYVDFTHPVLLEGPVEAWLCDIERTMRWTLKELLRNCRLALKKMSSKRDKWVKEWAGQMLITSSQIQWTADVTKSLMAAKERGEKKILKIMKKKQVSMLNKYSDAIRGNLTKNLRLKLVALVTVEVHARDVIDKMLKSGCMDVASFEWLSQLRLYWDKDVDDCLIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGMYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILTALSANLT-RFVFEGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEIILFGEGFNNCKVLAKKVYTLYSLAVQQLSKQDHYDFGLRALTSLLRYSGRKRRLQPNLSDEEVLIMAMKDMNVAKLTSVDLPLFSGIMQDLFPGIETPTVDYGKLREQIEQELKLSGLQVTPFTVSKVIQLYETKTSRHSTMLVGRTCSGKTTIWRCLQGALSALNKAGDGNYNQVRDFPLNPKALSLGELYGEYDLTTNEWTDGILSSLMRTACADDRPEEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVSDLAVASPATVSRCGMVYTDHTSLGWRPYVQSWLEKHP-------------------------------KVNPS--------------------DP---ESYLRMAELWFLFCLVWSVCASVDEEGRRKIDNYLREMEGSFPSKDTVYEYYVDPKTKNWVSFEDKLPKGWRIPTNAPFYKIVVPTVDTVRYQFIVNALVSHQSPVLLVGPVGTGKTSIAQSVLQSLDSSKWAVLTVNMSAQTTTNNVQDIIESRVEKRTKGVYVPSGGKRLITFLDDLNMPAKDTFGSQPPLELLRLWIDYGFWYDRQNQSIKYIKDMFIMAAMGPPGGGRTAISSRLQSRFNLINMTFPSESQIRRIFGTMMSQKLQDFDEEVKPVGDLITQATVELYNAITQRFLPTPAKIHYLFNLRDISK 2530          

HSP 2 Score: 1723.75 bits (4463), Expect = 0.000e+0
Identity = 822/1223 (67.21%), Postives = 999/1223 (81.68%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQME-GKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q MLR  +D HDTK SITRLW+HE FRVF+DR+V   D  AFV +LSEKLGSLF+ T+HN+CP+KQ P+FGD++     YEDITD + LK FM   L E +  PG     LVLF DAI+H+++I+RVI QPRGNMLLVGIGGSGRQSL RLA+Y+C+Y  FQ+EV++ YRKQEFR+D+KRLY  AGVD++P++FL  DTQ+ DESFLED+NNILSSGE+PNLYK DE +++++ LS++A+   I DT +S+F +LI+RVR N+H+VLCMSPVG+PFRNRIR +PA VNCTTIDWFSEWP +ALLEVAERYL+ +QL   G  D ++  +A IF  MHRSV++ S RM  E++RHNY+TPT+YLE+VS YK LL EKRK+L D A KL+NGL KIDETR KVE MS +L  AR K+A FQK+C++YLV+IVQQ+READ+Q K+V    E+I  +E KC  + E A  DL +A+PALE AM+ALESLNKKD+TEIKSYG+PPALV+ VM+AVMILRG EPTWAEAK+ LGE +FIKQLI+FDKDNISDR LKKIG Y    DFQPD++GKVSLAA+SLCMWV AMEVYGR++RVVEPKR R+ AA + L EKQA LA AQ KL  V E +++L+ +Y+EK+ QKE LR +AE  E  L RA  LV+GLAGEK RWE+TV  L+  +G L GDCL+ASA+LSYMGPFLS YRE ++  W + +++  +P +  FS   FLS+PT +R+WN+QGLP D FS +NGVIVTRG+RWPLMVDPQ QA KWIK ME  K LKVIDL M DF+R LE A+QFG PVLLQNVQE+LDPSL PILNKS+ K+GG   ++LGDK+I YN +FRFYITTKL NPHYTPEIS++  IVNFAVKEQGLEAQLLG VVRKERPELEEQK +LV++IAAGKRKL ELEDEILRLLNEA GSLLDD QL+NTLQTSK+T+TEV+EQL+ +E+TE  ID AR+ Y  CAQRAS+LFFVLNDLG+IDPMYQF+LD+Y DLF++SI+KS +S   +ERI+NLND+HTYAVY Y CR LFE+HKLLFSFQ+CAKIL+ +GK+NMDEYNFFL+GGVVLDRE QMDNPC  WLSD  WDNI+ELDKLANFHG++ SFEQYPRDW+ WYTS  PE++ LPGEW+N+ +E QRMLIVRSLR DRV+FC TSFIINNLG+KF EPPVLDM+ VV+DS  ++ L+FVLSPG
Sbjct: 2533 QGMLRAQRDLHDTKQSITRLWVHECFRVFSDRLVDSSDADAFVAILSEKLGSLFNLTYHNLCPSKQPPVFGDFLREPPVYEDITDFQALKTFMNRQLQEQSQRPGAGAKSLVLFTDAIQHVTRIVRVIGQPRGNMLLVGIGGSGRQSLARLASYICDYKVFQLEVTRGYRKQEFREDIKRLYRLAGVDDRPSVFLLTDTQITDESFLEDVNNILSSGEVPNLYKADEFEEIKSALSEKAREQNIPDTPESLFNFLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPQEALLEVAERYLEGVQL---GAIDGIQGKVARIFVTMHRSVAEFSHRMKLELRRHNYITPTSYLEVVSRYKSLLAEKRKELGDKATKLRNGLFKIDETREKVEKMSEQLAVARSKVAEFQKQCEEYLVIIVQQRREADEQQKTVAAHSEKIAAEEIKCKALAENAQKDLEEALPALEEAMRALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGNEPTWAEAKRQLGESNFIKQLIHFDKDNISDRVLKKIGQYCILPDFQPDIIGKVSLAARSLCMWVRAMEVYGRLFRVVEPKRARMNAAMNQLAEKQASLAEAQNKLREVAERLEQLKTQYDEKLAQKEALRAEAELMELKLQRAGTLVTGLAGEKSRWEETVKGLDEDLGFLVGDCLLASAYLSYMGPFLSSYREGILSIWIKEVREMLVPCSAVFSLTNFLSSPTMVREWNLQGLPSDSFSSDNGVIVTRGNRWPLMVDPQGQATKWIKSMESAKGLKVIDLQMTDFMRTLEQAVQFGFPVLLQNVQEELDPSLAPILNKSVTKVGGQLQIRLGDKDIVYNPEFRFYITTKLSNPHYTPEISSQATIVNFAVKEQGLEAQLLGSVVRKERPELEEQKQSLVLNIAAGKRKLQELEDEILRLLNEATGSLLDDVQLLNTLQTSKVTATEVSEQLESSEETEEKIDTAREAYRPCAQRASLLFFVLNDLGRIDPMYQFSLDSYTDLFHLSIDKSKRSANVEERIANLNDWHTYAVYRYTCRALFERHKLLFSFQMCAKILEVAGKLNMDEYNFFLRGGVVLDREEQMDNPCSAWLSDTNWDNITELDKLANFHGIMNSFEQYPRDWHQWYTSPEPESACLPGEWENSCSEIQRMLIVRSLRQDRVAFCVTSFIINNLGSKFTEPPVLDMRAVVEDSLPRSPLVFVLSPG 3752          

HSP 3 Score: 950.658 bits (2456), Expect = 0.000e+0
Identity = 476/1027 (46.35%), Postives = 681/1027 (66.31%), Query Frame = 3
Query: 1485 EICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQ------MRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKK-SIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            ++C CQ  FAR++DG + ++P F GA+G  V   +L+IE  F  N++ L+  K TILDVK TSWHDDYNRFR+GVKDLEVM QN I TAFETV  +++G+E+LDVF HL  RE I+RT DK    +      E +LV KEL        PH  + ++AG     R LR+RI+R M +L  A F+P      +  Q+Y QL+  L+E++RK   E+  G D+  ++ LD  L++RS    GMLD+NF +++LK+F E+HYWERLQF++PHY A+IY RR ELR  RE+VLLVVR YNRI+  L+ EER LF+E+I+ LDKKIQPGL K+ WSSKGA   F++DC ++A+R+Q+ VD YK AN+ I +  + IS  L++ ID  R++ + EF + QE HR+  + +L  LH +I   MR TYE+F  D  ++QQ+W +Y +K+D+  EEAFRLNVK SL EL+KAINGD +   +PLF+V + LQ         + F P+L +L++I+++     +  +    R+ +VL K K ++  I   +  D+EI KI   I  G+   +  +Q  L  WD FR IWELNK+ FI +Y  LNP V + DADI+RYTEV N     E +  ++F+ LD S LK ++  HC +WQ K T LL  MA+  LM LH Y+++ +++V + PQ LEEL +S++L + L  E   +Q +  P+ E F IL+KYEV   D++     +L   W  F Q+L+++E M+KKSK+KFKT L+  +++FKK+  +L+ +F   GPF +S+  + AL +I+  +  +E+LK +E  I  GL++FKIEQP SK++ ALEKDLD+++ +W+   EWE  W +WKSG F+ L+T  ME+ A   +R+ +K SR+LK+KNWEI+E +R R+DQF+RTMPLI DLRN A+R+RHW Q+K E++  FDE + DFTLEKI++L  DQH E I+E+S +ATKEL IE  L+ + K WE+  L+I+P+KD  K H  L G DD++Q L+DN+  LS 
Sbjct:  354 KVCLCQEQFARWQDGKQSQLPCFSGAQGPAVTRSLLEIEETFHKNLQQLKAVKKTILDVKNTSWHDDYNRFRAGVKDLEVMMQNLINTAFETVRGVEEGVELLDVFHHLSAREAIKRTFDKKTVQVYQLFKDELDLVNKELGKKLPTLPPH--MCRFAGQGHAIRGLRRRIDRSMQSLASAHFIPRIGIGEEALQEYQQLAQKLDELMRKLFSEWSQGADKQAVRRLDTPLMARSTEKVGMLDVNFDKSVLKMFVEIHYWERLQFEIPHYVAEIYQRREELRNLRENVLLVVRAYNRIIAALSQEERGLFRERIRFLDKKIQPGLTKLHWSSKGASSAFISDCLLHASRVQQIVDNYKLANEKISQCAQKISESLLLHIDGKRVFRDNEFQEVQEEHRSAAETRLHSLHEDICGVMRATYEVFKADGPEVQQHWMIYTDKMDRMVEEAFRLNVKRSLQELSKAINGDNKTTANPLFRVMVILQSDVPGATGQVEFSPSLQQLSHIMSNTCSEILNTISNFRRLPDVLAKKKFQREPIHVVVERDEEIKKILAQINGGVSVNAGLLQAYLKTWDSFRMIWELNKDAFIRRYQHLNPIVSAFDADIARYTEVANNVQKQETVQHIQFVLLDCSHLKFALVQHCNEWQNKFTGLLSHMASAKLMELHGYLRDNADRVLQPPQTLEELAQSLQLYETLQSELAKVQSQIPPIHEQFAILEKYEV-VVDEVLQTLASLNGAWISFQQSLIDSESMLKKSKEKFKTSLIHTAEEFKKKTHSLLEEFTAKGPFLSSLGCEPALEQISMTREMMETLKAEENTIHLGLSMFKIEQPSSKDLRALEKDLDSLQLVWEATQEWEQRWEEWKSGSFLTLQTDLMESTAQGLYRRLSKLSRELKEKNWEIVETSRQRIDQFKRTMPLIADLRNPALRERHWSQVKQEVQGPFDETAEDFTLEKIVELGLDQHVEKISEISTSATKELFIEQGLENISKTWEATLLDIMPYKD--KGHHRLRGTDDVFQALEDNQVALST 1375          

HSP 4 Score: 300.827 bits (769), Expect = 1.791e-80
Identity = 147/294 (50.00%), Postives = 203/294 (69.05%), Query Frame = 3
Query:  366 VQDEFVTS-NNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKM 1244
            V D F +  +   L  Y     GL+++   P   V +L+YFI++ G     +  +N  + +Q G+V G  I +LLR+M G+YAP  FSN  WP+SI+N+FS  + RF++ALTDAR+KL+G+TVLYIP EA    VE   K+K+ + R+E  M+HWTRQIKEVLSAQ A E  ESSGPL+EI++W++RC DL+GISKQLD+ GV+HI  ILE AKSSYVG F KL+ +I+  T QAQSNL FL+ LK    +L+    +DIP  L +L++ +R+IWVNS  YN+R+ +T +FRK+
Sbjct:   65 VLDRFASDVSQSTLSVYFDPHMGLRVEANMPAQNVEQLMYFIRKEG---ATLTPDNLEETLQFGSVRGTAIVALLRLMNGLYAPYIFSNATWPESIRNNFSAHVHRFLAALTDARYKLQGQTVLYIPIEALHLDVEVAVKDKELVQRLETAMVHWTRQIKEVLSAQEAVEIGESSGPLEEIDFWRDRCADLTGISKQLDQPGVRHIKMILEMAKSSYVGPFHKLSKQIQEGTIQAQSNLSFLSVLKAPFEELTSLSLKDIPPKLPRLLSLVRVIWVNSPFYNTRERLTSLFRKV 355          
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Match: asxl2 (ASXL transcriptional regulator 2 [Source:Xenbase;Acc:XB-GENE-996283])

HSP 1 Score: 1068.91 bits (2763), Expect = 0.000e+0
Identity = 554/1258 (44.04%), Postives = 791/1258 (62.88%), Query Frame = 1
Query: 4483 FFLE*MTSIKLLMTTEIL--YQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEAS-------SMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEW-----SGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEA---IRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQ--FEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESW---LKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCD-PSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM-----EGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDI-WTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            F L     I++L+   I+    + +SR+V P +  VD+W+R LS   ET++  LT QR WLYLE+IF   DI++QLP E+  F +++K W+ IM ++N++ NA     + GLLE+F   N  L+ IQK L+ YLE+KR +FPRFYF+SND+LLEIL Q++NP  V PHL+KCFD+I  L+      +G +         +M S +GE+V   + L+  G VE WL  +E+ M  +LR      R++    A  ++K   EW       Q+ +T SQ+ W  D++  L+   + N    L  + + +K+  E+ +     +R +L  + R  I +L+ I+VH RDI+  L K     I +FEW  QLR+YW+ ++D+CV +   + + Y YEYLG   RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK MGR FSGLAQ+GAW CFDEFNRI+IEVLSV+AQQ+++I +A AS    +FMF+GR I LV +   FITMNPGYAGRTELPDNLK++FRP +M+ P+ A+IAE+ L++EGF   KVLA+K+  +Y L  +QLS+QDHYDFG+RA+ SVL  AG  KR NP + ++ +L+ ++ D NL K  + D  LF GI+SDLFPG+  P  DY  ++  I     N  LQP    + KV+QL+ET   RH VM+VG T  GK+T +++L  AL  L K  E+   ++    + LNPKS+++GELYGE +  T EW DG+++  +R    DT  D KWII DGPVD LWIE+MN+V+DDNK+L L N ERI    Q+ ++FEV++L VASPATVSRCGMVY D  +L W PYV++W   L  KV   + E +  +FD+Y+E    F+   C++ I     + V +LC L + L   + G D   D    + ++   F FC +WS+  ++ E+     D ++R+      E   PN   ++  ++D   K    W E++   +KY+ +VPF++++VPT DTVRY YL++ L+   H V+  G  G GK+ VA   LN++  +  +  + IN SAQTSS+  Q+IIE+++EK+ K      G KR++ F+DD NMP  D +GSQPP+EL+RQ+ D+G +YDR K   K I+D+ +  A  PPGGGR  ++ R    F+++ +  P+E +LK+IF S++N  L DF E +K     I  A +E+Y+ + I  LPTP K HY+FNLRD+SK
Sbjct: 1026 FILGGTDDIQVLLDDSIINISTIASSRYVGPIKSRVDEWQRQLSLFNETLDEWLTCQRNWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLESFQNNNALLDQIQKCLEAYLESKRAVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSIAKLEFAVSPGEGEQEVVFTNDILAMLSPEGEKVNLGKGLKARGNVEDWLGKVEEAMFASLR------RLSKAAIADYQNKTRVEWVVAGHPSQVVLTISQLMWCRDLSHCLEGECEDN----LHSLAEFEKVNFERLNALAGLVRGHLPTLHRNIITALITIDVHARDIVSDLVKDKVDSIESFEWQRQLRYYWDLDLDNCVARMALSQYTYAYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKASKLS-RFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFSMMVPNYALIAEVILYSEGFESSKVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPNLNEDVVLIRALRDSNLPKFLTDDAELFSGIISDLFPGVHIPEHDYGTLQSTIINAMINRGLQPVPSMVDKVIQLFETMIVRHGVMLVGPTGGGKTTVYQILADALGTLFKAGETHPFYQLVKTYILNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSKDHKWIICDGPVDALWIENMNTVLDDNKMLCLANSERIKFTPQIHMVFEVQDLKVASPATVSRCGMVYIDSEELKWMPYVQTWISGLSAKVSVCIAEYVLALFDRYVEDGLKFVNKKCVQAISQVDISKVTTLCCLLESLLLGKGGPDLQMDPSRLNSIVCQTFVFCYLWSVGGNLTENYWDAFDTFVRQQFEDNPEAKLPNSGDLWSVYMDYDTKRLDPW-ERIIPSFKYSNNVPFFEMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVVARGLLNRIQEEAGYVPVYINFSAQTSSSRTQEIIESKLEKKRKTILGAPGNKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDVTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSEHSLKQIFQSILNGFLADFPEAVKQAATNIVDAAVEIYHRMSIDLLPTPAKSHYVFNLRDLSK 2271          

HSP 2 Score: 925.235 bits (2390), Expect = 0.000e+0
Identity = 512/1217 (42.07%), Postives = 738/1217 (60.64%), Query Frame = 3
Query: 8205 KNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMS-----STDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECD-DYLVVIVQQKREADDQAKSVMQTQERI-KVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            K  I RL+ HE  R+F DR++ ++DK  F E+LSE     F           +  IFGD+       +   YED+TD+EK+K  +++ LD+YN T     + LV F+DA+EH+S+I R+IRQ RGN LLVG+GG+G+QSLTRLAA++C Y  FQIE+S+ Y    F +DL++LY  AGV++K  +FLF DTQV                   +L  Q    +    L           ++  +F Y I RVR  +H+VLCMSPVGE FR R RMFP+ VNC TIDWF +WP +ALL V++++  ++ L   G E  MK   + +   +H SV+ M+++   E++R  Y TPT+YLEL++ Y  +L EKR QL  + +++KNGL K+ ET   V+ M +EL      L   QK  D D L+  +   +E  DQ + +++  E + KV   +   + + A  DL +AMPALEAA +AL+SL+K DI+EI+ + KPP LV  VMEA+ IL  A+P W+ AK+ LG+ +F+K+L+ +DK+NI  + L K+  YV   DF P+ V KVS A +S+CMWV AM++Y RV + VEPK+Q+L AA++ L    + L   Q KL +V E++K LQ +Y++ + +KE L K    T+  L+RA KL S L  E+ RW++++A+ E +I  + G+  IA+A ++Y G F + YR+ LV  W    ++ +IP +P+FS I  L +  +IR WN  GLPRD  S ENG++VTRG RWPLM+DPQ QA +WI+  E K  LKVI L    F+R LE AI+ G PVLL+ ++E LDP+L+PIL+K     GG T+++LGD +I+Y+ +FRFY+TTK+PNPHY PE+  K  I+NF V   GLE QLL  VVR ERP+LEEQ++ L++ I + K +L  +ED IL+LL  ++G++LD+E L+NTLQ SKITS  +  +L  AE TE  I+ AR+ Y   A + S+++FV+  L +IDPMYQ++L  +  LFNM+I  + KS   D R++ L     ++ Y    RGLFE+HKL++SF +C +I++  G+++  E+NFFL+G   LD+E       PG LSD           L+ F+  I                                     ML+  S+    V F  T F+IN LG KF+E P +D+  +  D S  T LIF+LS G
Sbjct: 2287 KTQIFRLFCHECQRIFHDRLINNEDKQYFHEMLSEMASKHFAVQIDPEYFVTKPIIFGDFTKVGVDKADKVYEDLTDMEKIKSVLQDYLDDYNLT-NAKDVKLVFFQDAVEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCFQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQV-------------------SLILQTSTCEQGKLLVSSFSLLPCSSSSYYVFQYFISRVRQKLHIVLCMSPVGEAFRARCRMFPSLVNCCTIDWFVQWPKEALLSVSQKFFINIDL---GSEG-MKAKFSEMCVEIHMSVNTMAEKYYSELRRRYYTTPTSYLELINLYLSMLGEKRNQLVSARDRVKNGLSKLLETNVLVDKMKVELSALEPVLK--QKSVDVDALMEKLSVDQENADQVRRIVKEDEAVAKVKAEETQAIADDAQRDLDEAMPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAICILLNAKPDWSAAKQLLGDSNFLKRLLEYDKENIKPQILLKLQKYVNNPDFVPEKVEKVSKACRSMCMWVRAMDLYSRVLKDVEPKKQKLAAAQAELDATMSTLRDKQQKLKSVEEQIKALQDQYDKSLSEKESLAKTMALTQARLNRAGKLTSALGDEQVRWKESIANFEEEISNVIGNVFIAAACVAYFGAFTAVYRQLLVDCWINKCQELEIPISPNFSLINILGDAYEIRQWNTDGLPRDHISTENGILVTRGRRWPLMIDPQDQANRWIRNKENKNGLKVIKLTDAGFLRTLENAIRLGLPVLLEELKETLDPALEPILSKQTFTSGGRTLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTRSGLEDQLLSDVVRIERPDLEEQRNQLIIRINSDKNQLKAIEDRILKLLFTSEGNILDNEDLINTLQESKITSGAIKTRLLEAEATEENINTAREKYRPVATQGSVIYFVIASLSEIDPMYQYSLKYFKQLFNMTIEAAEKSNDLDIRLATLLSQTLFSAYTNVSRGLFEQHKLIYSFMLCVEIMRHKGEISETEWNFFLRGAAGLDKERPTKPDVPG-LSDYY---------LSIFYARI-------------------------------------MLLGHSI---NVVFAVTEFVINTLGKKFIENPPIDLATLYQDMSPSTPLIFILSTG 3427          

HSP 3 Score: 108.227 bits (269), Expect = 3.210e-22
Identity = 117/572 (20.45%), Postives = 240/572 (41.96%), Query Frame = 3
Query: 2877 NGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIG-----EVLQKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFI-----SQYCDLN------PHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSAL------IMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
             G    E  P+F   + L  + L F P+L +    +  +   F E+V  +P +      +   K  +   + E    D        +    +Q I S I+E + Y     +++    E F+     ++  DL       P V      + +Y +  N AL       +  L +D   LK  +    +   + + ++L  +A K    +     +   K+  +P    +   S+  LD++ E    ++E+ + +   + ++D Y+V    +       L+        A+ ++      S +KF   L     +  K+V  +      I+D       A  +  ++ LA +    + L++   Q +  ++    FK+E    + +  +  ++   + +W    EW+    +W    F  L   ++ +L     + AT+  + L   N  ++   + +V+  +  +P+ITDLRN  ++ RHW  ++  I     +     +L+K+I+++   +A+ I ++SG A+ E ++E  +K +E  W++ E   IPH+D  K+ F+L G DD+   LDD+
Sbjct:  481 GGQIEEEVVPMFLTEIVLDTQALWFEPSLDDFQENIAEVVNQFQEIVLSLPNLVPDSYFDAFTKPTINNKLEEKTCGDGPTLSTMFDDDKHLQTIISQIKETIQYAFDAAQVYAGTFERFLIFFKENENLDLEAMKKEEPGVDFFAEKLEKYNKEHNDALAITQNRNIGLLLIDAKKLKEKLIPSPKRCLEAINDMLPILAKKKTDAVIAEALDAQFKLQSLPTTTIDYVNSLIFLDEIQERIEVLEEECNIVSHMYQLIDNYKVPTPPEDFAVYATLQPSITAVRNAIDKSVGERDGSIEKFCHSLDKDIAELNKEVKEVRQKDPQILDLA-----ADQVKVKQILADLHTVLNELQTCAFQYKTYQKN---FKVEVTKYEALEEVCAEVKLKQLLWDSLAEWDVLQDEWMQSNFEALDPEQVNSLVLKYAKFATQLEKGLPPNN--VVPLLKEKVENMKEKVPVITDLRNPFLKPRHWAALEQTINAALIDTEHPLSLQKLIEIHAFDYAQAIQDISGQASGEASLETIIKKVEDSWKATEFTAIPHRD-SKDVFILGGTDDIQVLLDDS 1041          
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Match: plekhg3 (pleckstrin homology and RhoGEF domain containing G3 [Source:Xenbase;Acc:XB-GENE-6468932])

HSP 1 Score: 1041.95 bits (2693), Expect = 0.000e+0
Identity = 546/1245 (43.86%), Postives = 772/1245 (62.01%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLL-RDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELS---KERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSV--LVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCL---ATVENGCDPSDTDNYSRV---IELWFQFCMIWSICCSVDEDGRKKIDNYIRE------MEGTFPNKDTIYEYFVDNKNKS---------------WGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQ--KRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQD-FEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            M  S F KPFE  +  WE  L   Q+ +E  L  QR WLYLE IF  EDI +QLP E   +  + + WR IM    + +   +   +  LLE+    N  LE +QK L  YLETKR  FPRFYF+S+D+LLEIL Q+K+P  V PHL+KCF+N+  L    L     + + M+S++GEEV   + +   G VE WL ++EK M+ ++R+ + R  ++      + R +W+  W GQ+ I   Q  WT DV++AL      N   P      + +  L      +R  L+++QR  +++L+VIEVH +D+  +L +   S +N FEW+SQLR+YW +  DD  ++  N  F YGYEYLGN+GRLVITPLTDRCY+TLT ALHL  GG+P GPAGTGKTET KDLGK+L    +V NCS+ LD+ +MG+ F GLA +GAW CFDEFNRI+IEVLSVVAQQI +I  A       +FMF+G  I LV +  +FITMNPGYAGRTELPDNLK++FRP+AM+ PD AMIAEI+L++ GF+  K+LAKK+ T + LS +QLS QDHYDFG+RA+ +V+  AG  KR NP M +E I L ++ D+N+ K    DL LF GIVSDLFP I+   +DY  ++EAI K C    L+  +  +TK +QLYET   RH +M+VG T SGK+  +++L +AL  L          +E    + LNPKS+++G+LYGEFDL T+EWTDG+LSS++R     T PD +W +FDGPVD +WIE+MN+V+DDNK L L +GE I + E ++++FEV++L+VASPATVSRCGMVY + + LG  P+ E WL+   D +    E+L  +F  ++     F++ +  E+I ++  N  +SL KL DC       + G      +   R+   IE WF F +IWS+  + D  GR     ++R+      +   FP +  +++Y +D+   S               W +W +     +       +  IIVPT+DTVR ++L+  L+ N  PV+ VGP GTGKT    + L +     +    +  SA+TS+N  QD+I+++++KR K  F P  G+  + F+DD NMP+ +T+G+QPP+EL+RQW+D+G WYDR KQ    K++ D+    AMGPPGGGR  +S RL   FN ++ T   +S+  RIF S++   L+    E ++ + + +  ATI++YN +  + LPTP K HY FNLRD+SK
Sbjct: 1094 MSFSPFKKPFEERISTWEGKLRLTQDVLEEWLICQRSWLYLEPIFSSEDINRQLPVEGKRYQTMERTWRKIMKNAEENKQVISLCPEPRLLESLRECNKLLELVQKGLSEYLETKRAAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENVARL----LFQHDLQITHMYSAEGEEVKLSKAIYPTGNVEDWLFEVEKVMKASVREYIERSIKVY---PETPRTEWVLNWPGQVTIAGCQTFWTKDVSEALDAGDLSNRLFP------QLESQLSGLVALVRGKLSRMQRSILSALIVIEVHAKDVAARLIEENVSSVNDFEWISQLRYYWAR--DDLYVRAVNAEFLYGYEYLGNTGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASSGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVD-RFMFEGVEIPLVTTCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNNAKILAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQDDLKLFSGIVSDLFPRIEEEHIDYGTLEEAIRKTCVQKNLKDVDGFVTKCIQLYETTVVRHGLMLVGPTGSGKTQCYKVLAAALTSLKGLPSVSGGTYETVHYYILNPKSITMGQLYGEFDLLTHEWTDGILSSLIRGGATSTDPDRRWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLTPFTECWLRCMPDVIKPFTEKLESLFSHFLLDSIRFVRRSVKEMIASTDNNLTMSLLKLLDCFFQPFIPQEGQKKFPEEKLRRIEELIESWFFFSLIWSVGITGDSQGRVLFSTWLRDKMKSEKIAMLFPEQGLVHDYKLDDAGISNASEEDEEDVQKPICWVNWMDS-AGSFSIVPDTSYADIIVPTLDTVRMSHLLGMLLTNKKPVLCVGPTGTGKTLTITDKLLKNFPMEYISHFLMFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRYYIFFIDDLNMPSLETYGAQPPIELLRQWMDHGGWYDR-KQIGVFKQLVDINFLCAMGPPGGGRNPVSPRLTRHFNYLSFTELEDSSKSRIFSSILGSWLEKGLWEIIENLTEQLVSATIKVYNTITSQLLPTPAKSHYTFNLRDLSK 2320          

HSP 2 Score: 964.911 bits (2493), Expect = 0.000e+0
Identity = 526/1248 (42.15%), Postives = 774/1248 (62.02%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSS---TDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALA-------DLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPT--------------WAEAKKHLGEQD-FIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQME-GKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q ML  +      K  + +LW HE+ RVF DR+V ++D+  F EL   K+   F  +FH + P +Q  +FGD+MS       Y+ I D EKL + ++E +++YN      +M LVLF DAI+HI +I RV+RQP GN LL+G+GGSGRQSLTRLA+ M +Y  FQIE+SK+Y + E+R+D+K +  +AG+ N P  FLF DTQ+ DESFLEDINNIL+SG++PNLY  DE+D +   +    +  G + T  ++      RVRGN+H VLCMSP+GE FR+R+R FP+ V C TIDWF EWP +AL  VA  +L ++      E+  + P +  +   +H+SV+  S++ L E+ RHNY+TP +YLEL+  +  L+ +K  ++  + +++K+GL K+  T   V  M  ELE  R  L    +E     V  +Q+ +E    A++   T+  ++V+EAK  +  + A A       DL +A+PAL+AA+ +L+SLNK D+TE+++  +PP  V+ V+EAV I++G +P               W   K  L +   F++ L  FDKDNI D  +K I  Y+  ++FQP  + +VS A  S+C WV AM  Y  V R VEPKRQ L+ A+  L   Q  L AA+A+L  V + +  LQ +Y + + +KEEL  K E  E+ L RA KL++GL+ E+ RW+ TV +LEN +  + GD L+ + FL+Y+GPF   YR  L  +WT+ +++ ++P +   S I  L +P +IR W I GLP D  SVENGVI     RW   +DPQ QA +WIK ME    L+V  L   DF+R LE AI+FG+P +L+NV E+LDP+L+P+L K   K  G+TV++LGD  I Y+ DFR YITTKLPNPHY PEI TK  ++NF +   GLE QLLG VV +ERP+LEE K+ L++S A  +++L ++ED+IL  L+ +QG+ +DD  L+  L+ SK  + E+  ++Q+AE+TE  ID  R+ Y   A R  ILFF ++DL  +DPMYQ++L+ ++ +F  +I  S ++   ++RI N+N Y T++++   CR LFEKHKL+FSF +C +IL   G ++M+E+ F L GG      +  +NP P WL+++AW +I  L  L+NF  +      Y +++     S  P    LPG W  + + FQ++LI+R LR D+V+     ++  +LG +F+EP   D+  V  +SS  T LIF+LSPG
Sbjct: 2323 QGMLMADASKMGDKYQLLKLWYHESCRVFQDRLVNEEDRSWFDELFKGKMQE-FGASFHEVVP-QQPVLFGDFMSPGSDAKAYQLIEDREKLHRVIEEYMEDYNQI-NTAKMKLVLFLDAIQHICRISRVLRQPLGNALLLGVGGSGRQSLTRLASNMAQYECFQIELSKNYGRSEWREDIKGILLKAGLQNTPITFLFTDTQIKDESFLEDINNILNSGDVPNLYGPDELDQIVTVMKPVVQDMGQQPTKANLMAAYTRRVRGNIHTVLCMSPIGEVFRSRLRQFPSLVTCCTIDWFDEWPAEALQSVASSFLSEIPELQSRED--IIPGMIQMCVDIHQSVAVKSKQYLAELSRHNYITPKSYLELLGIFSKLIGKKLMEIKTAKDRMKSGLDKLLTTAEDVAKMQEELEVMRPLL----EEAAQDTVTTMQKIQEDTVVAEA---TRGSVQVEEAKATEKAQTAQAIADDAQKDLDEALPALDAALASLKSLNKNDVTEVRAMQRPPVGVKLVIEAVCIMKGIKPKKVAGDKPGSKIDDYWEPGKGLLQDPGKFLEGLFKFDKDNIPDAVIKAIQPYIDNEEFQPAAIARVSKACTSICQWVRAMHKYHFVARGVEPKRQALREAQEDLAVTQKILDAAKARLRDVEDGIATLQAKYRDCVSKKEELEHKCEQCEQKLGRADKLITGLSDERQRWQDTVLNLENLLVNVAGDLLLCAGFLAYLGPFTGPYRTTLFNQWTKKLQELKVPCSEEPSLIGTLGDPVKIRSWQIAGLPNDTLSVENGVITQYSQRWSHCIDPQGQANRWIKNMEKDNGLEVAKLSDRDFLRSLENAIRFGKPFMLENVGEELDPALEPVLLKQTYKQQGSTVLRLGDAVIPYHDDFRMYITTKLPNPHYPPEICTKVTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLILSNAKMRQELKDIEDQILLRLSTSQGNPVDDVDLIKVLEASKQKAGEIKVKVQVAEQTERDIDSTRRQYVPVAVRTQILFFCVSDLSNVDPMYQYSLEWFLSIFIAAIANSERAETVEKRIININTYFTFSLFSNVCRSLFEKHKLMFSFLLCVRILMNQGLIHMEEWRFLLSGGTA---SSLAENPFPEWLTERAWRDIQALSALSNFSKITEQLTHYAKEYRGLCDSPEPHREQLPGNWGQSLDSFQKILILRCLRGDKVTNAMQDYVCQHLGQRFIEPQTADLGAVYKESSPVTPLIFILSPG 3555          

HSP 3 Score: 90.5077 bits (223), Expect = 6.937e-17
Identity = 151/715 (21.12%), Postives = 296/715 (41.40%), Query Frame = 3
Query: 2589 ELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDS--------------------SDIQQY-WNLY-MNKVDKFCE-------EAFRLNVKYSLNELNKAI----------------NGDGRNEP-----SPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPL----GYWDQFREIWELNK---EEFISQYCDLNPHVYSIDADISRY---TEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEA--EQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLN----LFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQ-WKSGRFIELKTIEMENLANSSFRKATKFSRDLKD--KNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            E+I+S+  ++++ NR+   T F+ S    + V  E+      +  +Q+    ++F KDS                     D+ +  W +Y M+K+ +  E       ++ R  V+ SL    + I                 GD  N P     +P+F + L L    + F   L      + SL    I     +P+    L+K  L+          + +   +  +    +DI ++I + L     Y  Q+ +  ELN    E +I  +   N    +I   +       E  + AL +   + V   Q+    +K +++   R+    L  LL     K +  + +  + +S  V + P ++EEL E    +  + E+   ++E+   +   + ++D++    S +    K N+   W   +  L+++  EQ   + ++KF+   ++   +F +++ +L M       F+  +    A  +IAN    +     + Q++    N    LF +      ++  + K      ++W  A +W   W + W +     +   ++E     S++   K  +  +D     E+ +  + R+++FR  +PLI  LRN  MR+RHW  +  +I+    +  ++    + +++N   H + I +V+  A KE AIE AL  ME  W SV   I+P+  KE   F+L   ++  Q LDD+
Sbjct:  395 EVITSLCKVRVECNRVSSMTLFHSSMA--KCVRLEEFEQTQSQTFSQV----QLFLKDSWVSTLKNAVRSSLRDVGKGWYDLHECNWEVYQMSKLRQLMELIKFNLQDSLRFLVQDSLVSFTQLIMDACCSVLSCTEDMDWGGDLVNSPYKPRKNPIFLLDLVLDNSGVHFSTPLENFELTLMSLFDKGILATHSVPQ----LEKFVLEDLFICGTPLLESVGLHEPPVEELRKDIRTAICKALIPLRSYAKQYEKYLELNNTDLETYIRDFQSKNSSALNIKLAVQENLLEKERLDNALPSS--IIVGPFQISIEGVKQNLSRKRRNLSNALLELLAKSLRKEMDDISDQFRAISRSVYEKPNSIEELTELREWMKGVPEKLKTLEEQITKVTSDYDVIDEFLYSLSQEDFSAKWNV-IAWPNKVMVLMDSICEQH-TEDEEKFRKIQVMDQTNFLERLDSLQM---VVAGFSTHVDITRA-HEIANEVRRVHKQLKESQQMALLYNNRERLFGLPVTNYDKLVRMVKAFQPFRDLWTTASDW-MRWNESWMNDPLTTIDAEQLEKNVTESYKVMHKCIKQFRDIPACQEVAQDIKERIEEFRPYIPLIQGLRNPGMRNRHWELLSEQIQINI-KPKANLNFTRCLEMNLQDHIDSIAKVAEIAGKEFAIEQALDKMENEWASVLFTILPY--KETGTFILKSPEEASQLLDDH 1087          
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Match: plekhg3 (pleckstrin homology and RhoGEF domain containing G3 [Source:Xenbase;Acc:XB-GENE-6468932])

HSP 1 Score: 1040.8 bits (2690), Expect = 0.000e+0
Identity = 545/1245 (43.78%), Postives = 771/1245 (61.93%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLL-RDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELS---KERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSV--LVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCL---ATVENGCDPSDTDNYSRV---IELWFQFCMIWSICCSVDEDGRKKIDNYIRE------MEGTFPNKDTIYEYFVDNKNKS---------------WGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQ--KRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKL-QDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            M  S F KPFE  +  WE  L   Q+ +E  L  QR WLYLE IF  EDI +QLP E   +  + + WR IM    + +   +   +  LLE+    N  LE +QK L  YLETKR  FPRFYF+S+D+LLEIL Q+K+P  V PHL+KCF+N+  L    L     + + M+S++GEEV   + +   G VE WL ++EK M+ ++R+ + R  ++      + R +W+  W GQ+ I   Q  WT DV++AL      N   P      + +  L      +R  L+++QR  +++L+VIEVH +D+  +L +   S +N FEW+SQLR+YW +  DD  ++  N  F YGYEYLGN+GRLVITPLTDRCY+TLT ALHL  GG+P GPAGTGKTET KDLGK+L    +V NCS+ LD+ +MG+ F GLA +GAW CFDEFNRI+IEVLSVVAQQI +I  A       +FMF+G  I LV +  +FITMNPGYAGRTELPDNLK++FRP+AM+ PD AMIAEI+L++ GF+  K+LAKK+ T + LS +QLS QDHYDFG+RA+ +V+  AG  KR NP M +E I L ++ D+N+ K    DL LF GIVSDLFP I+   +DY  ++EAI K C    L+  +  +TK +QLYET   RH +M+VG T SGK+  +++L +AL  L          +E    + LNPKS+++G+LYGEFDL T+EWTDG+LSS++R     T PD +W +FDGPVD +WIE+MN+V+DDNK L L +GE I + E ++++FEV++L+VASPATVSRCGMVY + + LG  P+ E WL+   D +    E+L  +F  ++     F++ +  E+I ++  N  +SL KL DC       + G      +   R+   IE WF F +IWS+  + D  GR     ++R+      +   FP +  +++Y +D+   S               W +W +     +       +  IIVPT+DTVR ++L+  L+ N  PV+ VGP GTGKT    + L +     +    +  SA+TS+N  QD+I+++++KR K  F P  G+  + F+DD NMP+ +T+G+QPP+EL+RQW+D+G WYDR KQ    K++ D+    AMGPPGGGR  +S RL   FN ++ T   +S+  RIF S++   L +     ++ + + +  ATI++YN +  + LPTP K HY FNLRD+SK
Sbjct: 1089 MSFSPFKKPFEERISTWEGKLRLTQDVLEEWLICQRSWLYLEPIFSSEDINRQLPVEGKRYQTMERTWRKIMKNAEENKQVISLCPEPRLLESLRECNKLLELVQKGLSEYLETKRAAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENVARL----LFQHDLQITHMYSAEGEEVKLSKAIYPTGNVEDWLFEVEKVMKASVREYIERSIKVY---PETPRTEWVLNWPGQVTIAGCQTFWTKDVSEALDAGDLSNRLFP------QLESQLSGLVALVRGKLSRMQRSILSALIVIEVHAKDVAARLIEENVSSVNDFEWISQLRYYWAR--DDLYVRAVNAEFLYGYEYLGNTGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASSGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVD-RFMFEGVEIPLVTTCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNNAKILAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQDDLKLFSGIVSDLFPRIEEEHIDYGTLEEAIRKTCVQKNLKDVDGFVTKCIQLYETTVVRHGLMLVGPTGSGKTQCYKVLAAALTSLKGLPSVSGGTYETVHYYILNPKSITMGQLYGEFDLLTHEWTDGILSSLIRGGATSTDPDRRWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLTPFTECWLRCMPDVIKPFTEKLESLFSHFLLDSIRFVRRSVKEMIASTDNNLTMSLLKLLDCFFQPFIPQEGQKKFPEEKLRRIEELIESWFFFSLIWSVGITGDSQGRVLFSTWLRDKMKSEKIAMLFPEQGLVHDYKLDDAGISNASEEDEEDVQKPICWVNWMDS-AGSFSIVPDTSYADIIVPTLDTVRMSHLLGMLLTNKKPVLCVGPTGTGKTLTITDKLLKNFPMEYISHFLMFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRYYIFFIDDLNMPSLETYGAQPPIELLRQWMDHGGWYDR-KQIGVFKQLVDINFLCAMGPPGGGRNPVSPRLTRHFNYLSFTELEDSSKSRIFSSILGSWLGKSGASAVQNLTEQLVSATIKVYNTITSQLLPTPAKSHYTFNLRDLSK 2315          

HSP 2 Score: 966.066 bits (2496), Expect = 0.000e+0
Identity = 526/1248 (42.15%), Postives = 774/1248 (62.02%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSS---TDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALA-------DLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPT--------------WAEAKKHLGEQD-FIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQME-GKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q ML  +      K  + +LW HE+ RVF DR+V ++D+  F EL   K+   F  +FH + P +Q  +FGD+MS       Y+ I D EKL + ++E +++YN      +M LVLF DAI+HI +I RV+RQP GN LL+G+GGSGRQSLTRLA+ M +Y  FQIE+SK+Y + E+R+D+K +  +AG+ N P  FLF DTQ+ DESFLEDINNIL+SG++PNLY  DE+D +   +    +  G + T  ++      RVRGN+H VLCMSP+GE FR+R+R FP+ V C TIDWF EWP +AL  VA  +L ++      E+  + P +  +   +H+SV+  S++ L E+ RHNY+TP +YLEL+  +  L+ +K  ++  + +++K+GL K+  T   V  M  ELE  R  L    +E     V  +Q+ +E    A++   T+  ++V+EAK  +  + A A       DL +A+PAL+AA+ +L+SLNK D+TE+++  +PP  V+ V+EAV I++G +P               W   K  L +   F++ L  FDKDNI D  +K I  Y+  ++FQP  + +VS A  S+C WV AM  Y  V R VEPKRQ L+ A+  L   Q  L AA+A+L  V + +  LQ +Y + + +KEEL  K E  E+ L RA KL++GL+ E+ RW+ TV +LEN +  + GD L+ + FL+Y+GPF   YR  L  +WT+ +++ ++P +   S I  L +P +IR W I GLP D  SVENGVI     RW   +DPQ QA +WIK ME    L+V  L   DF+R LE AI+FG+P +L+NV E+LDP+L+P+L K   K  G+TV++LGD  I Y+ DFR YITTKLPNPHY PEI TK  ++NF +   GLE QLLG VV +ERP+LEE K+ L++S A  +++L ++ED+IL  L+ +QG+ +DD  L+  L+ SK  + E+  ++Q+AE+TE  ID  R+ Y   A R  ILFF ++DL  +DPMYQ++L+ ++ +F  +I  S ++   ++RI N+N Y T++++   CR LFEKHKL+FSF +C +IL   G ++M+E+ F L GG      +  +NP P WL+++AW +I  L  L+NF  +      Y +++     S  P    LPG W  + + FQ++LI+R LR D+V+     ++  +LG +F+EP   D+  V  +SS  T LIF+LSPG
Sbjct: 2318 QGMLMADASKMGDKYQLLKLWYHESCRVFQDRLVNEEDRSWFDELFKGKMQE-FGASFHEVVP-QQPVLFGDFMSPGSDAKAYQLIEDREKLHRVIEEYMEDYNQI-NTAKMKLVLFLDAIQHICRISRVLRQPLGNALLLGVGGSGRQSLTRLASNMAQYECFQIELSKNYGRSEWREDIKGILLKAGLQNTPITFLFTDTQIKDESFLEDINNILNSGDVPNLYGPDELDQIVTVMKPVVQDMGQQPTKANLMAAYTRRVRGNIHTVLCMSPIGEVFRSRLRQFPSLVTCCTIDWFDEWPAEALQSVASSFLSEIPELQSRED--IIPGMIQMCVDIHQSVAVKSKQYLAELSRHNYITPKSYLELLGIFSKLIGKKLMEIKTAKDRMKSGLDKLLTTAEDVAKMQEELEVMRPLL----EEAAQDTVTTMQKIQEDTVVAEA---TRGSVQVEEAKATEKAQTAQAIADDAQKDLDEALPALDAALASLKSLNKNDVTEVRAMQRPPVGVKLVIEAVCIMKGIKPKKVAGDKPGSKIDDYWEPGKGLLQDPGKFLEGLFKFDKDNIPDAVIKAIQPYIDNEEFQPAAIARVSKACTSICQWVRAMHKYHFVARGVEPKRQALREAQEDLAVTQKILDAAKARLRDVEDGIATLQAKYRDCVSKKEELEHKCEQCEQKLGRADKLITGLSDERQRWQDTVLNLENLLVNVAGDLLLCAGFLAYLGPFTGPYRTTLFNQWTKKLQELKVPCSEEPSLIGTLGDPVKIRSWQIAGLPNDTLSVENGVITQYSQRWSHCIDPQGQANRWIKNMEKDNGLEVAKLSDRDFLRSLENAIRFGKPFMLENVGEELDPALEPVLLKQTYKQQGSTVLRLGDAVIPYHDDFRMYITTKLPNPHYPPEICTKVTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLILSNAKMRQELKDIEDQILLRLSTSQGNPVDDVDLIKVLEASKQKAGEIKVKVQVAEQTERDIDSTRRQYVPVAVRTQILFFCVSDLSNVDPMYQYSLEWFLSIFIAAIANSERAETVEKRIININTYFTFSLFSNVCRSLFEKHKLMFSFLLCVRILMNQGLIHMEEWRFLLSGGTA---SSLAENPFPEWLTERAWRDIQALSALSNFSKITEQLTHYAKEYRGLCDSPEPHREQLPGNWGQSLDSFQKILILRCLRGDKVTNAMQDYVCQHLGQRFIEPQTADLGAVYKESSPVTPLIFILSPG 3550          

HSP 3 Score: 90.8929 bits (224), Expect = 6.486e-17
Identity = 151/715 (21.12%), Postives = 296/715 (41.40%), Query Frame = 3
Query: 2589 ELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDS--------------------SDIQQY-WNLY-MNKVDKFCE-------EAFRLNVKYSLNELNKAI----------------NGDGRNEP-----SPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPL----GYWDQFREIWELNK---EEFISQYCDLNPHVYSIDADISRY---TEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEA--EQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLN----LFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQ-WKSGRFIELKTIEMENLANSSFRKATKFSRDLKD--KNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            E+I+S+  ++++ NR+   T F+ S    + V  E+      +  +Q+    ++F KDS                     D+ +  W +Y M+K+ +  E       ++ R  V+ SL    + I                 GD  N P     +P+F + L L    + F   L      + SL    I     +P+    L+K  L+          + +   +  +    +DI ++I + L     Y  Q+ +  ELN    E +I  +   N    +I   +       E  + AL +   + V   Q+    +K +++   R+    L  LL     K +  + +  + +S  V + P ++EEL E    +  + E+   ++E+   +   + ++D++    S +    K N+   W   +  L+++  EQ   + ++KF+   ++   +F +++ +L M       F+  +    A  +IAN    +     + Q++    N    LF +      ++  + K      ++W  A +W   W + W +     +   ++E     S++   K  +  +D     E+ +  + R+++FR  +PLI  LRN  MR+RHW  +  +I+    +  ++    + +++N   H + I +V+  A KE AIE AL  ME  W SV   I+P+  KE   F+L   ++  Q LDD+
Sbjct:  390 EVITSLCKVRVECNRVSSMTLFHSSMA--KCVRLEEFEQTQSQTFSQV----QLFLKDSWVSTLKNAVRSSLRDVGKGWYDLHECNWEVYQMSKLRQLMELIKFNLQDSLRFLVQDSLVSFTQLIMDACCSVLSCTEDMDWGGDLVNSPYKPRKNPIFLLDLVLDNSGVHFSTPLENFELTLMSLFDKGILATHSVPQ----LEKFVLEDLFICGTPLLESVGLHEPPVEELRKDIRTAICKALIPLRSYAKQYEKYLELNNTDLETYIRDFQSKNSSALNIKLAVQENLLEKERLDNALPSS--IIVGPFQISIEGVKQNLSRKRRNLSNALLELLAKSLRKEMDDISDQFRAISRSVYEKPNSIEELTELREWMKGVPEKLKTLEEQITKVTSDYDVIDEFLYSLSQEDFSAKWNV-IAWPNKVMVLMDSICEQH-TEDEEKFRKIQVMDQTNFLERLDSLQM---VVAGFSTHVDITRA-HEIANEVRRVHKQLKESQQMALLYNNRERLFGLPVTNYDKLVRMVKAFQPFRDLWTTASDW-MRWNESWMNDPLTTIDAEQLEKNVTESYKVMHKCIKQFRDIPACQEVAQDIKERIEEFRPYIPLIQGLRNPGMRNRHWELLSEQIQINI-KPKANLNFTRCLEMNLQDHIDSIAKVAEIAGKEFAIEQALDKMENEWASVLFTILPY--KETGTFILKSPEEASQLLDDH 1082          
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 1002.66 bits (2591), Expect = 0.000e+0
Identity = 529/1256 (42.12%), Postives = 770/1256 (61.31%), Query Frame = 1
Query: 4507 IKLLMTTEIL--YQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKL---RLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFP-LNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESW---LKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLA-TVENGCDPSDTDNYSRVIELWFQ----FCMIWSICCSVDEDGRKKIDNYIREM------------------EGTFPNKDTIYE-YFVDNKNKSWGHWDEKL-KAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKL-QDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            I+LL+   I+    M  S F+KP E E  +WE+ L  IQE ++  L  Q  WLYLE IF  EDI  Q+P+E   F  ++  W+ IM E  +        K++ +L      N  LEDIQK L+ YLE KR  FPRF+F+SND+LLEIL ++K+P +V PHLKKCF+ I  L+     ++  + + M SS+ E V   QK+   + +G VE WL  +E+ M  ++R ++RD      +    R +W+ +W GQ+ I  S I WT +V++A+          P  + K  Q++   +  E +R  L+   R  + +L VI+VH RD++ KL +   S+++ F+W+SQLR+ WE +  D ++K   T  +YGYEYLGNS RLVITPLTDRCY TL  AL L+ GG+P+GPAGTGKTET KDL K+L    +V NCS+GLDYK+MG+ F GLAQ+GAW CFDEFNRI +EVLSVVAQQILSI  A+  N    F F+G  + L P+  +FITMNPGYAGR ELPDNLK++FR +AM+ PD A+I EI+L++ GF   + LA+K+   Y L  +QLS Q HYD+G+RA+ SVL  AG  K   P   +  +LL ++ D+NLAK  + D+PLF+GI+SDLFPG+  P  DY    +A++      +LQP  + I K++Q+YE    RH  MIVG  + GK+  +++L  AL +L     S  E A+E   +NPK++++G+LYG FD  ++EWTDGVL++  R+  + T  D KWIIFDGPVD +WIE+MN+V+DDNK L L++GE I M  ++SL+FE  +L  ASPATVSRCGM+Y + + LGW+P  +S+   L   + S   E +S MF+  ++   +FI+  C  L+ TSP +   S+ +L+ CL   + N  +  +    S+ I LW Q    F ++W+I  +++ D RKK D + R +                     FP K ++Y+ YF    +  W  W + + K       +     +I+PT++T R  + ++  + +  P++ VGP GTGK+++  + L +L  + +   +IN SA+TS+N  QDII +++++R K  F P  GK+ + F+DD NMPAK+ +G+QPP+EL+RQWID+G WYDR   ++  I D+    AMGPPGGGR  I+ R     N++ +    +  L +IFGS+ +    + F+      G ++ QAT+ +Y   V  FLPTP+K HY+FNLRD S+
Sbjct:  945 IQLLLDDHIIKTQTMCGSPFIKPIEAEAREWEQTLVLIQEIMDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKNIMVEAVKDTRVLIATKQDNMLGRLQESNVLLEDIQKGLNTYLEKKRLYFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLE----FTEDLQITGMISSENEIVPLSQKIYPAKAKGMVEKWLLQVEENMLSSMRQVIRDGIDGYVEVP--RKQWVLQWPGQVVICVSSIYWTKEVSEAIAE-----GTLPAFLEKSNQQI--GEIVELVRGKLSSGARATLGALTVIDVHARDVVAKLAQDKVSNLSDFQWISQLRYSWEGQ--DVMVKMITTEVKYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRNMK-TFFFEGTELTLNPTCSVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYDLFIQALKDNIAKLKLQPVPWFIGKIIQIYEMMLVRHGFMIVGDPMGGKTCAYKVLSGALDDLHAAN-SMDEYAVELKVINPKAITMGQLYGCFDPVSHEWTDGVLATTFREQASSTTDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSAKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLQDSYMNTLPENLTSEHREMISDMFNWLLQPCLDFIRSECKFLVFTSPIHLAYSMMRLYTCLLDEIVNSSEEGNEPMSSQQITLWLQGLFLFSVVWTIGGTINTDSRKKFDIFYRNLLMGLDEHHPRPKSVKLTKNNLFPEKGSVYDFYFHKQASGQWNMWTDYITKEELIIPTTAKVSDLIIPTMETARQTFFLKTYLEHSVPMLFVGPTGTGKSAITNSFLIKLPKNKYVANSINFSARTSANQTQDIIFSKLDRRRKGQFGPPVGKQAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGHWYDRKDTSRLDILDVLFVSAMGPPGGGRNDITGRFTRHLNIVTIDAFDDETLTKIFGSIADWHFSKGFDIAFLRTGKLMIQATMAIYKAAVENFLPTPSKSHYVFNLRDFSR 2183          

HSP 2 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 519/1261 (41.16%), Postives = 758/1261 (60.11%), Query Frame = 3
Query: 8151 FERYKQRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLF----DQTFHNICP-------NKQSPIFGDYM---SSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDG--IEDTTQSIFTYLIDRVRGNMHV-VLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPT---------------WAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIG-TYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQME-GKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            F R  + +L     +    + + RLWIHE +RVF DR++  +D+  F  ++ E   + F    D+   ++ P       N +S  FGDY    S T  Y++ITD++ L   M+  L+EYNN      M LV+FR AIEHIS+I RV++Q  G++LLVGIGGSGRQS T+LA +M  +  FQIE++K+Y   E+RDD+K++  QAGV  K T+FLF D Q+ DE F+EDIN +L++G+IPN++  DE  ++  ++   A+ +G  IE T  +++ + I++V+ N+    L MSP+G+ FRNR+RMFP+ +NC TIDWF  WP DAL  VA ++L+D+ L     +D ++  + ++      +V  MS R  + ++RHNYVTPT+YLEL+  +K LL  KR+++    N+   GL K++   ++V VM  EL   + +L     E +  ++ I ++  E D + + V   ++      A    +++    DLA+AMPALEAA+ AL++LN+ DIT +KS   PPA V+ VME++ +++  +P                W  +KK LG+  F+  L  FDKDNIS   +KKI   ++   DFQP ++  VS A + LC WV AMEVY RV +VV PKR+RL+ AE  L  +  QL   +A+L AV + ++ L  E ++   +K EL    E   + L RA KL+SGL GEKDRW +    L  +   L GD L++S  ++Y+G F  DYR     +W    K+++IP +  FS    L +P ++R W I GLP D FSV+NG+IV+   R+PLM+DPQ QA KWIK ME   KL VI L    + R LE AIQFG PVLL+N+ E++D  L+P+L K   K  G   ++LG+  IEY+ DFR Y+TT+L NPHY PE++ K C++NF +   GL+ QLLGIV  KE+PELEE+K+ L++  AA K++L E+ED+IL +L+ +QG++L+DE  +  L +SK+ S E++E+ QIA  TE  ID  R GY   A  +SI+FF ++DL  I+PMYQ++L  +I+L+  S+  S KS    ERI N+  + T ++Y   CR LFEK KLLFS  +   I++   K+N D + F L GGV LD  N   NP   WLSD++W  I     L    G +   +     W   Y S  P+   LP +W    N   R++++R LRPD++      FI  N+G KF+EPP  D+    +DS+    LIFVLSPG
Sbjct: 2181 FSRVVRGVLLCPHTHLQDSDKLIRLWIHEVYRVFYDRLIDPEDRQVFFNMVKETTSNCFKQSVDKALSHLAPTGKVVDDNIRSLFFGDYFKPDSDTKIYDEITDLKHLTSVMEHYLEEYNNV-SKAPMSLVMFRFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFMNSFELFQIEITKNYTISEWRDDVKKVMLQAGVAGKNTVFLFCDNQIKDEGFVEDINMLLNTGDIPNIFPADEKAEIVEKMQAIARTEGRKIEATPLAMYNFFIEKVKANLSFFALSMSPIGDAFRNRLRMFPSLINCCTIDWFQTWPTDALEMVANKFLEDVAL-----DDDIRKEVVSMCKYFQETVKQMSDRYYNTLRRHNYVTPTSYLELILTFKTLLNSKRQEVETMRNRYMVGLEKLEFASSQVSVMQKELTALQPELIKTSAETEKMMIKIEKETIEVDAKKELVSADEKVANEAAAASKAIKDECEGDLAEAMPALEAALSALDTLNQSDITLVKSMTNPPAPVKLVMESICVMKAIKPDRKPDPSGTGKMVEDFWGPSKKVLGDLKFLDGLKAFDKDNISPAVMKKIREKFIDNPDFQPSVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLKEAEGKLFIQMQQLNTKRAELKAVEDRLQALNDELSDMNNKKMELENNIELCSQKLVRAEKLISGLGGEKDRWTEAARLLGIRYNNLTGDVLLSSGTVAYLGAFTVDYRHECQNQWQILCKEKKIPCSDDFSLSSTLGDPVKVRAWQIAGLPVDSFSVDNGIIVSNSRRFPLMIDPQGQANKWIKNMEKANKLFVIKLSDASYTRTLENAIQFGNPVLLENLGEEIDAVLEPLLLKQTFKQQGVEYIRLGENIIEYSKDFRLYMTTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAANKKQLKEIEDKILEVLSSSQGNILEDETAIKVLSSSKLLSEEISEKQQIASATEKEIDSTRMGYKPVAVHSSIIFFCISDLANIEPMYQYSLTWFINLYIHSLAHSEKSENLHERIENIIGHFTISIYNNVCRSLFEKDKLLFSLLLTIGIMKGEDKINDDVWRFLLTGGVALD--NPYPNPASLWLSDKSWAEIVRASNLEPLSGFMNHVKDNISKWKTIYDSLKPQDEKLPDKWQE-LNGINRLVVLRCLRPDKMVPAVQEFISENMGKKFIEPPTFDLAGSYNDSNCCAPLIFVLSPG 3432          

HSP 3 Score: 72.7886 bits (177), Expect = 0.000e+0
Identity = 42/180 (23.33%), Postives = 91/180 (50.56%), Query Frame = 3
Query: 3993 ENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNW--EIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            E +W  A  +     +W +G F +L   ++     + +R   K S+   D      + E  + ++D+F+  +P+I+ + N  ++ RHW QI + +       + D +L  +++    ++ E + ++  +A+KE ++E AL+ M+  W ++    I +  +E +  +LS +DD+   LDD+
Sbjct:  776 EQLWITAYNFHCKSEEWMNGAFQDLNAEDITEEVGNMWRNMYKLSKTFADMAGPKRVAENMKIKIDKFKMHLPIISVICNRGIKKRHWEQISDVVGYDI-TPAPDTSLLNMLEYGLSKYIERLEQIGASASKEYSLEKALEKMKSEWSNINFVFIRY--RETSTSILSAVDDIQLLLDDH 952          
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 1803.88 bits (4671), Expect = 0.000e+0
Identity = 852/1214 (70.18%), Postives = 1010/1214 (83.20%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKL--MSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  MK SRFVK FE +VD WER LS I E +EM+LTVQRQW+YLENIFLGEDIRKQLP ESA FD++N  W+ IM  +N+  NA       GLLET   MN  LEDIQKSLDMYLETKR+IFPRFYF+SNDDLLEILGQS+NP+ V PHLKKCFDNI  LKI+K+   S  +EA  MFS DGE + F   + LEGPVE+WL D+E+ MR+TLRDLLR+CR+ALKK  +KRDKW+K+W+GQ+ IT+SQIQWTADVTK L    +R+DKK L++       +L K+SEAIR NLTKI RLKI +LV IE+H RD++EKLYKSG  D+++F+WLSQLRFYWEK++DDC+I+QTNT FQYGYEYLGNSGRLVITPLTDRCY+TLTTALHLHRGGSPKGPAGTGKTETVKDLGK+LG YVIVVNCSEGLDYKSMGRM+SGLAQ+GAWGCFDEFNRINIEVLSVVAQQILSILSAL +N   +F F+G  I+LV S GIFITMNPGYAGRTELP+NLKSMFRPIAMV PDS +IAEI LF EGF  CK+LAKKV+TLYSL++QQLS+QDHYDFGLRAL S+LRYAG+K+R  P + DEE+LLLSM DMN+AKLTSVD+PLF  IV DLFP I+ PV+DY  +++ IE+      LQ T FT+TKV+QLYETK SRHS MIVG T S K+T+W++LQ++L  L +  E  +    EFPLNPK++SLGELYGE+DLNTNEWTDG+LSSVMR  CAD +PDEKWI+FDGPVDTLWIESMNSVMDDNK+LTLINGERI+MPEQVSLLFEVENL+VASPATVSRCGMVY D  DLGW+PYV+SWL+++  +  VE L RMF+K+I KI +F K NC EL+     + +ISLCKL+  LAT ENG +P+D +NYS ++E+ F F MIWS+C SVDEDGRKKID+Y+RE+EG+FPNKDT+YEY+V+ K ++W  ++EKL   W+Y  + PFYKI+VPTVDTVRYNYLV  LV N +PV+LVGPVGTGKTS+A + L  L +  W++L +NMSAQT+SNNVQ IIE+RVEKRTK  +VP GGK M+TFMDD NMPAKD FGSQPPLELIR WIDYGFWYDR+KQ+ K I+DM+L  AMGPPGGGR +IS RLQSRFN+INMTFPTES + RIFG+MINQKLQDFEEE+KPIG+++T+AT+++YN VV +FLPTP KIHYLFNLRDISK
Sbjct: 1445 LSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWAGQVVITASQIQWTADVTKCLMTAKERSDKKILKVS------ILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLT-RFYFEGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVREFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEKRPKTE-VEPLQRMFEKFINKILSFKKDNCNELVPVPEYSGIISLCKLYTVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLREIEGSFPNKDTVYEYYVNPKMRTWTSFEEKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQSIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISK 2650          

HSP 2 Score: 1749.95 bits (4531), Expect = 0.000e+0
Identity = 834/1224 (68.14%), Postives = 1021/1224 (83.42%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q MLR NKD+HDTK SITRLWIHE FRVF+DR+V   D  AF+ +LS+KLG+ FD TFH++CPNK+ PIFGD++     YED+ D+  LK  M+  L+EYN +P VV M LVLFR+AIEHI++I+RVI QPRGNMLLVGIGGSGRQSL RLA+ +C+Y +FQIEV+KHYRKQEFRDD+KRLY QAGV+ + T FLF DTQ+ DESFLEDINNILSSGE+PNLYK DE ++++N + D+A+ + I +++ S+F YLI+RVR N+H+VLC+SPVG+PFRN IR +PA VNCTTI+WFSEWP +ALLEVAE+Y+  + L   G ++ +   +A IF  MH SV+  SQ+ML E++R+NYVTPTNYLELVSGYK LL EKR++L D ANKL+ GL KIDETR KVEVMS+ELE+A+KK+A FQK+C++YLV+IVQQKREAD+Q K+V    E+I ++E KC  + + A  DL +A+PALE AM+ALESLNKKDI EIKSYG+PPA V+ VM+AVMILRG EPTWAEAK+ LGEQ+FIK LINFDKDNISD+ LKKIG Y AQ DFQPD++G+VSLAAKSLCMWV AME+YGR+YRVVEPKR R+ AA + L+EKQA LA AQ KL  V E+++ L+++Y+EK+ QKEELRKK+E  E  L+RA  LVSGLAGEK RWE+TV  LE  +G L GDCLIA+AFLSYMGPFL++YR+ ++ + W   I++ Q+P +P F+   FL+NPT++RDWNIQGLP D FS ENG+IVTRG+RW LM+DPQ QA KWIK MEG + LK+IDL M D++RVLE AIQFG PVLLQNVQE LDP+L+P+LNKS+ +IGG  ++++GDKE+EYN +FRFY+TTKL NPHY PE S KT IVNFAVKEQGLEAQLLGIVVRKERPELEEQKD+LV++IAAGKRKL ELEDEILRLLNEA GSLLDD QLVNTLQTSKIT+TEVTEQL+ +E TE  ID+AR+ Y  CAQRAS+LFFVLND+G+IDPMYQF+LDAYI LF +SI+KS +S K ++RI  LNDYHTYAVY Y CR LFE+HKLLFSF +CAKIL+TSGK+NMDEYNFFL+GGVVLDRE QMDNPC  WL+D  WDNI+ELDKL NFHGL+ SFEQYPRDW+LWYT+ SPE + LPGEW+NA NE QRMLIVRSLR DRV+FC TSFI++NLG++F+EPPVL+MK V++DS+ ++ L+F+LSPG
Sbjct: 2653 QGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGDFLKEPKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDL---GTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPG 3873          

HSP 3 Score: 918.302 bits (2372), Expect = 0.000e+0
Identity = 455/1027 (44.30%), Postives = 679/1027 (66.11%), Query Frame = 3
Query: 1485 EICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQ------MRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKL-KKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            ++CECQ HFAR+EDG +  +P F GA+G ++   +L+IE +F  N++ LR  +  ILDVK TSWH+DYN+FR G+KDLEVMTQN IT+AFE V  ++ G+ +LD F  L  RE I RT +K    +      E  LV +EL  +       P + +Y+G A W R LR+RI+R M  L  A FLP   +  +    Y Q++ A++E+VRKT  E+ + LD+D ++ LD++LL  S    GMLD+NF + LL LF E+ YWERL F+ PHY  ++  R  +LRI RE++LLV RDYNRI+  L+ +E++LFKE+I+ LDKKI PGL K+ W+ KGA  +F+ +CR++A+++Q  V+++K +   I    + +S +L++ I   ++Y + EF ++Q  HR   ++KLV LH +++N M  +YE+F  D  +IQQ W LY  ++D   E+A RLNVK+SL EL+KAINGDG+  P+PLF+V + LQ         + F PTL  L ++V  +G +    +     + ++L K K+ ++ I+  +  D++I KIQ  I  GM + +S +Q  L  WD +REIWE+NK+ FI +Y  LNP V S DADI+RYTEV N     E ++ ++F+ LD S LK S+  HC +WQ K T LL  MA   L  LH+Y+K+ +EK+S  PQ LEELG S++L+D L  +  +++ +  P+ E F IL+KYEV   D +    ++L  EW  F Q L+++EQM+KK K+KFKTGL+  +DDFKK+   L+ DF+  GPF +++    AL +IA  ++ L +++ +E  +R  L +FKIEQP SK++  LEK+LD ++ +W++  +WE +W QWK G F  L+T  ME++A+  FR+ T+ +++ KD+NWEIIE TR++++QF+RTMPLI+DLRN A+R+RHW Q+K E++++FD+ES  FTLE+I+ L  DQH E I E+S +ATKELAIE  L+ + K W+S +L+I+P+KD  K H  L G ++++Q L+DN+  LS 
Sbjct:  425 KVCECQYHFARWEDGKQGPLPCFFGAQGPQITRNLLEIEDIFHKNLQTLRAVRGGILDVKNTSWHEDYNKFRGGIKDLEVMTQNLITSAFELVRDVEHGVLLLDTFHRLATREAIMRTYEKKAVDLYMLFNSELALVNREL--NKKWPYLEPYMTQYSGQAHWVRILRRRIDRVMNCLSGAHFLPHIGTGEESIHTYQQMAQAIDEMVRKTFQEWTATLDKDCIRRLDMSLLRISQEKVGMLDVNFDKTLLILFAEIDYWERLLFETPHYVMNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRFLDKKIHPGLKKLNWALKGASAFFITECRMHASKVQMIVNDFKASTLTIGWKAQEMSELLLVHITGKQVYRDLEFEEAQREHRMAAQQKLVKLHQDVVNIMTNSYEVFKNDGPEIQQQWLLYTIRLDHMMEDALRLNVKWSLLELSKAINGDGKTTPNPLFRVLVILQNDVRGGGSQVEFSPTLQTLASVVNDIGSHLFATISVFRHLPDILTKRKMNREPIYVLVERDEDIRKIQAQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIRRYQRLNPPVSSFDADIARYTEVANNVQKEETVLNIQFVMLDCSHLKFSLVQHCNEWQNKFTTLLKEMAAGRLADLHSYLKDNAEKISHPPQTLEELGVSLQLMDTLQHDLPNLETQIPPIHEQFTILEKYEVPVPDTVLEMLESLNGEWLTFQQILLDSEQMLKKHKEKFKTGLIHAADDFKKKAHNLLEDFEFKGPFTSTVGHTAALDQIAQMRAMLMAMRDEENNLRSNLGIFKIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKD--KGHHRLRGTEEVFQALEDNQVALST 1447          

HSP 4 Score: 294.278 bits (752), Expect = 1.295e-78
Identity = 155/317 (48.90%), Postives = 207/317 (65.30%), Query Frame = 3
Query:  306 RIRLSGYVEIENWTADHALQ----VQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKM 1244
            R  L+G  +   WT +H +     VQD  V +    L  ++    GL+L+   P    N++VYFI++       I  ENF + +Q+GTV G  I +LLR++ G+Y P  F N  WP+SI+N F   L RF+++LTD R+KLEG TVLYIPAEA     E   K+K+ + R+E  MIHWTRQIKEVLSAQ + E  E+ GPL+EIE+W NRC DLS ISKQL K GVKHI  IL  AKSSY+  F KLA +I+  ++QAQSNL FL+ L++   +L+  KP+DI   L KLI+ IR+IWVNS HYN+R+ +T +FRK+
Sbjct:  118 RTMLTGLAD-ATWTGEHDMVLEHFVQDPAVPA----LTIFIDPVFGLKLELGMPVQTQNQIVYFIRQAPVP---ITPENFEETVQYGTVRGAYIPALLRLLSGVYVPQIFMNKSWPESIRNHFVSHLHRFLASLTDTRYKLEGHTVLYIPAEAVQMDPEVVVKDKELVQRLETSMIHWTRQIKEVLSAQESVETGENLGPLEEIEFWHNRCMDLSSISKQLVKKGVKHIESILFLAKSSYLTPFRKLAQQIQDGSRQAQSNLTFLSILREPYQELAFMKPKDISEKLPKLISLIRIIWVNSPHYNTRERLTALFRKV 426          
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 1801.56 bits (4665), Expect = 0.000e+0
Identity = 857/1214 (70.59%), Postives = 1015/1214 (83.61%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKL--MSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  MK SRFVK FE +VD WER LS I E +EM+LTVQRQW+YLENIFLGEDIRKQLP ESA FD++N  W+ IM  +N+  NA       GLLET   MN  LEDIQKSLDMYLETKR+IFPRFYF+SNDDLLEILGQS+NP+ V PHLKKCFDNI  LKI+K+   S  +EA  MFS DGE + F   + LEGPVE+WL D+E+ MR+TLRDLLR+CR+ALKK  +KRDKW+K+W+GQ+ IT+SQIQWTADVTK L    +R+DKK L++MKKKQ  +L K+SEAIR NLTKI RLKI +LV IE+H RD++EKLYKSG  D+++F+WLSQLRFYWEK++DDC+I+QTNT FQYGYEYLGNSGRLVITPLTDRCY+TLTTALHLHRGGSPKGPAGTGKTETVKDLGK+LG YVIVVNCSEGLDYKSMGRM+SGLAQ+GAWGCFDEFNRINIEVLSVVAQQILSILSAL +N   +F F+G  I+LV S GIFITMNPGYAGRTELP+NLKSMFRPIAMV PDS +IAEI LF EGF  CK+LAKKV+TLYSL++QQLS+QDHYDFGLRAL S+LRYAG+K+R  P + DEE+LLLSM DMN+AKLTSVD+PLF  IV DLFP I+ PV+DY  +++ IE+      LQ T FT+TKV+QLYETK SRHS MIVG T S K+T+W++LQ++L  L +  E  +    EFPLNPK++SLGELYGE+DLNTNEWTDG+LSSVMR  CAD +PDEKWI+FDGPVDTLWIESMNSVMDDNK+LTLINGERI+MPEQVSLLFEVENL+VASPATVSRCGMVY D  DLGW+PYV+SWL+++  +  VE L RMF+K+I KI +F K NC EL+     + +ISLCKL+  LAT ENG +P+D +NYS ++E+ F F MIWS+C SVDEDGRKKID+Y+RE+EG+FPNKDT+YEY+V+ K ++W  ++EKL   W+Y  + PFYKI+VPTVDTVRYNYLV  LV N +PV+LVGPVGTGKTS+A + L  L +  W++L +NMSAQT+SNNVQ IIE+RVEKRTK  +VP GGK M+TFMDD NMPAKD FGSQPPLELIR WIDYGFWYDR+KQ+ K I+DM+L  AMGPPGGGR +IS RLQSRFN+INMTFPTES + RIFG+MINQKLQDFEEE+KPIG+++T+AT+++YN VV +FLPTP KIHYLFNLRDISK
Sbjct: 1445 LSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWAGQVVITASQIQWTADVTKCLMTAKERSDKKILKVMKKKQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLT-RFYFEGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVREFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEKRPKTE-VEPLQRMFEKFINKILSFKKDNCNELVPVPEYSGIISLCKLYTVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLREIEGSFPNKDTVYEYYVNPKMRTWTSFEEKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQSIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISK 2656          

HSP 2 Score: 1749.56 bits (4530), Expect = 0.000e+0
Identity = 834/1224 (68.14%), Postives = 1021/1224 (83.42%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q MLR NKD+HDTK SITRLWIHE FRVF+DR+V   D  AF+ +LS+KLG+ FD TFH++CPNK+ PIFGD++     YED+ D+  LK  M+  L+EYN +P VV M LVLFR+AIEHI++I+RVI QPRGNMLLVGIGGSGRQSL RLA+ +C+Y +FQIEV+KHYRKQEFRDD+KRLY QAGV+ + T FLF DTQ+ DESFLEDINNILSSGE+PNLYK DE ++++N + D+A+ + I +++ S+F YLI+RVR N+H+VLC+SPVG+PFRN IR +PA VNCTTI+WFSEWP +ALLEVAE+Y+  + L   G ++ +   +A IF  MH SV+  SQ+ML E++R+NYVTPTNYLELVSGYK LL EKR++L D ANKL+ GL KIDETR KVEVMS+ELE+A+KK+A FQK+C++YLV+IVQQKREAD+Q K+V    E+I ++E KC  + + A  DL +A+PALE AM+ALESLNKKDI EIKSYG+PPA V+ VM+AVMILRG EPTWAEAK+ LGEQ+FIK LINFDKDNISD+ LKKIG Y AQ DFQPD++G+VSLAAKSLCMWV AME+YGR+YRVVEPKR R+ AA + L+EKQA LA AQ KL  V E+++ L+++Y+EK+ QKEELRKK+E  E  L+RA  LVSGLAGEK RWE+TV  LE  +G L GDCLIA+AFLSYMGPFL++YR+ ++ + W   I++ Q+P +P F+   FL+NPT++RDWNIQGLP D FS ENG+IVTRG+RW LM+DPQ QA KWIK MEG + LK+IDL M D++RVLE AIQFG PVLLQNVQE LDP+L+P+LNKS+ +IGG  ++++GDKE+EYN +FRFY+TTKL NPHY PE S KT IVNFAVKEQGLEAQLLGIVVRKERPELEEQKD+LV++IAAGKRKL ELEDEILRLLNEA GSLLDD QLVNTLQTSKIT+TEVTEQL+ +E TE  ID+AR+ Y  CAQRAS+LFFVLND+G+IDPMYQF+LDAYI LF +SI+KS +S K ++RI  LNDYHTYAVY Y CR LFE+HKLLFSF +CAKIL+TSGK+NMDEYNFFL+GGVVLDRE QMDNPC  WL+D  WDNI+ELDKL NFHGL+ SFEQYPRDW+LWYT+ SPE + LPGEW+NA NE QRMLIVRSLR DRV+FC TSFI++NLG++F+EPPVL+MK V++DS+ ++ L+F+LSPG
Sbjct: 2659 QGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGDFLKEPKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDL---GTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPG 3879          

HSP 3 Score: 917.916 bits (2371), Expect = 0.000e+0
Identity = 455/1027 (44.30%), Postives = 679/1027 (66.11%), Query Frame = 3
Query: 1485 EICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQ------MRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKL-KKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            ++CECQ HFAR+EDG +  +P F GA+G ++   +L+IE +F  N++ LR  +  ILDVK TSWH+DYN+FR G+KDLEVMTQN IT+AFE V  ++ G+ +LD F  L  RE I RT +K    +      E  LV +EL  +       P + +Y+G A W R LR+RI+R M  L  A FLP   +  +    Y Q++ A++E+VRKT  E+ + LD+D ++ LD++LL  S    GMLD+NF + LL LF E+ YWERL F+ PHY  ++  R  +LRI RE++LLV RDYNRI+  L+ +E++LFKE+I+ LDKKI PGL K+ W+ KGA  +F+ +CR++A+++Q  V+++K +   I    + +S +L++ I   ++Y + EF ++Q  HR   ++KLV LH +++N M  +YE+F  D  +IQQ W LY  ++D   E+A RLNVK+SL EL+KAINGDG+  P+PLF+V + LQ         + F PTL  L ++V  +G +    +     + ++L K K+ ++ I+  +  D++I KIQ  I  GM + +S +Q  L  WD +REIWE+NK+ FI +Y  LNP V S DADI+RYTEV N     E ++ ++F+ LD S LK S+  HC +WQ K T LL  MA   L  LH+Y+K+ +EK+S  PQ LEELG S++L+D L  +  +++ +  P+ E F IL+KYEV   D +    ++L  EW  F Q L+++EQM+KK K+KFKTGL+  +DDFKK+   L+ DF+  GPF +++    AL +IA  ++ L +++ +E  +R  L +FKIEQP SK++  LEK+LD ++ +W++  +WE +W QWK G F  L+T  ME++A+  FR+ T+ +++ KD+NWEIIE TR++++QF+RTMPLI+DLRN A+R+RHW Q+K E++++FD+ES  FTLE+I+ L  DQH E I E+S +ATKELAIE  L+ + K W+S +L+I+P+KD  K H  L G ++++Q L+DN+  LS 
Sbjct:  425 KVCECQYHFARWEDGKQGPLPCFFGAQGPQITRNLLEIEDIFHKNLQTLRAVRGGILDVKNTSWHEDYNKFRGGIKDLEVMTQNLITSAFELVRDVEHGVLLLDTFHRLATREAIMRTYEKKAVDLYMLFNSELALVNREL--NKKWPYLEPYMTQYSGQAHWVRILRRRIDRVMNCLSGAHFLPHIGTGEESIHTYQQMAQAIDEMVRKTFQEWTATLDKDCIRRLDMSLLRISQEKVGMLDVNFDKTLLILFAEIDYWERLLFETPHYVMNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRFLDKKIHPGLKKLNWALKGASAFFITECRMHASKVQMIVNDFKASTLTIGWKAQEMSELLLVHITGKQVYRDLEFEEAQREHRMAAQQKLVKLHQDVVNIMTNSYEVFKNDGPEIQQQWLLYTIRLDHMMEDALRLNVKWSLLELSKAINGDGKTTPNPLFRVLVILQNDVRGGGSQVEFSPTLQTLASVVNDIGSHLFATISVFRHLPDILTKRKMNREPIYVLVERDEDIRKIQAQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIRRYQRLNPPVSSFDADIARYTEVANNVQKEETVLNIQFVMLDCSHLKFSLVQHCNEWQNKFTTLLKEMAAGRLADLHSYLKDNAEKISHPPQTLEELGVSLQLMDTLQHDLPNLETQIPPIHEQFTILEKYEVPVPDTVLEMLESLNGEWLTFQQILLDSEQMLKKHKEKFKTGLIHAADDFKKKAHNLLEDFEFKGPFTSTVGHTAALDQIAQMRAMLMAMRDEENNLRSNLGIFKIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKD--KGHHRLRGTEEVFQALEDNQVALST 1447          

HSP 4 Score: 294.664 bits (753), Expect = 1.263e-78
Identity = 155/317 (48.90%), Postives = 207/317 (65.30%), Query Frame = 3
Query:  306 RIRLSGYVEIENWTADHALQ----VQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKM 1244
            R  L+G  +   WT +H +     VQD  V +    L  ++    GL+L+   P    N++VYFI++       I  ENF + +Q+GTV G  I +LLR++ G+Y P  F N  WP+SI+N F   L RF+++LTD R+KLEG TVLYIPAEA     E   K+K+ + R+E  MIHWTRQIKEVLSAQ + E  E+ GPL+EIE+W NRC DLS ISKQL K GVKHI  IL  AKSSY+  F KLA +I+  ++QAQSNL FL+ L++   +L+  KP+DI   L KLI+ IR+IWVNS HYN+R+ +T +FRK+
Sbjct:  118 RTMLTGLAD-ATWTGEHDMVLEHFVQDPAVPA----LTIFIDPVFGLKLELGMPVQTQNQIVYFIRQAPVP---ITPENFEETVQYGTVRGAYIPALLRLLSGVYVPQIFMNKSWPESIRNHFVSHLHRFLASLTDTRYKLEGHTVLYIPAEAVQMDPEVVVKDKELVQRLETSMIHWTRQIKEVLSAQESVETGENLGPLEEIEFWHNRCMDLSSISKQLVKKGVKHIESILFLAKSSYLTPFRKLAQQIQDGSRQAQSNLTFLSILREPYQELAFMKPKDISEKLPKLISLIRIIWVNSPHYNTRERLTALFRKV 426          
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Match: Dnah6 (dynein, axonemal, heavy chain 6 [Source:MGI Symbol;Acc:MGI:107744])

HSP 1 Score: 1045.03 bits (2701), Expect = 0.000e+0
Identity = 541/1240 (43.63%), Postives = 786/1240 (63.39%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKI-----------------EKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASK-RDKW-IKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQ--FEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLK---RKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPS-DTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM-----EGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDI-WTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            + +SR+V P +  VD W++ LS   +T+E  L  QR WLYLE+IF   DI++QLP E+  F +++K W+ IM ++N++ NA     + GLLETF   N  L+ IQK L+ YLE+KR IFPRFYF+SND+LLEIL Q++NP  V PHL+KCFD+I+ L+                  EK+ +    A  M S +GE V   + L+  G VE WL  +E+ M  +LR L   C+ A+     K R +W I     Q+ +T SQI W  D+T++L+   + ++   L   ++     L   +  +R NL K+ R  I +L+ I+VH RDI+ +L ++     ++F+W  QLR+YW+ ++D+CV +   + + Y YEYLG   RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK MGR FSGLAQ+GAW CFDEFNRI+IEVLSV+AQQ+++I +A A+    +FMF+GR I LV +   FITMNPGYAGRTELPDNLK++FRP+AM+ P+ A+IAE+ L++EGF   K+LA+K+  +Y L  +QLS+QDHYDFG+RA+ SVL  AG  KR NP + ++ +L+ ++ D NL K  + D  LF GI+SDLFPG+  P  DY  ++  I +   N  LQP    + KV+QLYET   RH VM+VG T  GK+T +++L   L  L K       ++    + LNPKS+++GELYGE +  T EW DG+++  +R    DT  D KWII DGPVD LWIE+MN+V+DDNK+L L N ERI +  Q+ +LFEV++L VASPATVSRCGMV+ D  +L W PYV++W++   +K++  + E L  +F++Y++   +F+   C + I     + V +LC L + L   ++G   S +    + V+   F FC +WS+  ++ E+     D +IR       +   P+   ++   +D   K    W E++   +KY+  VPF++++VPT DTVRY YL++ L+   H V+  G  G GK+ +A   LN++     +  + +N SAQTSS+  Q+IIE+++E++ K+     G K+++ F+DD NMP  D +GSQPP+EL+RQ+ D+G +YDR K   K I+D+ +  A  PPGGGR  ++ R    F+++ +  P+E +LK+IF +++N  L DF E +K     I +A +E+YN + +  LPTP K HY+FNLRD+SK
Sbjct: 1067 IASSRYVGPLKSRVDDWQKQLSLFNQTLEEWLNCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPTEGKIPGMDTEPEKVFTNDILA--MLSPEGERVGLGKGLKARGNVEEWLGKVEEAMFTSLRRL---CKAAIADYQGKPRTEWVIAGHPSQVILTISQIMWCRDLTESLE--CEGDNVDALEDFEQVNFERLNALAAIVRGNLPKLHRNIITALITIDVHARDIVSELVQAKVDSADSFDWQRQLRYYWDMDLDNCVARMALSQYTYAYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKL-SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLSEDVVLIRALRDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVEVMINQNLQPELCMVKKVIQLYETMLVRHGVMLVGPTGGGKTTVYQVLAETLGNLEKLNTDNPFYQPVKTYVLNPKSITMGELYGEVNNVTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMRTMSKKLNDEVQEYLLNLFNRYVDDGLHFVNKKCTQAIPQVDISKVTTLCCLLESLLLSKDGNILSMEQMKLNTVLCQTFVFCYLWSLGGNLTENYWDSFDTFIRTQFDDNPDARLPSSGDLWSIHIDFDTKRLDPW-ERIIPTFKYSRDVPFFEMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVIAKGLLNRIQESAGYVPVYLNFSAQTSSSRTQEIIESKLERKRKNILGAPGNKQVVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIVSACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLADFPEAVKQTSSNIVEAAVEIYNRMSVDLLPTPAKSHYVFNLRDLSK 2297          

HSP 2 Score: 964.911 bits (2493), Expect = 0.000e+0
Identity = 526/1230 (42.76%), Postives = 776/1230 (63.09%), Query Frame = 3
Query: 8214 ITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMS-----STDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGI-EDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECD-DYLVVIVQQKREADDQAKSVMQTQERI-KVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDK-LANFHGL------------ITSFEQY--PRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            I RL+ HE  RVF DR++ ++DK  F  +L+E     F           +  IFGD++      S   Y+D+ D+EK++  +++ LD+YN T    ++ LV F+DAIEH+S+I R+IRQ RGN LLVG+GG+G+QSLTRLAA++C Y   QIE+S+ Y    F +DL++LY  AGV++K  +FLF DTQ+V E FLEDINNIL+SGE+PNL+++DE++ +      +AK  GI E     +F Y I RVR  +H+VLCMSPVGE FR+R RMFP+ VNC TIDWF +WP +ALL V++ +   +     G +D ++  L+ +   +H SVS M++R  +E++R  Y TPT+YLEL++ Y  +L EKRKQL  + +++KNGL K+ ET   V+ M ++L        + QK  D + L+  +   +E+ DQ ++V+Q  E I KV   +   + + A  DL +A+PALEAA +AL+SL+K DI+EI+ + KPP LV  VMEA+ IL  A+P W  AK+ LG+ +F+++L+ +DK+NI  + L K+  Y+   DF P+ V KVS A KS+CMWV AM++Y RV + VEPKRQ+L+AA++ L    A L   QA L  V +++K LQ +Y + + +KE L K    T+  L RA KL + L  E+ RWE+++   + ++  + G+  IA+A ++Y G F + YR+ L+  W E+    +IP +PSFS I  L +P +IR WN  GLPRD  S ENG++VT+G RWPLM+DPQ QA +WI+  E K  LKVI L   +F+R+LE +I+ G PVLL+ ++E LDP+L+PIL K     GG  ++ LGD +I+Y+  FRFY+T+K+PNPHY PE+  K  I+NF V + GLE QLL  VVR E+PELEEQ+  L++ I + K +L  +ED+IL+LL  ++G++LD+E+L++TLQ SKITS  +  +L+ AE TE  I+IAR+ Y   A + S+++FV+  L +IDPMYQ++L  +  LFN +I  S KS    ER+  L        Y    RGLFE+HKL++SF +C  I++   ++   E+NFFL+G   +++E       P WL  Q W +  +L++    F GL            + SFE Y  P  W  +      E       W    + F ++++V+  + ++V F  T F+I NLG +F+E P +D+  +  D S  T L+F+LS G
Sbjct: 2316 IFRLFCHECQRVFHDRLINNEDKHYFHLILTEMANKHFGIAIDLEYFLSKPIIFGDFIKFGAEKSDRIYDDLPDMEKIENVLQDYLDDYNLT-NPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCMQIELSRGYNYDNFHEDLRKLYKMAGVEDKDMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDELEHVLAATRPKAKEVGISEGNRDEVFQYFISRVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKSFFSSVD---TGNDD-LREKLSLMCVNVHLSVSHMAERYYNELRRRYYTTPTSYLELINLYLTMLTEKRKQLVSARDRVKNGLTKLLETNVLVDKMKLDLSALEP--VLLQKSQDVEALMEKLVVDQESADQVRNVVQEDEAIAKVKAEETQAIADDAQRDLEEALPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDWPTAKQLLGDSNFLRRLLEYDKENIKPQILLKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKEVEPKRQKLRAAQAELDATMATLKEKQALLKQVEDQIKTLQDKYEKGVNEKESLAKNMALTKARLIRAGKLTAALGDEQVRWEESIEKFQEELANIVGNVFIAAACVAYYGAFTAQYRQLLIEWWIESCLALEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKVIKLTDTNFLRILENSIRLGLPVLLEELREVLDPALEPILLKQTFMSGGRLLIHLGDSDIDYDKSFRFYMTSKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRIQLIVRINSDKNQLKSIEDKILKLLFTSEGNILDNEELIDTLQDSKITSGAIKTRLKEAESTELMINIARERYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSEKSDNLHERLKILLQQTLLTAYTNVSRGLFEQHKLIYSFMLCVDIMREHEQLTEAEWNFFLRGSAGMEKERPPKPEAP-WLPIQMWFSCCDLEESFPIFEGLTKHILLRPISIKLGSFETYINPPVWEGYPKQRHEEEKD--HVWGLDFSSFHKLILVKCCKEEKVVFALTDFVIENLGKQFIETPPVDLATLYQDMSNSTPLVFILSTG 3535          

HSP 3 Score: 92.0485 bits (227), Expect = 2.091e-17
Identity = 110/559 (19.68%), Postives = 240/559 (42.93%), Query Frame = 3
Query: 2904 PLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGE-----------VLQKVKLKKS-----IWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKD--KNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            P+F   L L ++ L+F P+L +  + ++    +F   V  +P +             + +KV+ K       +      D     I   I+  +     S +     +++F+  ++ N+   +       P V    + + +Y +    ++       V  L +D   LK  +        + L ++L  ++ K +  + +  ++   K+  +P    E   S+  LD++ E    ++E+ + + + + ++++Y+V    +       ++        A+ ++    + S  +F   L    +D   +V+ + +  Q       S   ++    +++ +S L+ L+ +  + +     FK+E      +  +  +L   + +W    EW+    +W   +F     ++ E L NS   K  KF   L+       ++   + +V++ +  +P+I DLRN  ++ RHW  I+  +     +     TLE++ +L+    A+ I ++SG A+ E A+E  LK +E  W++ E  I+PH+D  K+ F+L G DD+   LDD+
Sbjct:  507 PMFLTELILTVQSLLFEPSLEDFLDGISGAINHFENTVLSVPNLVPDSYFDAFTSPFINKKVEEKTCGPGPNLSAVFEDDRNFLTIIMQIKETIHAAFDSARLYAATFEKFQLFFKENESLDLEALKQEEPDVQFFSSQLEKYHKQHKDSVALRPTRNVGLLLIDTKQLKEKLIPSPLRCLEVLNSMLPCLSKKKVDAIISEAQDAEYKLEFMPTTTIEYVNSLVFLDEIQERIETLEEEANVVVQMYKLIEQYQVPTPPEDFAVFATMKPSITAVRNAIDKSVGDRETSIKQFCLHLGRDLEDLNNEVNEVKLLAQDPQILDISADQEKIKTMLSDLQSVLDDLQKRAFQYKSYQKNFKVEVSKFDALEEVSAELRLKQLLWDSLSEWDNLQQEWLKSKF---DCLDPEVL-NSQVTKYAKFVTQLEKGLPPNSVVPQLKQKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDALLVDTEIPLTLERLSELHVFNFAQEIQDISGQASGEAALEIILKKVEDSWKTTEFVILPHRDS-KDVFILGGTDDIQVLLDDS 1060          
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Match: Dnah6 (dynein, axonemal, heavy chain 6 [Source:MGI Symbol;Acc:MGI:107744])

HSP 1 Score: 1045.03 bits (2701), Expect = 0.000e+0
Identity = 541/1240 (43.63%), Postives = 786/1240 (63.39%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKI-----------------EKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASK-RDKW-IKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQ--FEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLK---RKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPS-DTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM-----EGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDI-WTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            + +SR+V P +  VD W++ LS   +T+E  L  QR WLYLE+IF   DI++QLP E+  F +++K W+ IM ++N++ NA     + GLLETF   N  L+ IQK L+ YLE+KR IFPRFYF+SND+LLEIL Q++NP  V PHL+KCFD+I+ L+                  EK+ +    A  M S +GE V   + L+  G VE WL  +E+ M  +LR L   C+ A+     K R +W I     Q+ +T SQI W  D+T++L+   + ++   L   ++     L   +  +R NL K+ R  I +L+ I+VH RDI+ +L ++     ++F+W  QLR+YW+ ++D+CV +   + + Y YEYLG   RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK MGR FSGLAQ+GAW CFDEFNRI+IEVLSV+AQQ+++I +A A+    +FMF+GR I LV +   FITMNPGYAGRTELPDNLK++FRP+AM+ P+ A+IAE+ L++EGF   K+LA+K+  +Y L  +QLS+QDHYDFG+RA+ SVL  AG  KR NP + ++ +L+ ++ D NL K  + D  LF GI+SDLFPG+  P  DY  ++  I +   N  LQP    + KV+QLYET   RH VM+VG T  GK+T +++L   L  L K       ++    + LNPKS+++GELYGE +  T EW DG+++  +R    DT  D KWII DGPVD LWIE+MN+V+DDNK+L L N ERI +  Q+ +LFEV++L VASPATVSRCGMV+ D  +L W PYV++W++   +K++  + E L  +F++Y++   +F+   C + I     + V +LC L + L   ++G   S +    + V+   F FC +WS+  ++ E+     D +IR       +   P+   ++   +D   K    W E++   +KY+  VPF++++VPT DTVRY YL++ L+   H V+  G  G GK+ +A   LN++     +  + +N SAQTSS+  Q+IIE+++E++ K+     G K+++ F+DD NMP  D +GSQPP+EL+RQ+ D+G +YDR K   K I+D+ +  A  PPGGGR  ++ R    F+++ +  P+E +LK+IF +++N  L DF E +K     I +A +E+YN + +  LPTP K HY+FNLRD+SK
Sbjct: 1067 IASSRYVGPLKSRVDDWQKQLSLFNQTLEEWLNCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPTEGKIPGMDTEPEKVFTNDILA--MLSPEGERVGLGKGLKARGNVEEWLGKVEEAMFTSLRRL---CKAAIADYQGKPRTEWVIAGHPSQVILTISQIMWCRDLTESLE--CEGDNVDALEDFEQVNFERLNALAAIVRGNLPKLHRNIITALITIDVHARDIVSELVQAKVDSADSFDWQRQLRYYWDMDLDNCVARMALSQYTYAYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKL-SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLSEDVVLIRALRDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVEVMINQNLQPELCMVKKVIQLYETMLVRHGVMLVGPTGGGKTTVYQVLAETLGNLEKLNTDNPFYQPVKTYVLNPKSITMGELYGEVNNVTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMRTMSKKLNDEVQEYLLNLFNRYVDDGLHFVNKKCTQAIPQVDISKVTTLCCLLESLLLSKDGNILSMEQMKLNTVLCQTFVFCYLWSLGGNLTENYWDSFDTFIRTQFDDNPDARLPSSGDLWSIHIDFDTKRLDPW-ERIIPTFKYSRDVPFFEMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVIAKGLLNRIQESAGYVPVYLNFSAQTSSSRTQEIIESKLERKRKNILGAPGNKQVVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIVSACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLADFPEAVKQTSSNIVEAAVEIYNRMSVDLLPTPAKSHYVFNLRDLSK 2297          

HSP 2 Score: 964.911 bits (2493), Expect = 0.000e+0
Identity = 526/1230 (42.76%), Postives = 776/1230 (63.09%), Query Frame = 3
Query: 8214 ITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMS-----STDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGI-EDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECD-DYLVVIVQQKREADDQAKSVMQTQERI-KVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDK-LANFHGL------------ITSFEQY--PRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            I RL+ HE  RVF DR++ ++DK  F  +L+E     F           +  IFGD++      S   Y+D+ D+EK++  +++ LD+YN T    ++ LV F+DAIEH+S+I R+IRQ RGN LLVG+GG+G+QSLTRLAA++C Y   QIE+S+ Y    F +DL++LY  AGV++K  +FLF DTQ+V E FLEDINNIL+SGE+PNL+++DE++ +      +AK  GI E     +F Y I RVR  +H+VLCMSPVGE FR+R RMFP+ VNC TIDWF +WP +ALL V++ +   +     G +D ++  L+ +   +H SVS M++R  +E++R  Y TPT+YLEL++ Y  +L EKRKQL  + +++KNGL K+ ET   V+ M ++L        + QK  D + L+  +   +E+ DQ ++V+Q  E I KV   +   + + A  DL +A+PALEAA +AL+SL+K DI+EI+ + KPP LV  VMEA+ IL  A+P W  AK+ LG+ +F+++L+ +DK+NI  + L K+  Y+   DF P+ V KVS A KS+CMWV AM++Y RV + VEPKRQ+L+AA++ L    A L   QA L  V +++K LQ +Y + + +KE L K    T+  L RA KL + L  E+ RWE+++   + ++  + G+  IA+A ++Y G F + YR+ L+  W E+    +IP +PSFS I  L +P +IR WN  GLPRD  S ENG++VT+G RWPLM+DPQ QA +WI+  E K  LKVI L   +F+R+LE +I+ G PVLL+ ++E LDP+L+PIL K     GG  ++ LGD +I+Y+  FRFY+T+K+PNPHY PE+  K  I+NF V + GLE QLL  VVR E+PELEEQ+  L++ I + K +L  +ED+IL+LL  ++G++LD+E+L++TLQ SKITS  +  +L+ AE TE  I+IAR+ Y   A + S+++FV+  L +IDPMYQ++L  +  LFN +I  S KS    ER+  L        Y    RGLFE+HKL++SF +C  I++   ++   E+NFFL+G   +++E       P WL  Q W +  +L++    F GL            + SFE Y  P  W  +      E       W    + F ++++V+  + ++V F  T F+I NLG +F+E P +D+  +  D S  T L+F+LS G
Sbjct: 2316 IFRLFCHECQRVFHDRLINNEDKHYFHLILTEMANKHFGIAIDLEYFLSKPIIFGDFIKFGAEKSDRIYDDLPDMEKIENVLQDYLDDYNLT-NPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCMQIELSRGYNYDNFHEDLRKLYKMAGVEDKDMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDELEHVLAATRPKAKEVGISEGNRDEVFQYFISRVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKSFFSSVD---TGNDD-LREKLSLMCVNVHLSVSHMAERYYNELRRRYYTTPTSYLELINLYLTMLTEKRKQLVSARDRVKNGLTKLLETNVLVDKMKLDLSALEP--VLLQKSQDVEALMEKLVVDQESADQVRNVVQEDEAIAKVKAEETQAIADDAQRDLEEALPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDWPTAKQLLGDSNFLRRLLEYDKENIKPQILLKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKEVEPKRQKLRAAQAELDATMATLKEKQALLKQVEDQIKTLQDKYEKGVNEKESLAKNMALTKARLIRAGKLTAALGDEQVRWEESIEKFQEELANIVGNVFIAAACVAYYGAFTAQYRQLLIEWWIESCLALEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKVIKLTDTNFLRILENSIRLGLPVLLEELREVLDPALEPILLKQTFMSGGRLLIHLGDSDIDYDKSFRFYMTSKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRIQLIVRINSDKNQLKSIEDKILKLLFTSEGNILDNEELIDTLQDSKITSGAIKTRLKEAESTELMINIARERYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSEKSDNLHERLKILLQQTLLTAYTNVSRGLFEQHKLIYSFMLCVDIMREHEQLTEAEWNFFLRGSAGMEKERPPKPEAP-WLPIQMWFSCCDLEESFPIFEGLTKHILLRPISIKLGSFETYINPPVWEGYPKQRHEEEKD--HVWGLDFSSFHKLILVKCCKEEKVVFALTDFVIENLGKQFIETPPVDLATLYQDMSNSTPLVFILSTG 3535          

HSP 3 Score: 92.0485 bits (227), Expect = 2.091e-17
Identity = 110/559 (19.68%), Postives = 240/559 (42.93%), Query Frame = 3
Query: 2904 PLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGE-----------VLQKVKLKKS-----IWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKD--KNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            P+F   L L ++ L+F P+L +  + ++    +F   V  +P +             + +KV+ K       +      D     I   I+  +     S +     +++F+  ++ N+   +       P V    + + +Y +    ++       V  L +D   LK  +        + L ++L  ++ K +  + +  ++   K+  +P    E   S+  LD++ E    ++E+ + + + + ++++Y+V    +       ++        A+ ++    + S  +F   L    +D   +V+ + +  Q       S   ++    +++ +S L+ L+ +  + +     FK+E      +  +  +L   + +W    EW+    +W   +F     ++ E L NS   K  KF   L+       ++   + +V++ +  +P+I DLRN  ++ RHW  I+  +     +     TLE++ +L+    A+ I ++SG A+ E A+E  LK +E  W++ E  I+PH+D  K+ F+L G DD+   LDD+
Sbjct:  507 PMFLTELILTVQSLLFEPSLEDFLDGISGAINHFENTVLSVPNLVPDSYFDAFTSPFINKKVEEKTCGPGPNLSAVFEDDRNFLTIIMQIKETIHAAFDSARLYAATFEKFQLFFKENESLDLEALKQEEPDVQFFSSQLEKYHKQHKDSVALRPTRNVGLLLIDTKQLKEKLIPSPLRCLEVLNSMLPCLSKKKVDAIISEAQDAEYKLEFMPTTTIEYVNSLVFLDEIQERIETLEEEANVVVQMYKLIEQYQVPTPPEDFAVFATMKPSITAVRNAIDKSVGDRETSIKQFCLHLGRDLEDLNNEVNEVKLLAQDPQILDISADQEKIKTMLSDLQSVLDDLQKRAFQYKSYQKNFKVEVSKFDALEEVSAELRLKQLLWDSLSEWDNLQQEWLKSKF---DCLDPEVL-NSQVTKYAKFVTQLEKGLPPNSVVPQLKQKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDALLVDTEIPLTLERLSELHVFNFAQEIQDISGQASGEAALEIILKKVEDSWKTTEFVILPHRDS-KDVFILGGTDDIQVLLDDS 1060          
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Match: Dnah1 (dynein, axonemal, heavy chain 1 [Source:MGI Symbol;Acc:MGI:107721])

HSP 1 Score: 1031.94 bits (2667), Expect = 0.000e+0
Identity = 550/1256 (43.79%), Postives = 766/1256 (60.99%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASK-RDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERE---SQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKR--KVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLAT---VENGCDPSDTDNYSRV---IELWFQFCMIWSICCSVDEDGRKKIDNYIR------EMEGTFPNKDTIYEYFVD----------------NKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDR-LKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKL------QDFEEELKPIGDI------ITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            M  S + KPFE  ++ WE  L   QE +E  L  QR WLYLE IF  EDI +QLP ES  +  + + WR IM    + R        + LL++    N  L+ +QK L  YLETKR  FPRFYF+S+D+LLEIL Q+K+P  V PHL+KCF+NI  L    L  +  E + M+S++GEEV     +     VE WL ++E+ M+ ++ D++    +A+K   +  R +W+  W GQ+ I   Q  WT +V +AL+  A     K    + K+    L      +R  L+++QR+ +++L+VIEVH +D++ KL       ++ FEW+SQLR+YW K  DD  I+  N  F YGYEYLGNSGRLVITPLTDRCY+TLT ALHL  GG+P GPAGTGKTET KDLGK+L    +V NCS+ LD+ +MG+ F GLA  GAW CFDEFNRI+IEVLSVVAQQI +I  A       +FMF+G  I LVPS  +FITMNPGYAGRTELPDNLK++FRP+AM+ PD AMIAEI+L++ GF+   VLAKK+ T + LS +QLS QDHYDFG+RA+ +V+  AG  KR NP M +E I L ++ D+N+ K    DL LF GIVSDLFP I     DY  + +AI + C+   L+     + K +QLYET   RH +M+VG T SGKS  +R+L +A+  L  +       +E    + LNPKS+++G+LYGEFDL T+EWTDG+ SS++R     +  ++KW +FDGPVD +WIE+MN+V+DDNK L L +GE I + E ++++FEV++L+VASPATVSRCGMVY + + LG  P+VE WLKR   +     E+   +F KY+E   NF++    E+I ++ +N  +SL KL DC         G     ++  S +   IE WF F ++WS+  + D   R     ++R      +++  FP    +Y+Y +D                NK  SW  W +   A +       +  IIVPT+DTV+ +YL+  L+ N  PV+ +GP GTGKT    N L +     +    +  SA+TS+N  QD+I+++++KR K  F P  G+  + F+DD NMPA +T+G+QPP+EL+RQW+D+G WYDR +    K + D+    AMGPPGGGR  I+ RL   FN ++     E + KRIF  ++   +      + + E +    +I      +  ATI +Y  +  + LPTP K HY FNLRD+SK
Sbjct: 1192 MSFSPYKKPFEQRINSWETKLKLTQEVLEEWLNCQRAWLYLEPIFSSEDITRQLPVESKRYQTMERIWRKIMKNAYENREVINVCSDQRLLDSLRDCNKLLDLVQKGLSEYLETKRTAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARL----LFQEDLEITHMYSAEGEEVKLSFSIYPSSNVEDWLLEVERSMKASVHDIIE---MAIKAYPTMLRTEWVLNWPGQVTIAGCQTYWTMEVAEALE--AGNISSKLFPQLSKQ----LSDLVALVRGKLSRMQRMVLSALIVIEVHAKDVVSKLIDENVVSVHDFEWISQLRYYWTK--DDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVE-RFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNEANVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEETDYGILDQAIRRSCEKNNLKDVEGFLIKCIQLYETTVVRHGLMLVGPTGSGKSNCYRVLAAAMTLLKGKPSISGGVYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSLIRAGAIASDTNKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFVECWLKRLPAIIKPYEEQFKSLFTKYLENSINFVRNTVKEVIASTNSNLTMSLLKLLDCFFRPFLPREGLKKIPSEKLSHIPELIEPWFIFSLVWSVGATGDHTSRISFSQWLRLKMRLEQVKLGFPEDGLVYDYRLDDAGISSTEDDDEEEDENKQVSWVKWMD-YSAPFTMMPDTNYCNIIVPTMDTVQMSYLLGMLLTNHKPVLCIGPTGTGKTLTVSNKLLKYLPLEYISHFLTFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKVIGAFKNLVDINFVCAMGPPGGGRNAITPRLTRHFNYLSFIEMDEVSKKRIFSIILECWMDGLLGEKSYREPVPGAPNIDDLTEPLVDATINVYGIITSQLLPTPAKSHYTFNLRDLSK 2430          

HSP 2 Score: 957.207 bits (2473), Expect = 0.000e+0
Identity = 524/1246 (42.05%), Postives = 764/1246 (61.32%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSS---TDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKRE---ADDQAKSVMQTQERIKVDEA--KCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPT--------------WAEAKKHLGEQD-FIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q ML       + K  + RLW HEN RVF DR+V ++D+  F ELL  ++   F   F+ +CP  Q  ++GD+MS      +YE IT   K+ + ++E +++YN      ++ LVLF DA+ HI +I R +RQ  GN LL+G+GGSGR SLTRLA++M EY  FQIE+SK+Y   E+R+D+K++  +AG+ N P  FLF+DTQ+ +ESFLEDINN+L+SG+IPN+Y  DE D + N +    +  G++ T  ++      RVR N+H+VLCMSP+GE FR R+R FP+ VNC TIDWF+EWP +AL  VA  +L ++      EE  +   L  +   +H+SV+      L E+ RHNYVTP +YLEL++ + IL+ +K+ +L  + N++K+GL K+  T   V  M  ELE  R    + ++   D ++ + Q K +   A++  KSV    E IK +E   K   + + A  DL +A+PAL+AA+ +L +LNK D+TE+++  +PP  V+ V+EAV I++G +P               W   K  L +   F++ L  FDKDNI +  +K I  Y+  ++FQP  + KVS A  S+C WV AM  Y  V + VEPKRQ L+ A+  L   Q  L  A+  L  V + +  +Q +Y E + +KEEL  K E  E+ L RA KL++GLA EK RW++TV +LEN +  + GD L+A+ F++Y+GPF   YR  L   W   +    +P     + I  L NP +IR W I GLP D  SVENGVI     RW   +DPQ QA KWIK ME +  L V  L   DF+R +E AI+FG+P LL+NV E+LDP+L+P+L K   K  G  V+KLGD  I Y+ DFR YITTKLPNPHY+PEISTK  ++NF +   GLE QLLG VV +ERP+LEE K+ L++S A  +++L ++ED+IL  L+ ++G+ +DD +L+  L+ SK+ + E+  +++IAE+TE  ID+ R  Y   A R  ILFF ++DL  +DPMYQ++L+ ++++F   I  S ++    +RI N+N Y T+++Y   CR LFEKHKL+F+F +C +I+   GK+N  E+ + L GG +   +   +NP P WLSD+AW +I  L  L  F      F  Y  ++   + S  P    LPG W+   +EFQ++LI+R LR D+V+     F+  +L  +F+EP   ++  V  +S++ T LIFVLSPG
Sbjct: 2433 QGMLMAEPSKVEDKVQLLRLWYHENCRVFRDRLVNEEDRSWFDELLEAQMEE-FGVAFNKVCPF-QPILYGDFMSPGSDVKSYELITSESKMMQVIEEYMEDYNQI-NTAKLRLVLFVDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWREDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNIYSADEQDQIINTMRPYIQEQGLQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATTFLSEIPELECSEE--VIQGLIQVCVFIHQSVASKCVEYLAELARHNYVTPKSYLELLNIFSILIGQKKMELKTAKNRMKSGLDKLLRTSEDVAKMQEELEIMR---PLLEEAAKDTMLTMEQIKVDTAIAEETRKSVQA--EEIKANEKANKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGSKVDDYWEPGKGLLQDPGRFLESLFKFDKDNIGEAVIKAIQPYIDNEEFQPAAIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALREAQDDLEVTQRILEEAKHHLHEVEDGIATMQAKYRECVAKKEELEMKCEQCEQRLGRADKLINGLADEKVRWQETVENLENMLDNIFGDVLVAAGFVAYLGPFTGQYRTTLYEYWVNQLTVHHVPHTSKPTLITTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQGQANKWIKNMERESGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNIVLKLGDTVIPYHEDFRMYITTKLPNPHYSPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIVSNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAVRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRIVNINRYLTFSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQAEWRYLLSGGSI---QTMFENPAPQWLSDRAWRDILALSNLPTFATFSNDFVMYLSEFQAIFDSAEPHRELLPGIWNAYLDEFQKLLILRCLRGDKVTNAMQDFVATHLEPRFIEPQTANLSAVFKESNSTTPLIFVLSPG 3665          

HSP 3 Score: 104.76 bits (260), Expect = 2.620e-21
Identity = 128/582 (21.99%), Postives = 248/582 (42.61%), Query Frame = 3
Query: 2874 INGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKKSIWE--FISTDDE----------ITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEE---FISQY---CDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFI-ILDKYEVQYSDDIRLKKQNLEKEW------QEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSAL---IMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQ-WKSGRFIELKTIEMENLANSSFRKATKFSRDLKD--KNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            +N   +   +PLF V L L    + +   L     I+ +L    I     +P         +L+K + E  FIS D            + +++ NI + M      +Q    Y  ++R+  ELN  +   F+  Y   C     V  +     +  E+ + +L +  ++   ++ +D   +K S++   +     + ++L     K +  +    +++S K+ + P ++EEL E       L +    I EK   L+E  + ++  YEV       L   +   +W       + L  +    Q   + ++KF+   L+  ++F++++  L   +  F  +   A +    E   ++   K  L+  +           +F +      +++ + K+     ++W  A +W   W++ W +     +   ++E     SF+   K  +  KD     E+    R R+++F+  +PLI  LRN  MR+RHW  + NEI        ++ T  + +++N   H E I++V+  A KE AIE AL  MEK W S+   ++P+  KE + ++L   D+  Q LDD+
Sbjct:  632 VNSPYKPRKNPLFIVDLVLDNSGVHYSTPLEHFEMILLNLFDKGILATHAVP---------QLEKLVMEDIFISGDPLLESVGLHEPLVEELRANITNAMHKAMMPLQ---AYAKEYRKYLELNNNDISTFLKTYQTQCPSAEEVREVVITHLKEKEILDNSLPSSIIIGPFYINVD--NVKQSLSKKRKALATSMLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAE-------LRDWMKGIPEKLVFLEERIVKVMSDYEVMDEFFYNLTTDDFNDKWAANNWPSKILGQIDMVRQQHVEDEEKFRKIQLMDQNNFQEKLEGLQLVVAGFSIHVEIARA---HEIANEVRRVKKQLKDCQQLAMLYNNRERIFGLPITNYDKLSRMVKEFQPYLDLWTTASDW-LRWSESWMNDPLSAIDAEQLEKNVIESFKTMHKCVKQFKDIPACQEVALDIRTRIEEFKPYIPLIQGLRNPGMRNRHWEVLSNEININV-RPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSSILFNVLPY--KETDTYILKSPDEASQLLDDH 1185          
BLAST of Dynein heavy chain axonemal vs. UniProt/SwissProt
Match: sp|P0C6F1|DYH2_MOUSE (Dynein heavy chain 2, axonemal OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1)

HSP 1 Score: 1803.88 bits (4671), Expect = 0.000e+0
Identity = 852/1214 (70.18%), Postives = 1010/1214 (83.20%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKL--MSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  MK SRFVK FE +VD WER LS I E +EM+LTVQRQW+YLENIFLGEDIRKQLP ESA FD++N  W+ IM  +N+  NA       GLLET   MN  LEDIQKSLDMYLETKR+IFPRFYF+SNDDLLEILGQS+NP+ V PHLKKCFDNI  LKI+K+   S  +EA  MFS DGE + F   + LEGPVE+WL D+E+ MR+TLRDLLR+CR+ALKK  +KRDKW+K+W+GQ+ IT+SQIQWTADVTK L    +R+DKK L++       +L K+SEAIR NLTKI RLKI +LV IE+H RD++EKLYKSG  D+++F+WLSQLRFYWEK++DDC+I+QTNT FQYGYEYLGNSGRLVITPLTDRCY+TLTTALHLHRGGSPKGPAGTGKTETVKDLGK+LG YVIVVNCSEGLDYKSMGRM+SGLAQ+GAWGCFDEFNRINIEVLSVVAQQILSILSAL +N   +F F+G  I+LV S GIFITMNPGYAGRTELP+NLKSMFRPIAMV PDS +IAEI LF EGF  CK+LAKKV+TLYSL++QQLS+QDHYDFGLRAL S+LRYAG+K+R  P + DEE+LLLSM DMN+AKLTSVD+PLF  IV DLFP I+ PV+DY  +++ IE+      LQ T FT+TKV+QLYETK SRHS MIVG T S K+T+W++LQ++L  L +  E  +    EFPLNPK++SLGELYGE+DLNTNEWTDG+LSSVMR  CAD +PDEKWI+FDGPVDTLWIESMNSVMDDNK+LTLINGERI+MPEQVSLLFEVENL+VASPATVSRCGMVY D  DLGW+PYV+SWL+++  +  VE L RMF+K+I KI +F K NC EL+     + +ISLCKL+  LAT ENG +P+D +NYS ++E+ F F MIWS+C SVDEDGRKKID+Y+RE+EG+FPNKDT+YEY+V+ K ++W  ++EKL   W+Y  + PFYKI+VPTVDTVRYNYLV  LV N +PV+LVGPVGTGKTS+A + L  L +  W++L +NMSAQT+SNNVQ IIE+RVEKRTK  +VP GGK M+TFMDD NMPAKD FGSQPPLELIR WIDYGFWYDR+KQ+ K I+DM+L  AMGPPGGGR +IS RLQSRFN+INMTFPTES + RIFG+MINQKLQDFEEE+KPIG+++T+AT+++YN VV +FLPTP KIHYLFNLRDISK
Sbjct: 1445 LSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWAGQVVITASQIQWTADVTKCLMTAKERSDKKILKVS------ILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLT-RFYFEGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVREFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEKRPKTE-VEPLQRMFEKFINKILSFKKDNCNELVPVPEYSGIISLCKLYTVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLREIEGSFPNKDTVYEYYVNPKMRTWTSFEEKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQSIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISK 2650          

HSP 2 Score: 1749.95 bits (4531), Expect = 0.000e+0
Identity = 834/1224 (68.14%), Postives = 1021/1224 (83.42%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q MLR NKD+HDTK SITRLWIHE FRVF+DR+V   D  AF+ +LS+KLG+ FD TFH++CPNK+ PIFGD++     YED+ D+  LK  M+  L+EYN +P VV M LVLFR+AIEHI++I+RVI QPRGNMLLVGIGGSGRQSL RLA+ +C+Y +FQIEV+KHYRKQEFRDD+KRLY QAGV+ + T FLF DTQ+ DESFLEDINNILSSGE+PNLYK DE ++++N + D+A+ + I +++ S+F YLI+RVR N+H+VLC+SPVG+PFRN IR +PA VNCTTI+WFSEWP +ALLEVAE+Y+  + L   G ++ +   +A IF  MH SV+  SQ+ML E++R+NYVTPTNYLELVSGYK LL EKR++L D ANKL+ GL KIDETR KVEVMS+ELE+A+KK+A FQK+C++YLV+IVQQKREAD+Q K+V    E+I ++E KC  + + A  DL +A+PALE AM+ALESLNKKDI EIKSYG+PPA V+ VM+AVMILRG EPTWAEAK+ LGEQ+FIK LINFDKDNISD+ LKKIG Y AQ DFQPD++G+VSLAAKSLCMWV AME+YGR+YRVVEPKR R+ AA + L+EKQA LA AQ KL  V E+++ L+++Y+EK+ QKEELRKK+E  E  L+RA  LVSGLAGEK RWE+TV  LE  +G L GDCLIA+AFLSYMGPFL++YR+ ++ + W   I++ Q+P +P F+   FL+NPT++RDWNIQGLP D FS ENG+IVTRG+RW LM+DPQ QA KWIK MEG + LK+IDL M D++RVLE AIQFG PVLLQNVQE LDP+L+P+LNKS+ +IGG  ++++GDKE+EYN +FRFY+TTKL NPHY PE S KT IVNFAVKEQGLEAQLLGIVVRKERPELEEQKD+LV++IAAGKRKL ELEDEILRLLNEA GSLLDD QLVNTLQTSKIT+TEVTEQL+ +E TE  ID+AR+ Y  CAQRAS+LFFVLND+G+IDPMYQF+LDAYI LF +SI+KS +S K ++RI  LNDYHTYAVY Y CR LFE+HKLLFSF +CAKIL+TSGK+NMDEYNFFL+GGVVLDRE QMDNPC  WL+D  WDNI+ELDKL NFHGL+ SFEQYPRDW+LWYT+ SPE + LPGEW+NA NE QRMLIVRSLR DRV+FC TSFI++NLG++F+EPPVL+MK V++DS+ ++ L+F+LSPG
Sbjct: 2653 QGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGDFLKEPKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDL---GTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPG 3873          

HSP 3 Score: 918.302 bits (2372), Expect = 0.000e+0
Identity = 455/1027 (44.30%), Postives = 679/1027 (66.11%), Query Frame = 3
Query: 1485 EICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQ------MRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKL-KKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            ++CECQ HFAR+EDG +  +P F GA+G ++   +L+IE +F  N++ LR  +  ILDVK TSWH+DYN+FR G+KDLEVMTQN IT+AFE V  ++ G+ +LD F  L  RE I RT +K    +      E  LV +EL  +       P + +Y+G A W R LR+RI+R M  L  A FLP   +  +    Y Q++ A++E+VRKT  E+ + LD+D ++ LD++LL  S    GMLD+NF + LL LF E+ YWERL F+ PHY  ++  R  +LRI RE++LLV RDYNRI+  L+ +E++LFKE+I+ LDKKI PGL K+ W+ KGA  +F+ +CR++A+++Q  V+++K +   I    + +S +L++ I   ++Y + EF ++Q  HR   ++KLV LH +++N M  +YE+F  D  +IQQ W LY  ++D   E+A RLNVK+SL EL+KAINGDG+  P+PLF+V + LQ         + F PTL  L ++V  +G +    +     + ++L K K+ ++ I+  +  D++I KIQ  I  GM + +S +Q  L  WD +REIWE+NK+ FI +Y  LNP V S DADI+RYTEV N     E ++ ++F+ LD S LK S+  HC +WQ K T LL  MA   L  LH+Y+K+ +EK+S  PQ LEELG S++L+D L  +  +++ +  P+ E F IL+KYEV   D +    ++L  EW  F Q L+++EQM+KK K+KFKTGL+  +DDFKK+   L+ DF+  GPF +++    AL +IA  ++ L +++ +E  +R  L +FKIEQP SK++  LEK+LD ++ +W++  +WE +W QWK G F  L+T  ME++A+  FR+ T+ +++ KD+NWEIIE TR++++QF+RTMPLI+DLRN A+R+RHW Q+K E++++FD+ES  FTLE+I+ L  DQH E I E+S +ATKELAIE  L+ + K W+S +L+I+P+KD  K H  L G ++++Q L+DN+  LS 
Sbjct:  425 KVCECQYHFARWEDGKQGPLPCFFGAQGPQITRNLLEIEDIFHKNLQTLRAVRGGILDVKNTSWHEDYNKFRGGIKDLEVMTQNLITSAFELVRDVEHGVLLLDTFHRLATREAIMRTYEKKAVDLYMLFNSELALVNREL--NKKWPYLEPYMTQYSGQAHWVRILRRRIDRVMNCLSGAHFLPHIGTGEESIHTYQQMAQAIDEMVRKTFQEWTATLDKDCIRRLDMSLLRISQEKVGMLDVNFDKTLLILFAEIDYWERLLFETPHYVMNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRFLDKKIHPGLKKLNWALKGASAFFITECRMHASKVQMIVNDFKASTLTIGWKAQEMSELLLVHITGKQVYRDLEFEEAQREHRMAAQQKLVKLHQDVVNIMTNSYEVFKNDGPEIQQQWLLYTIRLDHMMEDALRLNVKWSLLELSKAINGDGKTTPNPLFRVLVILQNDVRGGGSQVEFSPTLQTLASVVNDIGSHLFATISVFRHLPDILTKRKMNREPIYVLVERDEDIRKIQAQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIRRYQRLNPPVSSFDADIARYTEVANNVQKEETVLNIQFVMLDCSHLKFSLVQHCNEWQNKFTTLLKEMAAGRLADLHSYLKDNAEKISHPPQTLEELGVSLQLMDTLQHDLPNLETQIPPIHEQFTILEKYEVPVPDTVLEMLESLNGEWLTFQQILLDSEQMLKKHKEKFKTGLIHAADDFKKKAHNLLEDFEFKGPFTSTVGHTAALDQIAQMRAMLMAMRDEENNLRSNLGIFKIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKD--KGHHRLRGTEEVFQALEDNQVALST 1447          

HSP 4 Score: 294.278 bits (752), Expect = 9.056e-78
Identity = 155/317 (48.90%), Postives = 207/317 (65.30%), Query Frame = 3
Query:  306 RIRLSGYVEIENWTADHALQ----VQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKM 1244
            R  L+G  +   WT +H +     VQD  V +    L  ++    GL+L+   P    N++VYFI++       I  ENF + +Q+GTV G  I +LLR++ G+Y P  F N  WP+SI+N F   L RF+++LTD R+KLEG TVLYIPAEA     E   K+K+ + R+E  MIHWTRQIKEVLSAQ + E  E+ GPL+EIE+W NRC DLS ISKQL K GVKHI  IL  AKSSY+  F KLA +I+  ++QAQSNL FL+ L++   +L+  KP+DI   L KLI+ IR+IWVNS HYN+R+ +T +FRK+
Sbjct:  118 RTMLTGLAD-ATWTGEHDMVLEHFVQDPAVPA----LTIFIDPVFGLKLELGMPVQTQNQIVYFIRQAPVP---ITPENFEETVQYGTVRGAYIPALLRLLSGVYVPQIFMNKSWPESIRNHFVSHLHRFLASLTDTRYKLEGHTVLYIPAEAVQMDPEVVVKDKELVQRLETSMIHWTRQIKEVLSAQESVETGENLGPLEEIEFWHNRCMDLSSISKQLVKKGVKHIESILFLAKSSYLTPFRKLAQQIQDGSRQAQSNLTFLSILREPYQELAFMKPKDISEKLPKLISLIRIIWVNSPHYNTRERLTALFRKV 426          
BLAST of Dynein heavy chain axonemal vs. UniProt/SwissProt
Match: sp|Q9P225|DYH2_HUMAN (Dynein heavy chain 2, axonemal OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3)

HSP 1 Score: 1790.78 bits (4637), Expect = 0.000e+0
Identity = 846/1214 (69.69%), Postives = 1004/1214 (82.70%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLM--SQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  MK SRFVK FE +VD WER LS I E +EM+LTVQRQW+YLENIFLGEDIRKQLP ES  FD++N  W+ IM  +N+  NA       GLL+T   MNT LEDIQKSLDMYLETKR+IFPRFYF+SNDDLLEILGQS+NP+ V PHLKKCFDNI  L+I+K+   S  +EA  MFS DGE + F   + LEGPVE+WL D+E+ MRVTLRDLLR+C +AL+K  +KRDKW+KEW+GQ+ IT+SQIQWTADVTK L    +R DKK L++MKK Q  +L K+SEAIR NLTKI RLKI +LV IE+H RD++EKLYKSG  D+N+F+WLSQLRFYWEK++DDCVI+QTNT FQY YEYLGNSGRLVITPLTDRCY+TLTTALHLHRGGSPKGPAGTGKTETVKDLGK+LG YVIVVNCSEGLDYKSMGRM+SGLAQTGAWGCFDEFNRINIEVLSVVA QIL ILSALA+     F F G  I+LV S GIFITMNPGYAGRTELP+NLKSMFRPIAMV PDS +IAEI LF EGF  CK+LAKKV+TLYSL++QQLS+QDHYDFGLRAL S+LRYAG+K+R  P + DEE+LLLSM DMN+AKLTSVD PLF  IV DLFP I+ PV+DY  ++E +E+   +  LQ T FT+TKV QLYETK SRHS MIVG T SGK+ +WR+LQ++L+ L +  +  F    EFPLNPK++SLGELYGE+DL+TNEWTDG+LSSVMR  CAD +PDEKWI+FDGPVDTLWIE+MNSVMDDNK+LTLINGERI+MPEQVSLLFEVE+L++ASPATVSRCGMVY D  DLGW+PYV+SWL+++  +  VE L RMF+K I K+  F K NC EL+     + + SLCKL+  LAT ENG +P+D +NY  ++E+ F F MIWS+C SVDE+GRK+ID+Y+RE+EG+FPNKDT+YEYFVD K +SW  +++KL   W+Y  + PFYKI+VPTVDTVRYNYLV +LV N +P++LVGPVGTGKTS+A + L  L +  W++L +NMSAQT+SNNVQ IIE+RVEKRTK  +VP GGK M+TFMDD NMPAKD FGSQPPLELIR WIDYGFWYDR KQT K I++M+L  AMGPPGGGR +IS RL+SRFN+INMTFPT+S + RIFG+MINQKLQDFEEE+KPIG+++T+AT++MYN VV +FLPTPTK+HYLFNLRDISK
Sbjct: 1410 LSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGLLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKWEAVGMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLALRKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILKVMKKNQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLT-HFHFDGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRETVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAGDPNFNIVREFPLNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWLEKRPKAE-VEPLQRMFEKLINKMLAFKKDNCKELVPLPEYSGITSLCKLYSALATPENGVNPADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRIDSYLREIEGSFPNKDTVYEYFVDPKIRSWTSFEDKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSSLVANQNPILLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRTKQTIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKMHYLFNLRDISK 2621          

HSP 2 Score: 1734.54 bits (4491), Expect = 0.000e+0
Identity = 830/1224 (67.81%), Postives = 1016/1224 (83.01%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q MLR NKD+HDTK+SITRLWIHE FRVF+DR+V   D  AF+ ++S+KLGS FD TFH++CP+K+ PIFGD++     YED+TD+  LK  M+  L+EYN +P VV M LVLFR+AIEHI++I+RVI QPRGNMLLVGIGGSGRQSL RLA+ +C+YT+FQIEV+KHYRKQEFRDD+KRLY QAGV+ K T F+F DTQ+ DESFLEDINNILSSGE+PNLYK DE +++++ + D+A+ + + +++ S+F YLI+RV+ N+H+VLC+SP+G+PFRN IR +PA VNCTTI+WFSEWP +ALLEVAE+ L  + L   G ++ +   +A IF  MH SV+  SQ+ML E++RHNYVTPT YLEL+SGYK LL EKR++L   ANKL+ GL KIDETR KV+VMS+ELE+A+KK+A FQK+C++YLV+IVQQKREAD+Q K+V    E+I V+E KC  + + A  DL +A+PALE AM+ALESLNKKDI EIKSYG+PPA V+ VM+AVMILRG EPTWAEAK+ LGEQ+FIK LINFDKDNISD+ LKKIG Y AQ DFQPD++G+VSLAAKSLCMWV AME+YGR+YRVVEPKR R+ AA + LREKQA LA AQ KL  V E+++ L+++Y+EK+ QKEELRKK+E  E  L+RA  LVSGLAGEK RWE+TV  LE  +G L GDCL+A+AFLSYMGPFL++YR+ +V + W   I + Q+P +PSF+   FL NPT++RDWNIQGLP D FS ENG+IVTRG+RW LM+DPQ QA KWIK MEG + LK+IDL M D++R+LE AI FG PVLLQNVQE LDP+L+P+LNKS+ +IGG  +M++GDKE+EYN +FRFYITTKL NPHY+PE S KT IVNFAVKEQGLEAQLLGIVVRKERPELEEQKD+LV++IAAGKRKL ELEDEILRLLNEA GSLLDD QLVNTL TSKIT+TEVTEQL+ +E TE   D+AR+ Y  CAQRASILFFVLND+G IDPMYQF+LDAYI LF +SI+KS +S K ++RI  LNDYHTYAVY Y CR LFE+HKLLFSF +CAKIL+TSGK+NMDEYNFFL+GGVVLDRE QMDNPC  WL+D  WDNI+ELDKL NFHGL+ SFEQYPRDW+LWYT+ +PE + LPGEW+NA NE QRMLIVRSLR DRV+FC TSFII NLG++F+EPPVL+MK V++DS+ ++ L+F+LSPG
Sbjct: 2624 QGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPPIFGDFLKEPKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESSDSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCLIGVDL---GTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAVEEIKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNAAPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPG 3844          

HSP 3 Score: 924.08 bits (2387), Expect = 0.000e+0
Identity = 461/1032 (44.67%), Postives = 679/1032 (65.79%), Query Frame = 3
Query: 1485 EICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALST---SIGLP--HPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQ------MRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKL-KKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            ++C+CQ HFAR+EDG +  +P F GA+G ++   +L+IE +F  N+  LR  +  ILDVK T WH+DYN+FR+G+KDLEVMTQN IT+AFE V  +  G+ +LD F  L +RE I+RT DK       K +  + L   ELAL     +   P   P + +Y+G A W   LR+RI+R M  L  A FLP   +  +    Y Q+  A++E+VRKT  E+ S LD+D ++ LD  LL  S    GMLD+NF ++LL LF E+ YWERL F+ PHY  ++  R  +LRI RE++LLV RDYNRI+  L+ +E++LFKE+I+ LDKKI PGL K+ W+ KGA  +F+ +CRI+A+++Q  V+E+K +   I    + +S  L+++I   R+Y + EF + Q  HRA V++KL+ LH +++  M  +YE+F  D  +IQQ W LYM ++D+  E+A RLNVK+SL EL+KAINGDG+  P+PLF+V + L+      +  + F PTL  L  +V  +G +    +     + ++L K KL ++ I   +  D++I KIQT I  GM + +S +Q  L  WD +REIWE+NK+ FI +Y  LNP V S  ADI+RYTEV N     E +  ++F+ LD S LK S+  HC +WQ K   LL  MA   L+ LH Y+K  +EK+S+ PQ LEELG S++L+D L  +  +++ +  P+ E F IL+KYEV   D +     +L  EW  F Q L++++QM+KK K+KFKTGL+  +DDFKK+   L+ DF+  G F +++    AL +I   ++ L +++ +E  +R  L +FKIEQPPSK++  LEK+LD ++ IW++A +WE NW +WK+GRF+ L+T  ME  A+  FR+ TK +++ KD+NWEIIE TR++++QF+RTMPLI+DLRN A+R+RHW Q+++EI+++FD+ES  FTLE+I++L  DQH E I E+S +ATKELAIE AL+ + K W+  +L+I+P+KD  K H  L G ++++Q L+DN+  LS 
Sbjct:  390 KVCDCQYHFARWEDGKQGPLPCFFGAQGPQITRNLLEIEDIFHKNLHTLRAVRGGILDVKNTCWHEDYNKFRAGIKDLEVMTQNLITSAFELVRDVPHGVLLLDTFHRLASREAIKRTYDK-------KAVDLYMLFNSELALVNRERNKKWPDLEPYVAQYSGKARWVHILRRRIDRVMTCLAGAHFLPRIGTGKESVHTYQQMVQAIDELVRKTFQEWTSSLDKDCIRRLDTPLLRISQEKAGMLDVNFDKSLLILFAEIDYWERLLFETPHYVVNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRLLDKKIHPGLKKLHWALKGASAFFITECRIHASKVQMIVNEFKASTLTIGWRAQEMSEKLLVRISGKRVYRDLEFEEDQREHRAAVQQKLMNLHQDVVTIMTNSYEVFKNDGPEIQQQWMLYMIRLDRMMEDALRLNVKWSLLELSKAINGDGKTSPNPLFQVLVILKNDLQGSVAQVEFSPTLQTLAGVVNDIGNHLFSTISVFCHLPDILTKRKLHREPIQTVVEQDEDIKKIQTQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIHRYQRLNPPVSSFVADIARYTEVANNVQKEETVTNIQFVLLDCSHLKFSLVQHCNEWQNKFATLLREMAAGRLLELHTYLKENAEKISRPPQTLEELGVSLQLVDALKHDLANVETQIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQMLKKHKEKFKTGLIHSADDFKKKAHTLLEDFEFKGHFTSNVGYMSALDQITQVRAMLMAMREEENSLRANLGIFKIEQPPSKDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETMETTAHGLFRRLTKLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKD--KGHHRLRGTEEVFQALEDNQVALST 1412          

HSP 4 Score: 301.982 bits (772), Expect = 5.373e-80
Identity = 156/327 (47.71%), Postives = 213/327 (65.14%), Query Frame = 3
Query:  270 DEEKSVIDLIRQRIRLSGYVEIENWTADHALQVQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSN 1250
            + E  V  L   R  L+G  +   WT +H   ++         +L  ++    GL+L+   P    N+LVYFI++       I  ENF   +Q GTV G  I +LLR++ G++AP  F+NT WP+SI+N F+  L +F++ LTD R+KLEG TVLYIPAEA     E   K+K+ + R+E  MIHWTRQIKE+LSAQ   E  E+ GPL+EIE+W+NRC DLSGISKQL K GVKH+  IL  AKSSY+  F+KLA +I+  ++QAQSNL FL+ LK+   +L+  KP+DI S L KLI+ IR+IWVNS HYN+R+ +T +FRK+ +
Sbjct:   71 EPEADVKPLFLSRAALTGLAD-AVWTQEHDAILEHFAQDPTESILTIFIDPCFGLKLELGMPVQTQNQLVYFIRQAPVP---ITWENFEATVQFGTVRGPYIPALLRLLGGVFAPQIFANTGWPESIRNHFASHLHKFLACLTDTRYKLEGHTVLYIPAEAMNMKPEMVIKDKELVQRLETSMIHWTRQIKEMLSAQETVETGENLGPLEEIEFWRNRCMDLSGISKQLVKKGVKHVESILHLAKSSYLAPFMKLAQQIQDGSRQAQSNLTFLSILKEPYQELAFMKPKDISSKLPKLISLIRIIWVNSPHYNTRERLTSLFRKVCD 393          
BLAST of Dynein heavy chain axonemal vs. UniProt/SwissProt
Match: sp|Q9MBF8|DYH1B_CHLRE (Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC10 PE=1 SV=1)

HSP 1 Score: 1268.06 bits (3280), Expect = 0.000e+0
Identity = 634/1232 (51.46%), Postives = 853/1232 (69.24%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNI--CPNKQSPIFGDYMSS---TDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERI--KVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGK--KLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q M++  K ++++K  + +LW HE  R+ ADRM    DK   V  L EKLG+ F  +F  +    N+  P F  +M        YE + D+  LK  + E L++Y   PG   MDLVLFRDA+ H+ +I R++ QPRGN LLVG+GGSGR+SL RLAA++ E   F IE++K+YR+ EFR+DLK LY QAGV NKPT+FLF++TQ+V E+FLED+NNIL+SGE+PNL+ +DE+  + ++L   AK  G  +T  +++ +L++RVR N+HVVLC+SPVGE FR R RMFP  VNCTTIDWF+EWP DAL EVA++ L D+ L  G  E  +K  +  +F   H+SV + S +M   +KR NYVTPTNYLE V GYK LL EKR +L + A KL+ GL K+DET  +V  M    EE +  +A  + +C++ LV IVQ KR AD+Q K V    ++I  + +EA  +  Q     +L +A+PAL  A  AL+ L KKD++E+K+Y KPP  V+  + AV+ +    P W EAKK L + +F++ L  FDKD + D  LKKIG + A  DF  + +  VS AA  +C WV AME YG V + V PKR +L++A+  L  KQA LA AQ +L  V+ +++ L+ +Y+  + +K+ L ++    E  L+RA KLV+GLAGE+ RWE ++++    +G LPGD ++A+AF+SY GPF S+YR+ LV   W   +K   IPA+  F F  FL+NP  +RDWNIQGLP D FS ENGV+VTRG RWPLM+DPQ QA KWIK MEG+  +LKV++L M D  R +E AIQFGQPVL+Q++ +++DP L+P+L KS +K G  T++KLGDKE++YN+DFR Y+TTKL NP YTPEISTK  IVNFAVKEQGLEAQLL  VV+ ERP+L++QK++LV+ +AAGKR  AELED IL LL+ A GSLLD+  L+NTL  SK T  EV   L +AE+T+  I+ A Q Y  C+ RAS+L+FVLNDL  IDPMYQF+LDAY DLF +SI  S K+    ERI +LND+HTYAVY Y  RGLFE+HKLL S Q+C +ILQT+ ++N +E+ FFL+GG VLDR +Q +NP   W+S++AWDNI+ELD L NF G+++SFE    +W  WY    PE S LP EW++  NE QR+++VR LRPDRV F AT+++ N LG K+VEPPVLD+ + + DS+A + LIFVLS G
Sbjct: 2705 QGMMQATKAFYNSKEEVLQLWCHECMRIIADRMWDHADKEWLVRQLDEKLGTTFSTSFGTLFEAYNETVPPFVTFMRQNVDVPVYEAVRDMVALKDLLTERLEDYALEPGHSAMDLVLFRDALSHVCRIHRILGQPRGNALLVGVGGSGRKSLARLAAFVAELKCFTIEITKNYRQTEFREDLKGLYRQAGVANKPTVFLFDETQIVYETFLEDVNNILTSGEVPNLFPKDELGSVLDELRPAAKAAGAGETADALYGFLLERVRTNLHVVLCLSPVGEAFRERCRMFPGLVNCTTIDWFTEWPADALFEVAQKQLMDVDL--GSTE--VKTAVCKVFVTAHQSVENTSAKMFAALKRRNYVTPTNYLETVRGYKGLLAEKRTELGEKAAKLQGGLHKLDETSVQVAAMKKVAEEKKVVVAQAKADCEELLVEIVQDKRVADEQEKQVNAEAQKIGKEAEEANIIAAQ--VQQELDKALPALREAEAALDVLTKKDMSELKAYAKPPEKVEMTLNAVLTVLRRPPNWDEAKKRLSDANFMQSLKEFDKDKLDDSLLKKIGKFTANPDFTYEKINTVSAAASGMCKWVHAMETYGYVAKDVAPKRAKLKSAQDTLARKQAALALAQEQLAVVLAKVQALKDKYDTSIARKQALEEELADLEGKLERAEKLVTGLAGERVRWEASISEYNIALGCLPGDVVVAAAFMSYAGPFPSEYRDELVKHTWLPQVKALNIPASEHFDFALFLANPAMVRDWNIQGLPSDSFSTENGVMVTRGRRWPLMIDPQGQANKWIKNMEGRGGRLKVLNLQMSDMARQIENAIQFGQPVLMQDILQEIDPILEPVLAKSFIKRGNQTLIKLGDKEVDYNFDFRLYLTTKLANPLYTPEISTKVMIVNFAVKEQGLEAQLLATVVKNERPDLDKQKNDLVVKVAAGKRTQAELEDTILHLLSTATGSLLDNVTLINTLDQSKTTWEEVNASLAVAEETQKKIEAASQLYRPCSVRASVLYFVLNDLSTIDPMYQFSLDAYNDLFLLSIKNSPKNDNLAERIKSLNDFHTYAVYKYTSRGLFERHKLLLSLQMCVRILQTANQVNTEEWQFFLRGGTVLDRSSQPNNPSQEWISEEAWDNITELDALPNFKGVVSSFESNLGEWEAWYRKGDPEASELPAEWESKCNELQRLILVRCLRPDRVIFAATTYVSNALGRKYVEPPVLDLAETLKDSTALSPLIFVLSAG 3930          

HSP 2 Score: 1241.1 bits (3210), Expect = 0.000e+0
Identity = 630/1253 (50.28%), Postives = 839/1253 (66.96%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLG-EDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASS--MFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALV-SVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKER--ESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRK-----VDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCD----------------------------PSDTDNYS--RVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  MK S++   FE ++  WE+ LSHI ET+E++L VQR W+YLENIF+G EDIRKQLP+ES  FD ++  +  +M +L    N       +GLLE+F  MN  LE IQKSLD YLE KR  FPRFYF+S+DDLLEILGQ+K+P  V PHLKKCF+ I  L +        +  S  + S DGE + F   +  EG  E WL  +E  M +T +  L   ++  +  A K++KW+KE  GQ+ IT+ QI WT +  KAL +    + +K L+++KKK    L K +   RS L KI+R K+ +L+ IEVH RD+IEKL KS CS  N FEW+SQLRFYW++E +DC++KQ  + F YGYEY GN+GRLVITPLTDRCY+TL  A+   RGG+P GPAGTGKTETVKD GK+L  YVIV NCS+G+DYK  G+MFSGLAQTGAW C DEFNRI +EVLSVVA QI +++ A+   +  +F+F G+ I L PS GIF+TMNPGYAGR+ELPDNLK+M RP++M+ PD  +IAEI +F+EGFS  KVLAKK+  +  LS QQLSKQDHYD+GLR+ V  + R AG  KR +P   +E IL  +M D+   KL  +DLPLF  ++SDLFPG++ P  D  +++ AIE       LQ     +TK++Q+++ K +RH  MIVG+T SGKS  W+ LQ AL  L KE   + +F+K     +NP ++S  ELYG F+  T+EW DGVL+ +MR  C D   ++KWI+FDGPVDTLWIESMN+ +DDNK+LTL++GERI+M   VSLLFEVE+LS ASPATVSR GM+Y +V DLGWRP++ SWL  K      D+ +++++S++ DKY+E      +++C EL+ T   + V +  +L+D LA  ENG                              P +T   +   ++E+WF FC+IW I   +DE+GRKK D ++REM+  +P+ DT++EYFV+ K KSW  W+ KL   +K     PF+KI+VPTVDTVR  ++   LV      ++VG VG GKT +  + L  L  D  + +TIN SAQTSSN++QD IE ++EKRTK  F P GGKR++ F+DD NMP K  FG  PPLEL++ W+D GFWYDR K   K IKDM L  AM PPGGGR   S R+Q+ F  +N+T P ++ LKRIFG+++N KL DF++E+KP+ + IT ATI +Y  V  + LPTP+K HYLFN RD++K
Sbjct: 1455 LSTMKASKYFIVFEKDIAYWEKTLSHISETIEIILQVQRNWMYLENIFIGSEDIRKQLPQESQMFDAVHNNFMRLMKQLYSTANCLKACTAQGLLESFQDMNNKLERIQKSLDNYLENKRQQFPRFYFLSSDDLLEILGQAKDPLNVQPHLKKCFEGIKKLDMHLPGEDRKQTISVGITSPDGEYLPFANPVITEGRPEEWLNRVEDAMFLTTKKHL--YKVLEESKAQKKEKWVKENQGQMIITAGQIVWTHECEKALADA--DSARKNLKLLKKKWISYLNKLTAVTRSKLNKIERNKVVALITIEVHARDVIEKLGKSNCSSTNDFEWVSQLRFYWDREKNDCIVKQVLSVFYYGYEYQGNNGRLVITPLTDRCYMTLGAAMFTRRGGNPLGPAGTGKTETVKDFGKALARYVIVFNCSDGVDYKMTGKMFSGLAQTGAWACLDEFNRIEVEVLSVVATQIAAVMQAI-KESKKRFLFLGQEIRLNPSCGIFVTMNPGYAGRSELPDNLKAMLRPVSMMVPDFTLIAEIMMFSEGFSSAKVLAKKMIAIMELSQQQLSKQDHYDYGLRSFVIPIARAAGSLKRLDPEGSEEVILYRTMLDLIKPKLVYLDLPLFMALLSDLFPGVELPPADGGSLRRAIEAELRESNLQIVPEFVTKIIQVFDCKVARHGNMIVGRTGSGKSEAWKCLQRALGRLRKEEPDDDRFQKVHVHTINPLALSNDELYGCFEAATHEWQDGVLARIMRTVCKDETHEQKWILFDGPVDTLWIESMNTTLDDNKLLTLLSGERIAMTPAVSLLFEVEDLSQASPATVSRAGMIYLNVEDLGWRPFITSWLAAKQAAPGADAAIIDQVSKLVDKYMEAALEHKRLHCRELVPTDRLSCVRAFTRLWDALAVPENGVGTMPVDESAGPPGSKAAAAAAAAAAAAAPPEETSGGTGGNLVEMWFLFCLIWGIGGPLDEEGRKKFDAFMREMDTRYPSSDTVFEYFVEPKAKSWLAWETKLTGAFKPAMDQPFFKILVPTVDTVRNRFVGSALVRVSQHTLIVGNVGVGKTMIVGSLLEGLPGDRMSSMTINFSAQTSSNSLQDTIEGKLEKRTKGVFAPAGGKRLVCFIDDLNMPQKSKFGFIPPLELLKLWVDNGFWYDRAKCEVKHIKDMQLLAAMAPPGGGRNAFSQRVQACFATLNVTAPNDNQLKRIFGTILNAKLADFDDEVKPLSEPITMATIGIYRAVSKELLPTPSKSHYLFNTRDLAK 2702          

HSP 3 Score: 928.702 bits (2399), Expect = 0.000e+0
Identity = 498/1377 (36.17%), Postives = 798/1377 (57.95%), Query Frame = 3
Query:  471 ELVYFIKRLGYDFEIINAENFHDFIQHGTV-CGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQA-FFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSS-KGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFI-PTLPELTNIVTSLGKNFIEVVKEIPRIGEVL---QKVKLKKS----------IWEFISTD-DEITKIQTNIRHGMQDISSSIQEPLGYWD-QFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            ++VYF++      + +  EN    I  G +  G  + SLL IM G+Y P   +NT WP+++K+DF+ Q+ +FM+ LT+  ++++GKT+LYIP E  L   +  AK+KD + R+E  +IHWTRQ+KE+L+ Q++ + +E +GPL EIE+W+ R  DLSGI  QLD   V  I  +LE AKSSY+  FL L + I      A+ NLKFL  L++ C  L+ + P+ IPS+L  ++N IRM+W  S  YN+ + ++ + RK+SNEII RCC  + L +++ G + + M  L+  +   E++K++Y +        S KPW+ D ++IFA IDAF+QRC DL+E+CE Q  FA      +  +P+F G  G EV+  IL I+  F+  ++ L+  K  ILDVKAT WHDD+N F+ GVKDLEVM  N I  AF+T   +    E+L+ F  +  R+ IRR  +K           E N VKK            P +P+YAG+A +A  L +R+E+    +D   + LP  S  AD  QQY     A+E+ +  TH ++ S ++    K L   LL++   S G+L +NF + LL + QE+H+WER++  VP  A +I  +R + R+ R+++L+VVRDYN+IL  L+ EER LF ++I+ LD++I PG+ K+ W++ K A+E++  + R         V +YKTAN  +   C  IS ++++ ++  +IY++ EF + QE+H A +K++LV    EI + M   + +F +DS ++Q+ W  +  KVD+  E+A R  +K SL EL++ +NGD + E  P+F V++ L+  + V + PT+  L + + S+ +N I V++ +PR+   L   Q+  ++ +          ++E IS D D + +    I  G+  I   +Q  L YW+ ++R++WE +++ +I +Y      + S +ADISRY +  ++    +    ++FL++D   LK ++  HC  W  K T LL  +A   L  LH Y +   + +   P  LE+L E + L  +L +ER   + +F PL + + +L++YEV   ++     + LE  W +F   L E    +++ KD F+  +    D F K V+ L  DF  + P+++ +P  +AL  I   K + E  + +  EI+ G+++F I QP  K++AA+EKDLD ++ IW L  EWE  +  WK G F ++K  EME  A    +   K  RD+  + W +    ++ +D F+RTMPLITDLRN AMR RHW  +++ I  +FD  S DFTL+ ++ L  DQH E + E+S  ATKELAIEN +K +   W ++ L++  +    K+ F L   ++++ +L++N  TLS 
Sbjct:   96 QMVYFVRDPS---KFVTRENVGSVIFFGVMRGGDPLHSLLNIMHGLYVPVVVANTTWPETVKSDFTAQMHKFMANLTETVYEVKGKTILYIPQED-LRDPKAAAKQKDLVQRLESTIIHWTRQVKELLNQQDSVDASEQAGPLAEIEFWRERSVDLSGIRAQLDDGAVSSIVSVLEYAKSSYLAPFLSLRNLIHREAVAAEDNLKFLLCLEEPCQQLASAHPQTIPSLLPPILNCIRMVWNLSRFYNTPERLSVLLRKLSNEIINRCCSVISLPDVWSGDVDNVMVALRQSMEAGERWKELYKRTAAAVAVRSPKPWDFDISSIFAHIDAFLQRCNDLLEVCEAQLQFA-----PRTPLPVFGGTYGPEVKKSILDIQESFQGLVQGLQALKYDILDVKATRWHDDFNGFKGGVKDLEVMMANVIQRAFDTQPCLAARGELLEGFQTMAKRDYIRRFVEKKTVEFFALFNAEINTVKKLFDAVKRSQPKSPILPRYAGLAKYAMNLMRRLEQSHKVVDSVRYTLPQVSEAADVMQQYELAHQAIEQYISNTHNDWFSTIESSIAKELQACLLTQDKASGGLLSMNFHKDLLSMGQEVHFWERMRLAVPLVAMEINAQREKYRVLRDNILMVVRDYNKILTALDKEERKLFHDRIRYLDRRIMPGVTKLQWTADKHALEFYYREARKFCRDADMAVGDYKTANSRLDAICRSISELVLVDVEKKKIYQHAEFANLQESHHAKIKDRLVSAVDEIRDIMASIHRVFEQDSEEVQREWVRFTQKVDRKLEDALRHVIKKSLQELSRLLNGDNKTEVMPIFHVTMVLERTNRVELRPTIQALFDTINSVARNLILVLQSVPRVALQLTDKQRRDMEDAGLPLPKPLPTLYETISADEDAVLRTIMQITSGITSIIDKVQAFLTYWEKKYRQVWEADRDAYIRRYEKAQKPLSSFEADISRYLQCIDEIRGEDGATNMRFLRIDCGPLKLTLVGHCEAWVSKFTGLLGQLAATELRTLHTYFRENKDSLMLAPSTLEQLAELVGLHRRLADERRRTEARFEPLRDKYKLLERYEVGAKEEEAALLEGLEPAWTQFQALLDETAGKLERYKDNFREKVKSLLDTFLKDVAQLCEDFSRDAPYSSEVPTPDALDFIQASKQADEDTRKRAAEIKNGMDIFNIPQPQYKDLAAMEKDLDFLDRIWGLKDEWEQLYYGWKDGSFTDIKVEEMEEAAVRIGKNVAKLGRDI--RQWTVWSSLKDTLDAFKRTMPLITDLRNPAMRPRHWQNLQDHIGVRFDPHSRDFTLDSLVALRLDQHVEFVAELSVNATKELAIENNIKAIAATWSALGLDMAEY----KSTFKLRSTEEIFTSLEENIVTLST 1457          
BLAST of Dynein heavy chain axonemal vs. UniProt/SwissProt
Match: sp|Q9C0G6|DYH6_HUMAN (Dynein heavy chain 6, axonemal OS=Homo sapiens OX=9606 GN=DNAH6 PE=2 SV=3)

HSP 1 Score: 1061.6 bits (2744), Expect = 0.000e+0
Identity = 543/1240 (43.79%), Postives = 787/1240 (63.47%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKI-----------------EKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASK-RDKWI-KEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSK-ERESQFEKALE-FPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLK---RKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPS-DTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM-----EGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDI-WTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            + +SR++ P +  VD+W++ L+   +T+E  LT QR WLYLE+IF   DI++QLP E+  F +++K W+ IM ++N++ NA     + GLLETF   N  L+ IQK L+ YLE+KR IFPRFYF+SND+LLEIL Q++NP  V PHL+KCFD+I+ L+                  EK+ +    A  M S +GE V   + L+  G VE WL  +E+ M  +LR L   C+ A+     K R  W+      Q+ +T SQI W  D+T+ L+     N  + L+  +K     L   +  ++ +L K+ R  + +L+ I+VH RDI+ +L +S    + +F+W  QLR+YW+ ++D+CV +   + + YGYEYLG   RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK MGR FSGLAQ+GAW CFDEFNRI+IEVLSV+AQQ+++I +A A+    +FMF+GR I LV +   FITMNPGYAGRTELPDNLK++FRP AM+ P+ A+IAE+ L++EGF   K+LA+K+  +Y L  +QLS+QDHYDFG+RA+ SVL  AG  KR NP + ++ +L+ ++ D NL K  + D  LF GI+SDLFPG+  P  DY  ++  I    +   LQP    + KV+Q YET   RH VM+VG T  GK+T +R+L   L  L K   E+ F +A++ + LNPKS+++GELYGE +  T EW DG+++  +R    DT  D KWII DGPVD LWIE+MN+V+DDNK+L L N ERI +  Q+ +LFEV++L VASPATVSRCGMV+ D  +L W PYV++W+K   +K+     E +  +F +Y+++  +FI   C + I     + V +LC L + L   ++G + + +    + ++   F FC +WS+  ++ E+     D +IR       +   PN   ++   +D   K    W E++   +KYN  VPF++++VPT DTVRY YL++ L+   H V+  G  G GK+ +A   LN++     +  + +N SAQTSS   Q+IIE+++E++ K+     G KR++ F+DD NMP  D +GSQPP+EL+RQ+ D+G +YDR K   K I+D+ +  A  PPGGGR  ++ R    F+++ +  P+E +LK+IF +++N  L DF   +K     I +A++E+YN + +  LPTP K HY+FNLRD+SK
Sbjct: 1071 LASSRYLGPLKTRVDEWQKQLALFNQTLEEWLTCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPAEGKIPGIDGEPEKVYTNDILA--MLSPEGERVSLGKGLKARGNVEEWLGKVEEAMFTSLRRL---CKAAIADYQGKLRTDWVVAGHPSQVILTVSQIMWCRDLTECLE-TEHSNHIQALKNFEKVNFERLNALAAIVQGSLPKLHRNILTALITIDVHARDIVTELVQSKVETVESFDWQRQLRYYWDIDLDNCVARMALSQYTYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKL-SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLNEDVVLIRALQDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVDVMNRQNLQPEMCMVRKVIQFYETMLVRHGVMLVGPTGGGKTTVYRILAETLGNLQKLGIENSFYQAVKTYVLNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMKGISKKLTEETQEYILNLFQRYVDEGLHFINKKCSQAIPQVDISKVTTLCCLLESLILGKDGVNLAMEQTKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIRTQFDDNPDARLPNSGDLWSIHMDFDTKRLDPW-ERIIPTFKYNRDVPFFEMLVPTTDTVRYGYLMEKLLAVKHSVLFTGITGVGKSVIAKGLLNKIQESAGYVPVYLNFSAQTSSARTQEIIESKLERKRKNILGAPGNKRIVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIISACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLSDFPPAVKQTASSIVEASVEIYNKMSVDLLPTPAKSHYVFNLRDLSK 2302          

HSP 2 Score: 979.163 bits (2530), Expect = 0.000e+0
Identity = 524/1239 (42.29%), Postives = 786/1239 (63.44%), Query Frame = 3
Query: 8214 ITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMS-----STDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGI-EDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQE---RIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDK-LANFHGL------------ITSFEQY--PRDWNLWYTSDSPETSSLPGE--------WDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            I RL+ HE  RVF DR++ ++DK  F  +L+E     F           +  IFGD++      +   Y+D+ DIEK    +++ LD+YN T    ++ LV F+DAIEH+S+I R+IRQ RGN LLVG+GG+G+QSLTRLAA++C Y   QIE+S+ Y    F +DL++LY  AGV++K  +FLF DTQ+V E FLEDINNIL+SGE+PNL+++DE++ +       AK  GI E     +F Y I +VR  +H+VLCMSPVGE FR+R RMFP+ VNC TIDWF +WP +ALL V++ +    Q+  G EE  +K  L  +   +H SVS M++R  +E++R  Y TPT+YLEL++ Y  +L EKRKQ+  + +++KNGL K+ ET   V+ M ++L  A + + + + E  + L+  +   +E+ DQ ++ +Q  E   ++K +E + +   + A  DL +A+PAL+AA +AL+SL+K DI+EI+ + KPP LV  VMEA+ IL  A+P W  AK+ LG+ +F+K+L+ +DK+NI  + L K+  Y+   DF P+ V KVS A KS+CMWV AM++Y RV +VVEPKRQ+L+AA++ L    A L   QA L  V ++++ LQ EY++ + +KE L K    T+  L RA KL + L  E+ RWE+++   E +I  + G+  IA+A ++Y G F + YR++L+  W +  +  +IP +PSFS I  L +P +IR WN  GLPRD  S ENG++VT+G RWPLM+DPQ QA +WI+  E K  LK+I L   +F+R+LE +I+ G PVLL+ ++E LDP+L+PIL K I   GG  +++LGD +I+Y+ +FRFY+TTK+PNPHY PE+  K  I+NF V + GLE QLL  VVR E+P LEEQ+  L++ I   K +L  +E++ILR+L  ++G++LD+E+L++TLQ SKITS  +  +L+ AE TE  I++AR+ Y   A + S+++FV+  L +IDPMYQ++L  +  LFN +I  S K+    +R+  L +      Y    RGLFE+HKL++SF +C ++++  G ++  E+NFFL+G   L++E       P WL    W    +L++    FHGL            + SFE Y  P+ W   Y+    E   +  E        W    + F ++++++  + ++V F  T F+I NLG +F+E P +D+  +  D S  T L+F+LS G
Sbjct: 2321 IFRLFCHECQRVFHDRLINNEDKHYFHVILTEMANKHFGIAIDLEYFLNKPIIFGDFIKFGADKADRIYDDMPDIEKTANVLQDYLDDYNLT-NPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCLQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDELEQVLAATRPRAKEVGISEGNRDEVFQYFISKVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKTFFS--QVDAGNEE--LKEKLPLMCVNVHLSVSSMAERYYNELRRRYYTTPTSYLELINLYLSMLSEKRKQIISARDRVKNGLTKLLETNILVDKMKLDLS-ALEPVLLAKSEDVEALMEKLAVDQESADQVRNTVQEDEATAKVKAEETQAIA--DDAQRDLDEALPALDAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDWPSAKQLLGDSNFLKRLLEYDKENIKPQILAKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKVVEPKRQKLRAAQAELDITMATLREKQALLRQVEDQIQALQDEYDKGVNEKESLAKTMALTKARLVRAGKLTAALEDEQVRWEESIQKFEEEISNITGNVFIAAACVAYYGAFTAQYRQSLIECWIQDCQSLEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKIIKLTDSNFLRILENSIRLGLPVLLEELKETLDPALEPILLKQIFISGGRLLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPRLEEQRIKLIVRINTDKNQLKTIEEKILRMLFTSEGNILDNEELIDTLQDSKITSGAIKTRLEEAESTEQMINVAREKYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSVKTENLQQRLDVLLEQTLLTAYVNVSRGLFEQHKLIYSFMLCVEMMRQQGTLSDAEWNFFLRGSAGLEKERPPKPEAP-WLPTATWFACCDLEESFPVFHGLTQNILSHPISIRLGSFETYINPQKWE-GYSKMKHEDKHMRQEKEAAHQDPWSAGLSSFHKLILIKCCKEEKVVFALTDFVIENLGKQFIETPPVDLPTLYQDMSCNTPLVFILSTG 3549          

HSP 3 Score: 87.8113 bits (216), Expect = 2.380e-15
Identity = 56/221 (25.34%), Postives = 108/221 (48.87%), Query Frame = 3
Query: 3864 NFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            N +S L  L+ +  + +     FK+E    + +  +  +L   + +W    EW+    +W   +F  L    +    +   +  T+  + L   +  ++   + +V++ +  +P+I DLRN  ++ RHW  I+  +     +     TLE++  L+     + I ++SG A+ E A+E  LK +E  W++ E  I+PH+D  K+ F+L G DD+   LDD+
Sbjct:  847 NLQSVLADLQKRAFQYKSYQKNFKVEVSKFEALEEVSAELKLKQLLWDSFSEWDKLQQEWLKSKFDCLDPEVLNGQVSKYAKFVTQLEKGLPPNS--VVPQLKYKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDATLVDAEIPLTLERLSQLHVFDFGQEIQDISGQASGEAALEAILKKVEDSWKTTEFVILPHRDS-KDVFILGGTDDIQVLLDDS 1064          
BLAST of Dynein heavy chain axonemal vs. UniProt/SwissProt
Match: sp|E9Q8T7|DYH1_MOUSE (Dynein heavy chain 1, axonemal OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1)

HSP 1 Score: 1031.94 bits (2667), Expect = 0.000e+0
Identity = 550/1256 (43.79%), Postives = 766/1256 (60.99%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASK-RDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERE---SQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKR--KVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLAT---VENGCDPSDTDNYSRV---IELWFQFCMIWSICCSVDEDGRKKIDNYIR------EMEGTFPNKDTIYEYFVD----------------NKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDR-LKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKL------QDFEEELKPIGDI------ITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            M  S + KPFE  ++ WE  L   QE +E  L  QR WLYLE IF  EDI +QLP ES  +  + + WR IM    + R        + LL++    N  L+ +QK L  YLETKR  FPRFYF+S+D+LLEIL Q+K+P  V PHL+KCF+NI  L    L  +  E + M+S++GEEV     +     VE WL ++E+ M+ ++ D++    +A+K   +  R +W+  W GQ+ I   Q  WT +V +AL+  A     K    + K+    L      +R  L+++QR+ +++L+VIEVH +D++ KL       ++ FEW+SQLR+YW K  DD  I+  N  F YGYEYLGNSGRLVITPLTDRCY+TLT ALHL  GG+P GPAGTGKTET KDLGK+L    +V NCS+ LD+ +MG+ F GLA  GAW CFDEFNRI+IEVLSVVAQQI +I  A       +FMF+G  I LVPS  +FITMNPGYAGRTELPDNLK++FRP+AM+ PD AMIAEI+L++ GF+   VLAKK+ T + LS +QLS QDHYDFG+RA+ +V+  AG  KR NP M +E I L ++ D+N+ K    DL LF GIVSDLFP I     DY  + +AI + C+   L+     + K +QLYET   RH +M+VG T SGKS  +R+L +A+  L  +       +E    + LNPKS+++G+LYGEFDL T+EWTDG+ SS++R     +  ++KW +FDGPVD +WIE+MN+V+DDNK L L +GE I + E ++++FEV++L+VASPATVSRCGMVY + + LG  P+VE WLKR   +     E+   +F KY+E   NF++    E+I ++ +N  +SL KL DC         G     ++  S +   IE WF F ++WS+  + D   R     ++R      +++  FP    +Y+Y +D                NK  SW  W +   A +       +  IIVPT+DTV+ +YL+  L+ N  PV+ +GP GTGKT    N L +     +    +  SA+TS+N  QD+I+++++KR K  F P  G+  + F+DD NMPA +T+G+QPP+EL+RQW+D+G WYDR +    K + D+    AMGPPGGGR  I+ RL   FN ++     E + KRIF  ++   +      + + E +    +I      +  ATI +Y  +  + LPTP K HY FNLRD+SK
Sbjct: 1192 MSFSPYKKPFEQRINSWETKLKLTQEVLEEWLNCQRAWLYLEPIFSSEDITRQLPVESKRYQTMERIWRKIMKNAYENREVINVCSDQRLLDSLRDCNKLLDLVQKGLSEYLETKRTAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARL----LFQEDLEITHMYSAEGEEVKLSFSIYPSSNVEDWLLEVERSMKASVHDIIE---MAIKAYPTMLRTEWVLNWPGQVTIAGCQTYWTMEVAEALE--AGNISSKLFPQLSKQ----LSDLVALVRGKLSRMQRMVLSALIVIEVHAKDVVSKLIDENVVSVHDFEWISQLRYYWTK--DDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVE-RFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNEANVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEETDYGILDQAIRRSCEKNNLKDVEGFLIKCIQLYETTVVRHGLMLVGPTGSGKSNCYRVLAAAMTLLKGKPSISGGVYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSLIRAGAIASDTNKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFVECWLKRLPAIIKPYEEQFKSLFTKYLENSINFVRNTVKEVIASTNSNLTMSLLKLLDCFFRPFLPREGLKKIPSEKLSHIPELIEPWFIFSLVWSVGATGDHTSRISFSQWLRLKMRLEQVKLGFPEDGLVYDYRLDDAGISSTEDDDEEEDENKQVSWVKWMD-YSAPFTMMPDTNYCNIIVPTMDTVQMSYLLGMLLTNHKPVLCIGPTGTGKTLTVSNKLLKYLPLEYISHFLTFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKVIGAFKNLVDINFVCAMGPPGGGRNAITPRLTRHFNYLSFIEMDEVSKKRIFSIILECWMDGLLGEKSYREPVPGAPNIDDLTEPLVDATINVYGIITSQLLPTPAKSHYTFNLRDLSK 2430          

HSP 2 Score: 957.207 bits (2473), Expect = 0.000e+0
Identity = 524/1246 (42.05%), Postives = 764/1246 (61.32%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSS---TDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKRE---ADDQAKSVMQTQERIKVDEA--KCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPT--------------WAEAKKHLGEQD-FIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q ML       + K  + RLW HEN RVF DR+V ++D+  F ELL  ++   F   F+ +CP  Q  ++GD+MS      +YE IT   K+ + ++E +++YN      ++ LVLF DA+ HI +I R +RQ  GN LL+G+GGSGR SLTRLA++M EY  FQIE+SK+Y   E+R+D+K++  +AG+ N P  FLF+DTQ+ +ESFLEDINN+L+SG+IPN+Y  DE D + N +    +  G++ T  ++      RVR N+H+VLCMSP+GE FR R+R FP+ VNC TIDWF+EWP +AL  VA  +L ++      EE  +   L  +   +H+SV+      L E+ RHNYVTP +YLEL++ + IL+ +K+ +L  + N++K+GL K+  T   V  M  ELE  R    + ++   D ++ + Q K +   A++  KSV    E IK +E   K   + + A  DL +A+PAL+AA+ +L +LNK D+TE+++  +PP  V+ V+EAV I++G +P               W   K  L +   F++ L  FDKDNI +  +K I  Y+  ++FQP  + KVS A  S+C WV AM  Y  V + VEPKRQ L+ A+  L   Q  L  A+  L  V + +  +Q +Y E + +KEEL  K E  E+ L RA KL++GLA EK RW++TV +LEN +  + GD L+A+ F++Y+GPF   YR  L   W   +    +P     + I  L NP +IR W I GLP D  SVENGVI     RW   +DPQ QA KWIK ME +  L V  L   DF+R +E AI+FG+P LL+NV E+LDP+L+P+L K   K  G  V+KLGD  I Y+ DFR YITTKLPNPHY+PEISTK  ++NF +   GLE QLLG VV +ERP+LEE K+ L++S A  +++L ++ED+IL  L+ ++G+ +DD +L+  L+ SK+ + E+  +++IAE+TE  ID+ R  Y   A R  ILFF ++DL  +DPMYQ++L+ ++++F   I  S ++    +RI N+N Y T+++Y   CR LFEKHKL+F+F +C +I+   GK+N  E+ + L GG +   +   +NP P WLSD+AW +I  L  L  F      F  Y  ++   + S  P    LPG W+   +EFQ++LI+R LR D+V+     F+  +L  +F+EP   ++  V  +S++ T LIFVLSPG
Sbjct: 2433 QGMLMAEPSKVEDKVQLLRLWYHENCRVFRDRLVNEEDRSWFDELLEAQMEE-FGVAFNKVCPF-QPILYGDFMSPGSDVKSYELITSESKMMQVIEEYMEDYNQI-NTAKLRLVLFVDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWREDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNIYSADEQDQIINTMRPYIQEQGLQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATTFLSEIPELECSEE--VIQGLIQVCVFIHQSVASKCVEYLAELARHNYVTPKSYLELLNIFSILIGQKKMELKTAKNRMKSGLDKLLRTSEDVAKMQEELEIMR---PLLEEAAKDTMLTMEQIKVDTAIAEETRKSVQA--EEIKANEKANKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGSKVDDYWEPGKGLLQDPGRFLESLFKFDKDNIGEAVIKAIQPYIDNEEFQPAAIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALREAQDDLEVTQRILEEAKHHLHEVEDGIATMQAKYRECVAKKEELEMKCEQCEQRLGRADKLINGLADEKVRWQETVENLENMLDNIFGDVLVAAGFVAYLGPFTGQYRTTLYEYWVNQLTVHHVPHTSKPTLITTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQGQANKWIKNMERESGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNIVLKLGDTVIPYHEDFRMYITTKLPNPHYSPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIVSNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAVRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRIVNINRYLTFSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQAEWRYLLSGGSI---QTMFENPAPQWLSDRAWRDILALSNLPTFATFSNDFVMYLSEFQAIFDSAEPHRELLPGIWNAYLDEFQKLLILRCLRGDKVTNAMQDFVATHLEPRFIEPQTANLSAVFKESNSTTPLIFVLSPG 3665          

HSP 3 Score: 104.76 bits (260), Expect = 1.832e-20
Identity = 128/582 (21.99%), Postives = 248/582 (42.61%), Query Frame = 3
Query: 2874 INGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKKSIWE--FISTDDE----------ITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEE---FISQY---CDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFI-ILDKYEVQYSDDIRLKKQNLEKEW------QEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSAL---IMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQ-WKSGRFIELKTIEMENLANSSFRKATKFSRDLKD--KNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            +N   +   +PLF V L L    + +   L     I+ +L    I     +P         +L+K + E  FIS D            + +++ NI + M      +Q    Y  ++R+  ELN  +   F+  Y   C     V  +     +  E+ + +L +  ++   ++ +D   +K S++   +     + ++L     K +  +    +++S K+ + P ++EEL E       L +    I EK   L+E  + ++  YEV       L   +   +W       + L  +    Q   + ++KF+   L+  ++F++++  L   +  F  +   A +    E   ++   K  L+  +           +F +      +++ + K+     ++W  A +W   W++ W +     +   ++E     SF+   K  +  KD     E+    R R+++F+  +PLI  LRN  MR+RHW  + NEI        ++ T  + +++N   H E I++V+  A KE AIE AL  MEK W S+   ++P+  KE + ++L   D+  Q LDD+
Sbjct:  632 VNSPYKPRKNPLFIVDLVLDNSGVHYSTPLEHFEMILLNLFDKGILATHAVP---------QLEKLVMEDIFISGDPLLESVGLHEPLVEELRANITNAMHKAMMPLQ---AYAKEYRKYLELNNNDISTFLKTYQTQCPSAEEVREVVITHLKEKEILDNSLPSSIIIGPFYINVD--NVKQSLSKKRKALATSMLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAE-------LRDWMKGIPEKLVFLEERIVKVMSDYEVMDEFFYNLTTDDFNDKWAANNWPSKILGQIDMVRQQHVEDEEKFRKIQLMDQNNFQEKLEGLQLVVAGFSIHVEIARA---HEIANEVRRVKKQLKDCQQLAMLYNNRERIFGLPITNYDKLSRMVKEFQPYLDLWTTASDW-LRWSESWMNDPLSAIDAEQLEKNVIESFKTMHKCVKQFKDIPACQEVALDIRTRIEEFKPYIPLIQGLRNPGMRNRHWEVLSNEININV-RPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSSILFNVLPY--KETDTYILKSPDEASQLLDDH 1185          
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Match: A0A1S8WJ22 (ATPase family protein OS=Opisthorchis viverrini OX=6198 GN=X801_09949 PE=4 SV=1)

HSP 1 Score: 1954.87 bits (5063), Expect = 0.000e+0
Identity = 916/1230 (74.47%), Postives = 1077/1230 (87.56%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIG--------GEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +LR +K   +T+ S+ RLWIHE  RVFADR++ DKD+ A+V+L+ + L + FDQT+H++CP +QSPIF D++++   YEDITD+++L++F+ + L EYN TPG V MDLVLFRDAIEH  K+ RV++QPRGNMLLVGIGGSGRQSL+RLAAY+CE+  FQIEV+K YRKQEFR+D+KR+Y+QAGV+N+PTLF+F DTQVV+ESFLEDINN+LSSGE+P LYK DE +++R  L D AK++G+ ++TQSIF + I+RVR N+H+VLCMSP+GEPFRNR+RMFPAFVNCTTIDWFSEWPL+ALLEVAE+YL D+ L +           E+R++  +  IF+ MHRSV+DM+  ML E++RH YVTPTNYLELV+GYK+LL +KR++LSD ANKL NGLGKIDETR KVEVMS+ELE+ARKK+A FQKECDDYLV+IVQQKREAD+QAK+V+QTQE+IKVDE KC+ M ELA+ADLAQAMPALEAAMQALE+LNKKDITEIKSYGKPP LVQKVMEAVMILRGAEPTWAE+++ LGEQDFIKQL+NFDKDNI+DRTLKKIG Y AQDDF PD+VGKVS AAKSLCMWV A+EVYGRVYRVVEPKRQRLQ AE+VLREKQ  LAAAQAKLD V  +M+RLQQEYNEKMEQKEELR KAEHTEKMLDRASKLVSGLAGEK RWE TVADL  +I LLPGDCL+A+ FLSYMGPFLS+YRE LV  W   ++ E  PA+  F F EFL++PTQ+R+WN+QGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIK MEGK L+VIDL MPD+IRVLE A+QFGQPVL+QN+ E LD +LDP+L KS+ KIGG  +M+LGDKEIEYN +FRFY+TTKLPNPHY PE+  KT +VNFAVK+QGLEAQLLGIVVRKERPELEEQKDNLV+ IAAGKRKL ELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQ+AEKTE  ID AR+GY  CA+RASILFF+LNDLG+IDPMYQFALD YIDLF++SI+KS +S K ++RI +LNDYHTYAVY Y CRGLFE+HKLLFSFQIC KIL+ +GK+N DEYNFFL+GG+VLDR+NQ+DNPC  WLS+Q WDNI+ELDKL N+HGL+TSFEQYPRDW++W+T+  PETS LPGEWDN TNEFQRMLIVRSLRPDRV+FCATSFI +NLG++FVEPPVLDMKQVV+DS+ +T LIFVLS G
Sbjct: 2242 QGLLRASKSQIETRTSMLRLWIHEGLRVFADRLINDKDRTAYVDLVGDALATHFDQTYHSLCPARQSPIFADFLNAEGEYEDITDLDRLRRFLADTLREYNETPGTVPMDLVLFRDAIEHTCKLTRVLKQPRGNMLLVGIGGSGRQSLSRLAAYICEFKIFQIEVTKVYRKQEFREDVKRMYFQAGVENQPTLFIFTDTQVVEESFLEDINNLLSSGEVPTLYKPDEFEEVRQALLDTAKQEGVSESTQSIFQFFIERVRSNLHIVLCMSPIGEPFRNRMRMFPAFVNCTTIDWFSEWPLEALLEVAEKYLNDVSLIVSEPDPQILVKRENRLRASIVKIFANMHRSVADMALLMLAELRRHVYVTPTNYLELVAGYKVLLYQKRQELSDKANKLANGLGKIDETREKVEVMSVELEDARKKVAAFQKECDDYLVIIVQQKREADEQAKAVIQTQEKIKVDEVKCMHMAELAMADLAQAMPALEAAMQALEALNKKDITEIKSYGKPPFLVQKVMEAVMILRGAEPTWAESRRQLGEQDFIKQLVNFDKDNINDRTLKKIGLYCAQDDFHPDVVGKVSTAAKSLCMWVRAIEVYGRVYRVVEPKRQRLQQAEAVLREKQEMLAAAQAKLDEVNAQMRRLQQEYNEKMEQKEELRLKAEHTEKMLDRASKLVSGLAGEKLRWESTVADLSARIELLPGDCLLAAGFLSYMGPFLSEYREKLVRNWLTLVRAEAAPASDPFVFTEFLADPTQVREWNLQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKSMEGKALRVIDLQMPDYIRVLETAVQFGQPVLMQNIHEHLDQALDPVLKKSLAKIGGVLIMRLGDKEIEYNENFRFYLTTKLPNPHYAPEVCAKTTVVNFAVKQQGLEAQLLGIVVRKERPELEEQKDNLVIGIAAGKRKLTELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQVAEKTEVQIDTAREGYRPCAERASILFFILNDLGRIDPMYQFALDGYIDLFHLSIDKSPRSGKLEDRIVHLNDYHTYAVYRYTCRGLFERHKLLFSFQICVKILEAAGKLNQDEYNFFLRGGIVLDRDNQLDNPCNSWLSEQCWDNITELDKLPNYHGLVTSFEQYPRDWHMWFTAAEPETSPLPGEWDNTTNEFQRMLIVRSLRPDRVAFCATSFITSNLGSRFVEPPVLDMKQVVEDSNTRTPLIFVLSTG 3471          

HSP 2 Score: 1697.56 bits (4395), Expect = 0.000e+0
Identity = 799/1049 (76.17%), Postives = 918/1049 (87.51%), Query Frame = 1
Query: 5044 EASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALA----SNAP---PKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            EA SM+S DGEEV FK K+RLEGPVE+WLCD+E+ M  TLRD+LR+CR ALKKAA+KR+K++K+W GQ+CITSSQIQWTADVT+ALQ V QR DKKPL+ ++ KQ+ +LEKFSE IRSNLTKIQRLKIN LVVIEVHQRDIIEKLYKSGC+DINAF+WLSQLRFYW+KE DDC ++QTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGK+LG YVIVVNCSEGLDYKSMGRMF+GLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALA    S++P    +FMF GRM+ LV S GIFITMNPGYAGRTELPDNLKSMFRPIAMV PDS+MIAEITLFAEGF   K+LAKKVFTLYSL+IQQLSKQDHYDFGLRALVSVLRYAGRKKR+NP MPDEE+LLLS+NDMNLAKLTSVDLPLFKGI++DLFPG+++P +DYT +K A+E  C +  L+   FT+ K +QLYETK+SRHSVMIVGKTLSGKSTTWR+LQ+    L+K  E  FE+  E+PLNPK+VSLGELYGEF+L TNEWTDGVLSSVMR+TCAD  P  KWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISM EQVSLLFEVE+L+VASPATVSRCGMVYND +DLGW PYV SWL  K D  LV+E  R+F+KYIE +  +IK NC  L+  S TN+VISLC+LFD LAT E   DP+DTD Y+R++E+ FQFCMIWS+CC VDEDGRKKID+YIRE+EG+FPNKD+IYEY VD K  +W HW+EKL+ GWKY  + PFYKI+VPTVDTVRY +L   LV N +P++L+GPVGTGKTS+AVN LN L+ +IWT LTINMSAQTSS+NVQDIIE RVEKRTKDTFVP+GG  MLTFMDDFNMPAKD FGSQPPLEL+RQW+DYGFWYDR+KQT +++ +MYL  +MGPPGGGRM+IS RLQ+RFN I +TFPTES+LKRI+GSM+ QKL +FE+++K + + + QA+I++YN V+ KFLPTPTK+HYLFNLRDISK
Sbjct: 1191 EALSMYSMDGEEVPFKTKVRLEGPVESWLCDVEEQMYKTLRDMLRECRFALKKAATKREKFVKDWPGQMCITSSQIQWTADVTRALQLVGQRQDKKPLKSLRHKQRNMLEKFSEMIRSNLTKIQRLKINGLVVIEVHQRDIIEKLYKSGCNDINAFDWLSQLRFYWDKEPDDCFVRQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGDYVIVVNCSEGLDYKSMGRMFAGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALALAAQSSSPMEKTRFMFDGRMLQLVWSCGIFITMNPGYAGRTELPDNLKSMFRPIAMVVPDSSMIAEITLFAEGFGSTKLLAKKVFTLYSLTIQQLSKQDHYDFGLRALVSVLRYAGRKKRSNPTMPDEEVLLLSLNDMNLAKLTSVDLPLFKGIMTDLFPGVEAPNIDYTKIKNAVESTCKSMNLRMIPFTLNKAIQLYETKSSRHSVMIVGKTLSGKSTTWRILQNVHNNLAKAGEPGFERVQEYPLNPKAVSLGELYGEFNLATNEWTDGVLSSVMRQTCADDTPTLKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMSEQVSLLFEVEDLAVASPATVSRCGMVYNDAHDLGWWPYVNSWLAAKQDKTLVDETRRLFEKYIENLHQYIKQNCNTLVPMSETNTVISLCRLFDGLATPEAWVDPADTDYYTRLVEMTFQFCMIWSVCCMVDEDGRKKIDSYIREIEGSFPNKDSIYEYCVDPKGHTWIHWEEKLRGGWKYQPNEPFYKILVPTVDTVRYQFLASQLVGNHNPILLIGPVGTGKTSLAVNILNSLDPNIWTNLTINMSAQTSSSNVQDIIEGRVEKRTKDTFVPIGGTNMLTFMDDFNMPAKDAFGSQPPLELVRQWLDYGFWYDRVKQTIRKVTNMYLLASMGPPGGGRMVISRRLQARFNQIVITFPTESSLKRIYGSMLTQKLLEFEDDVKSMSESLLQASIDLYNMVINKFLPTPTKMHYLFNLRDISK 2239          

HSP 3 Score: 971.844 bits (2511), Expect = 0.000e+0
Identity = 462/801 (57.68%), Postives = 614/801 (76.65%), Query Frame = 3
Query: 2145 RDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKK-SIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            +DPLK+L+ +LL RS +   +++ N + A+ KLF ELHYW RL  +VP  AA+ + RR ELR   E VLL+VRDYNRI+ +LN+EER+LF+E+IK LDKK+ PG  K+ W+ KG +E FV+D R+ A++LQ KVD+YKTAN+DI+  CE I+  L+I+++ NR+YENTEF+D Q AHRA+ K KL  LH  I+ QMR+  E F  +S+DIQ YW  Y  ++D++CEEAFRLNVK SL+EL +AINGDGRN+P+PLFKV+LNL    LVF+PTLP+LTN+V SLG  F E++  +PR+ ++L ++K  K  I + I+ D+EI KIQ +I+ GMQ+ISS++QEPL YWDQFREIWEL K++FI +Y  LNPHV SIDADI+RYTEVTNK  DAE MVT +FLQLDFS+LKN+IAAHCRDWQQ+LTNLLL M T SL  ++ Y++  SE++SK PQNL+EL ES++LL+++  E++ IQ KF PL+E F ILDK EV Y+D +  ++ NL  +W +F   L+ AEQMIKK K+KFKTGLL  S++FK+ V+ L+ + Q+ GP++A + PQ AL  +A F+  L+ LK +E E+R GLNLFKIEQPP KEIA +EKDL+ ++ IW +  EWE NW  WK GRF EL+T EMENLAN+ FRK  K SRDLKD+NWE+IE +R RVDQFRRTMPLI DLRN AMR RHW Q+K E+ KQFDE S+DFTLE+I+ L F+QHAE+I+E+SGAA+KELAIE+ L  ME+LW++ EL+++P+  KEKN + L   ++++Q L+DN+  LS 
Sbjct:   14 QDPLKALETSLLLRSSMQLCLIEPNLNAAVPKLFNELHYWIRLGVEVPPNAAEAFRRRHELRYLVELVLLIVRDYNRIMNSLNSEERALFRERIKILDKKLAPGFTKLHWTVKGLVEMFVSDVRVQASKLQGKVDDYKTANEDIKGNCEQIARTLLIRLEPNRVYENTEFDDCQSAHRAITKIKLFNLHEGIVQQMRQVKETFVSESADIQLYWGRYTERMDRYCEEAFRLNVKLSLSELQRAINGDGRNDPNPLFKVALNLDNDVLVFLPTLPQLTNVVASLGNKFTEIISAVPRLPDLLTRMKSSKVPICDAIANDEEINKIQASIKRGMQEISSAVQEPLSYWDQFREIWELPKDDFIQRYRQLNPHVSSIDADIARYTEVTNKVQDAETMVTTRFLQLDFSLLKNAIAAHCRDWQQRLTNLLLDMTTDSLNGIYTYIETSSERISKPPQNLDELSESIQLLERILTEQHDIQAKFGPLEEQFAILDKCEVTYTDSVAARRANLANDWIQFQNTLLAAEQMIKKCKEKFKTGLLGDSEEFKRAVANLLAELQSTGPYSADLAPQTALDAVAGFRERLDKLKARELELRHGLNLFKIEQPPCKEIAVIEKDLEYLDVIWTMNYEWEKNWEIWKYGRFCELQTTEMENLANTVFRKFVKLSRDLKDRNWEVIESSRIRVDQFRRTMPLIMDLRNPAMRSRHWVQLKLEMNKQFDENSADFTLERIVQLGFEQHAEIIHEISGAASKELAIEHTLDNMERLWQNNELDMVPY--KEKNTYKLRSTEEVFQALEDNQVQLST 812          

HSP 4 Score: 236.884 bits (603), Expect = 0.000e+0
Identity = 113/168 (67.26%), Postives = 134/168 (79.76%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQ 5037
            L  MK SRFV+PFE  VD+WER LS I ET+E LL+VQRQ+LYLE IFLGEDIRKQLPKES+ FD +N  W+ I   L + RN RAC  K GLL+  N +   LE+IQ+SLDMYLETKR IFPRFYF++N+DLLEILGQ +NPD V+PH+KKCFDNINSLKIEK+ S+
Sbjct:  810 LSTMKASRFVRPFEVLVDRWERLLSLIMETLEQLLSVQRQYLYLETIFLGEDIRKQLPKESSAFDAVNMDWQSITAFLYETRNTRACTTKPGLLDNLNRLVNSLEEIQQSLDMYLETKRQIFPRFYFLANEDLLEILGQGRNPDAVMPHMKKCFDNINSLKIEKVHSR 977          
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Match: A0A074ZWJ9 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_13739 PE=4 SV=1)

HSP 1 Score: 1954.87 bits (5063), Expect = 0.000e+0
Identity = 916/1230 (74.47%), Postives = 1077/1230 (87.56%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIG--------GEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +LR +K   +T+ S+ RLWIHE  RVFADR++ DKD+ A+V+L+ + L + FDQT+H++CP +QSPIF D++++   YEDITD+++L++F+ + L EYN TPG V MDLVLFRDAIEH  K+ RV++QPRGNMLLVGIGGSGRQSL+RLAAY+CE+  FQIEV+K YRKQEFR+D+KR+Y+QAGV+N+PTLF+F DTQVV+ESFLEDINN+LSSGE+P LYK DE +++R  L D AK++G+ ++TQSIF + I+RVR N+H+VLCMSP+GEPFRNR+RMFPAFVNCTTIDWFSEWPL+ALLEVAE+YL D+ L +           E+R++  +  IF+ MHRSV+DM+  ML E++RH YVTPTNYLELV+GYK+LL +KR++LSD ANKL NGLGKIDETR KVEVMS+ELE+ARKK+A FQKECDDYLV+IVQQKREAD+QAK+V+QTQE+IKVDE KC+ M ELA+ADLAQAMPALEAAMQALE+LNKKDITEIKSYGKPP LVQKVMEAVMILRGAEPTWAE+++ LGEQDFIKQL+NFDKDNI+DRTLKKIG Y AQDDF PD+VGKVS AAKSLCMWV A+EVYGRVYRVVEPKRQRLQ AE+VLREKQ  LAAAQAKLD V  +M+RLQQEYNEKMEQKEELR KAEHTEKMLDRASKLVSGLAGEK RWE TVADL  +I LLPGDCL+A+ FLSYMGPFLS+YRE LV  W   ++ E  PA+  F F EFL++PTQ+R+WN+QGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIK MEGK L+VIDL MPD+IRVLE A+QFGQPVL+QN+ E LD +LDP+L KS+ KIGG  +M+LGDKEIEYN +FRFY+TTKLPNPHY PE+  KT +VNFAVK+QGLEAQLLGIVVRKERPELEEQKDNLV+ IAAGKRKL ELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQ+AEKTE  ID AR+GY  CA+RASILFF+LNDLG+IDPMYQFALD YIDLF++SI+KS +S K ++RI +LNDYHTYAVY Y CRGLFE+HKLLFSFQIC KIL+ +GK+N DEYNFFL+GG+VLDR+NQ+DNPC  WLS+Q WDNI+ELDKL N+HGL+TSFEQYPRDW++W+T+  PETS LPGEWDN TNEFQRMLIVRSLRPDRV+FCATSFI +NLG++FVEPPVLDMKQVV+DS+ +T LIFVLS G
Sbjct: 3330 QGLLRASKSQIETRTSMLRLWIHEGLRVFADRLINDKDRTAYVDLVGDALATHFDQTYHSLCPARQSPIFADFLNAEGEYEDITDLDRLRRFLADTLREYNETPGTVPMDLVLFRDAIEHTCKLTRVLKQPRGNMLLVGIGGSGRQSLSRLAAYICEFKIFQIEVTKVYRKQEFREDVKRMYFQAGVENQPTLFIFTDTQVVEESFLEDINNLLSSGEVPTLYKPDEFEEVRQALLDTAKQEGVSESTQSIFQFFIERVRSNLHIVLCMSPIGEPFRNRMRMFPAFVNCTTIDWFSEWPLEALLEVAEKYLNDVSLIVSEPDPQILVKRENRLRASIVKIFANMHRSVADMALLMLAELRRHVYVTPTNYLELVAGYKVLLYQKRQELSDKANKLANGLGKIDETREKVEVMSVELEDARKKVAAFQKECDDYLVIIVQQKREADEQAKAVIQTQEKIKVDEVKCMHMAELAMADLAQAMPALEAAMQALEALNKKDITEIKSYGKPPFLVQKVMEAVMILRGAEPTWAESRRQLGEQDFIKQLVNFDKDNINDRTLKKIGLYCAQDDFHPDVVGKVSTAAKSLCMWVRAIEVYGRVYRVVEPKRQRLQQAEAVLREKQEMLAAAQAKLDEVNAQMRRLQQEYNEKMEQKEELRLKAEHTEKMLDRASKLVSGLAGEKLRWESTVADLSARIELLPGDCLLAAGFLSYMGPFLSEYREKLVRNWLTLVRAEAAPASDPFVFTEFLADPTQVREWNLQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKSMEGKALRVIDLQMPDYIRVLETAVQFGQPVLMQNIHEHLDQALDPVLKKSLAKIGGVLIMRLGDKEIEYNENFRFYLTTKLPNPHYAPEVCAKTTVVNFAVKQQGLEAQLLGIVVRKERPELEEQKDNLVIGIAAGKRKLTELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQVAEKTEVQIDTAREGYRPCAERASILFFILNDLGRIDPMYQFALDGYIDLFHLSIDKSPRSGKLEDRIVHLNDYHTYAVYRYTCRGLFERHKLLFSFQICVKILEAAGKLNQDEYNFFLRGGIVLDRDNQLDNPCNSWLSEQCWDNITELDKLPNYHGLVTSFEQYPRDWHMWFTAAEPETSPLPGEWDNTTNEFQRMLIVRSLRPDRVAFCATSFITSNLGSRFVEPPVLDMKQVVEDSNTRTPLIFVLSTG 4559          

HSP 2 Score: 1707.96 bits (4422), Expect = 0.000e+0
Identity = 833/1532 (54.37%), Postives = 1107/1532 (72.26%), Query Frame = 3
Query:  108 NKSNLETESLNITVTDEAVEINPNKEEQNEIFYEDDG------------TAELVMSYEEIPKSTPPDEEKSVIDLIRQRIRLSGYVEIENWTADHALQVQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRE-----------------TIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSN-ADFRQQYTQLSVALEEVVRKTHIEFMSGLD---------------------------RDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKK-SIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNR 4529
            N SN E  +L +  +    ++  ++E + EIF E D              AE + S ++ PK       + + D+IR RI L+G+  I++W+   A  + D+F +     L  Y++ KN L++    P    +EL YFI   G + + + ++NF   + +GTV GRGI+SLLRIM  I+AP++F+N  WPDSIKNDFSLQLQRFMSALTDARWKLE KTVLY+P E      E  AK KD +NR EMI+IHWTRQIK VL++QN  ++ E +GPLDEIE+W+NRC+DL+GISKQLDK  VK+IT IL  AKSSYV AF++LA EIKFNTQQAQSNL+FLNTLK+MCH L++S P +IP  L ++I+ IRMIWVNS+HYN+++ +TGMFRK+SNEII RCC  + LD+IFDG+++SS   L++CI CCE+YK IYDK+  +H  +S+ PW+  K +IFAQ+DAFIQRC+DL+EICECQ +F R+E+G K  MPIFQGARG E+E+++  IE +F   +R L D++++ILDVKATSWHDDYNRFR G+KDLEVM QNAI TAFETVTTIQQG+EILDVFAHLQ+RE                  IRRT D     +  +  +  N VKKE+      GLP P+   YAG  ++ R LR+R+E+ ML+LDQAFFL ++++   + RQQY+Q   ALE++ RKT +EF S +D                           +DPLK+L+ +LL RS +   +++ N + A+ KLF ELHYW RL  +VP  AA+ + RR ELR   E VLL+VRDYNRI+ +LN+EER+LF+E+IK LDKK+ PG  K+ W+ KG +E FV+D R+ A++LQ KVD+YKTAN+DI+  CE I+  L+I+++ NR+YENTEF+D Q AHRA+ K KL  LH  I+ QMR+  E F  +S+DIQ YW  Y  ++D++CEEAFRLNVK SL+EL +AINGDGRN+P+PLFKV+LNL    LVF+PTLP+LTN+V SLG  F E++  +PR+ ++L ++K  K  I + I+ D+EI KIQ +I+ GMQ+ISS++QEPL YWDQFREIWEL K++FI +Y  LNPHV SIDADI+RYTEVTNK  DAE MVT +FLQLDFS+LKN+IAAHCRDWQQ+LTNLLL M T SL  ++ Y++  SE++SK PQNL+EL ES++LL+++  E++ IQ KF PL+E F ILDK EV Y+D +  ++ NL  +W +F   L+ AEQMIKK K+KFKTGLL  S++FK+ V+ L+ + Q+ GP++A + PQ AL  +A F+  L+ LK +E E+R GLNLFKIEQPP KEIA +EKDL+ ++ IW +  EWE NW  WK GRF EL+T EMENLAN+ FRK  K SRDLKD+NWE+IE +R RVDQFRRTMPLI DLRN AMR RHW Q+K E+ KQFDE S+DFTLE+I+ L F+QHAE+I+E+SGAA+KELAIE+ L  ME+LW++ EL+++P+  KEKN + L   ++++Q L+DN+
Sbjct:  281 NHSNTEETALRLGHSSPDEDVQEDEEVKKEIFLEPDDEFLGFTTNPDLEGAEYLESIDDAPKPGIVKPSQPISDMIRDRIYLTGFEPIKHWSEQIAQHINDDFGSGEKLQLFIYLNRKNELRVTFDVPMHWYSELNYFIHIPGAEGKTLTSDNFDVRVHYGTVVGRGIESLLRIMSTIFAPAFFANKTWPDSIKNDFSLQLQRFMSALTDARWKLENKTVLYMPTEKIERDSEIEAKNKDLVNRFEMIVIHWTRQIKAVLNSQNTADEVEGTGPLDEIEFWRNRCEDLTGISKQLDKAEVKNITDILTAAKSSYVAAFIRLADEIKFNTQQAQSNLQFLNTLKEMCHQLAESTPREIPPKLPRIISVIRMIWVNSKHYNTKEIITGMFRKLSNEIINRCCSVISLDDIFDGKVISSSNNLRHCITCCEEYKAIYDKLQKIHSRHSAFPWDAQKGSIFAQVDAFIQRCRDLLEICECQKNFGRYEEGTKTTMPIFQGARGPELEVLLNTIEQMFGKLMRNLYDKRTSILDVKATSWHDDYNRFRVGIKDLEVMMQNAINTAFETVTTIQQGVEILDVFAHLQSREFGLVAGVHHRLSIVIFQAIRRTIDNKTHELVARFGEILNQVKKEMTQRIYGGLPMPTEAHYAGQGLYWRFLRRRLEKTMLSLDQAFFLSLAAAGMTEHRQQYSQTLAALEDMTRKTFLEFQSTIDQGRFDYLQKQFYHFMQGTSRLTDFFTLQDPLKALETSLLLRSSMQLCLIEPNLNAAVPKLFNELHYWIRLGVEVPPNAAEAFRRRHELRYLVELVLLIVRDYNRIMNSLNSEERALFRERIKILDKKLAPGFTKLHWTVKGLVEMFVSDVRVQASKLQGKVDDYKTANEDIKGNCEQIARTLLIRLEPNRVYENTEFDDCQSAHRAITKIKLFNLHEGIVQQMRQVKETFVSESADIQLYWGRYTERMDRYCEEAFRLNVKLSLSELQRAINGDGRNDPNPLFKVALNLDNDVLVFLPTLPQLTNVVASLGNKFTEIISAVPRLPDLLTRMKSSKVPICDAIANDEEINKIQASIKRGMQEISSAVQEPLSYWDQFREIWELPKDDFIQRYRQLNPHVSSIDADIARYTEVTNKVQDAETMVTTRFLQLDFSLLKNAIAAHCRDWQQRLTNLLLDMTTDSLNGIYTYIETSSERISKPPQNLDELSESIQLLERILTEQHDIQAKFGPLEEQFAILDKCEVTYTDSVAARRANLANDWIQFQNTLLAAEQMIKKCKEKFKTGLLGDSEEFKRAVANLLAELQSTGPYSADLAPQTALDAVAGFRERLDKLKARELELRHGLNLFKIEQPPCKEIAVIEKDLEYLDVIWTMNYEWEKNWEIWKYGRFCELQTTEMENLANTVFRKFVKLSRDLKDRNWEVIESSRIRVDQFRRTMPLIMDLRNPAMRSRHWVQLKLEMNKQFDENSADFTLERIVQLGFEQHAEIIHEISGAASKELAIEHTLDNMERLWQNNELDMVPY--KEKNTYKLRSTEEVFQALEDNQ 1810          

HSP 3 Score: 1657.5 bits (4291), Expect = 0.000e+0
Identity = 799/1126 (70.96%), Postives = 918/1126 (81.53%), Query Frame = 1
Query: 5044 EASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQ---------------------------------NVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNR----------------INIEVLSVVAQQILSILSALA----SNAP---PKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCA----------------------------DTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            EA SM+S DGEEV FK K+RLEGPVE+WLCD+E+ M  TLRD+LR+CR ALKKAA+KR+K++K+W GQ+CITSSQIQWTADVT+ALQ                                  V QR DKKPL+ ++ KQ+ +LEKFSE IRSNLTKIQRLKIN LVVIEVHQRDIIEKLYKSGC+DINAF+WLSQLRFYW+KE DDC ++QTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGK+LG YVIVVNCSEGLDYKSMGRMF+GLAQTGAWGCFDEFNR                INIEVLSVVAQQILSILSALA    S++P    +FMF GRM+ LV S GIFITMNPGYAGRTELPDNLKSMFRPIAMV PDS+MIAEITLFAEGF   K+LAKKVFTLYSL+IQQLSKQDHYDFGLRALVSVLRYAGRKKR+NP MPDEE+LLLS+NDMNLAKLTSVDLPLFKGI++DLFPG+++P +DYT +K A+E  C +  L+   FT+ K +QLYETK+SRHSVMIVGKTLSGKSTTWR+LQ+    L+K  E  FE+  E+PLNPK+VSLGELYGEF+L TNEWTDGVLSSVMR+TCA                            D  P  KWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISM EQVSLLFEVE+L+VASPATVSRCGMVYND +DLGW PYV SWL  K D  LV+E  R+F+KYIE +  +IK NC  L+  S TN+VISLC+LFD LAT E   DP+DTD Y+R++E+ FQFCMIWS+CC VDEDGRKKID+YIRE+EG+FPNKD+IYEY VD K  +W HW+EKL+ GWKY  + PFYKI+VPTVDTVRY +L   LV N +P++L+GPVGTGKTS+AVN LN L+ +IWT LTINMSAQTSS+NVQDIIE RVEKRTKDTFVP+GG  MLTFMDDFNMPAKD FGSQPPLEL+RQW+DYGFWYDR+KQT +++ +MYL  +MGPPGGGRM+IS RLQ+RFN I +TFPTES+LKRI+GSM+ QKL +FE+++K + + + QA+I++YN V+ KFLPTPTK+HYLFNLRDISK
Sbjct: 2202 EALSMYSMDGEEVPFKTKVRLEGPVESWLCDVEEQMYKTLRDMLRECRFALKKAATKREKFVKDWPGQMCITSSQIQWTADVTRALQLVSFPFAWLSSALTCRSNGIMELLQPVVHLPFLQVGQRQDKKPLKSLRHKQRNMLEKFSEMIRSNLTKIQRLKINGLVVIEVHQRDIIEKLYKSGCNDINAFDWLSQLRFYWDKEPDDCFVRQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGDYVIVVNCSEGLDYKSMGRMFAGLAQTGAWGCFDEFNRCEFPKQLLRIHSFWHRINIEVLSVVAQQILSILSALALAAQSSSPMEKTRFMFDGRMLQLVWSCGIFITMNPGYAGRTELPDNLKSMFRPIAMVVPDSSMIAEITLFAEGFGSTKLLAKKVFTLYSLTIQQLSKQDHYDFGLRALVSVLRYAGRKKRSNPTMPDEEVLLLSLNDMNLAKLTSVDLPLFKGIMTDLFPGVEAPNIDYTKIKNAVESTCKSMNLRMIPFTLNKAIQLYETKSSRHSVMIVGKTLSGKSTTWRILQNVHNNLAKAGEPGFERVQEYPLNPKAVSLGELYGEFNLATNEWTDGVLSSVMRQTCAGRKFFILLLHKRLCCCSVWYPMTTFVVTDDTPTLKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMSEQVSLLFEVEDLAVASPATVSRCGMVYNDAHDLGWWPYVNSWLAAKQDKTLVDETRRLFEKYIENLHQYIKQNCNTLVPMSETNTVISLCRLFDGLATPEAWVDPADTDYYTRLVEMTFQFCMIWSVCCMVDEDGRKKIDSYIREIEGSFPNKDSIYEYCVDPKGHTWIHWEEKLRGGWKYQPNEPFYKILVPTVDTVRYQFLASQLVGNHNPILLIGPVGTGKTSLAVNILNSLDPNIWTNLTINMSAQTSSSNVQDIIEGRVEKRTKDTFVPIGGTNMLTFMDDFNMPAKDAFGSQPPLELVRQWLDYGFWYDRVKQTIRKVTNMYLLASMGPPGGGRMVISRRLQARFNQIVITFPTESSLKRIYGSMLTQKLLEFEDDVKSMSESLLQASIDLYNMVINKFLPTPTKMHYLFNLRDISK 3327          

HSP 4 Score: 236.884 bits (603), Expect = 7.007e-58
Identity = 113/168 (67.26%), Postives = 134/168 (79.76%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQ 5037
            L  MK SRFV+PFE  VD+WER LS I ET+E LL+VQRQ+LYLE IFLGEDIRKQLPKES+ FD +N  W+ I   L + RN RAC  K GLL+  N +   LE+IQ+SLDMYLETKR IFPRFYF++N+DLLEILGQ +NPD V+PH+KKCFDNINSLKIEK+ S+
Sbjct: 1821 LSTMKASRFVRPFEVLVDRWERLLSLIMETLEQLLSVQRQYLYLETIFLGEDIRKQLPKESSAFDAVNMDWQSITAFLYETRNTRACTTKPGLLDNLNRLVNSLEEIQQSLDMYLETKRQIFPRFYFLANEDLLEILGQGRNPDAVMPHMKKCFDNINSLKIEKVHSR 1988          
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Match: A0A4Z2CU40 (Dynein heavy chain 2, axonemal OS=Schistosoma japonicum OX=6182 GN=EWB00_007593 PE=4 SV=1)

HSP 1 Score: 1947.94 bits (5045), Expect = 0.000e+0
Identity = 919/1231 (74.65%), Postives = 1084/1231 (88.06%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLK---------DLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +LR++K Y DT+NS+ RLWIHE  RVF DRMV DKD+  +++L+ E L + FDQT+H++CP+KQSPIF D+M+S ++YED+TD+E+L+KFM + L EYN +PG+V++DLV+FRDAIEH  K++RVI QPRGNMLL+GIGGSGRQSL+RLAAY+CEY +FQ+EV+KHYRKQEFR+DLK++Y+QAGV+NKPT+FLF D QV+DESFLEDINN+LSSGE+P LYK DE ++++ +L + AK +G+E++TQ+IF + I+RVR N+H++LCMSP+GEPFRNRIRMFPAFVNCTTIDWFSEWPL+ALLEVAE+YL          D QL +  ++ +M+  +A IF+ MHRSV+DM+  ML+E+KRHNY+TPTNYLE V+GYK LL +KR++LS+ ANKL NGL KIDETR KVEVMS+ELEEA+KK++ FQKECDDYLVVIVQQKREAD+QAKSVMQTQE+IKVDEAKCL M ELA ADLAQAMPALEAA+QALE+LNKKDITEIKSYGKPP LVQKV+EAVMILRGA+P+WAE+K+ LGEQDFIKQLINFDKDNI+D+TLKKIG Y AQDDFQPD+VGKVS AAKSLCMWV AM+VYGRVYR+VEPKRQRL+ AE VLREKQAQLAAAQAKLDAV  EM+RLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEK RWE +VADL  +I LLPGDCL+A+AFLSYMGPFLS+YRE L+  W   I+ E +P    F F EFL++PTQ+R+WNIQGLPRD FSVENGVIVTRGSRWPLM+DPQ QA +WIK MEGK+L++IDL +PD++R LE+A+Q GQPVLLQNV E+LD +LDP+L KS++K+GG  +MKLGDKEIEYN  FR YITTKLPNPHYTPE+ +K  IVNFAVK+QGLEAQLLGIVVRKERPELEEQKDNLVM IAAGKRKL +LEDEILRLLNEAQGSLLDDEQLVNTLQ+SK+TS+EVTEQL +AEKTE  ID AR+GY  CAQR+SILFFVLND+ +IDPMYQF+L+AYIDLF +SI+KS KS K D+RI NLNDYHTYAVY Y CRGLFE+HKLLFSF IC +IL+++GK+N DEYNFFL GGVVLDRENQ DNPC  WL++Q WDNI+ELDKLA+FHG++TSFEQY RDWN+WYTS  PE SSLPGEWDN  NEFQRMLIVRSLRPDRVSFCATSFI+NNLG++FVEPPVLDMKQVVDDSS +T LIFVLSPG
Sbjct: 1231 QGLLRSSKSYIDTRNSMLRLWIHEGLRVFCDRMVDDKDRTTYIDLVGESLATYFDQTYHSLCPSKQSPIFVDFMNSDNSYEDVTDLERLRKFMAQTLKEYNESPGMVRVDLVMFRDAIEHTCKVVRVINQPRGNMLLIGIGGSGRQSLSRLAAYICEYKTFQVEVTKHYRKQEFREDLKKMYFQAGVENKPTVFLFTDAQVLDESFLEDINNMLSSGEVPTLYKSDEFEEVKQELLEVAKHEGVEESTQAIFRFFIERVRANLHIILCMSPIGEPFRNRIRMFPAFVNCTTIDWFSEWPLEALLEVAEKYLASTDININEVDPQLLVK-KQAKMRVSVAKIFANMHRSVTDMAMVMLNELKRHNYITPTNYLEFVAGYKTLLYQKRQELSNKANKLTNGLDKIDETRKKVEVMSVELEEAKKKVSAFQKECDDYLVVIVQQKREADEQAKSVMQTQEKIKVDEAKCLHMAELAQADLAQAMPALEAAVQALEALNKKDITEIKSYGKPPLLVQKVLEAVMILRGADPSWAESKRQLGEQDFIKQLINFDKDNINDKTLKKIGQYCAQDDFQPDVVGKVSSAAKSLCMWVRAMDVYGRVYRIVEPKRQRLKQAEDVLREKQAQLAAAQAKLDAVNAEMRRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKIRWEASVADLLCRIELLPGDCLLAAAFLSYMGPFLSEYREKLITDWLALIRTENVPVTDPFIFTEFLADPTQVREWNIQGLPRDTFSVENGVIVTRGSRWPLMIDPQNQALRWIKSMEGKELRIIDLQIPDYMRTLEVAVQHGQPVLLQNVHEQLDQALDPLLTKSLIKVGGTLMMKLGDKEIEYNDKFRLYITTKLPNPHYTPEVCSKALIVNFAVKQQGLEAQLLGIVVRKERPELEEQKDNLVMGIAAGKRKLTDLEDEILRLLNEAQGSLLDDEQLVNTLQSSKVTSSEVTEQLHVAEKTEIQIDKAREGYRPCAQRSSILFFVLNDMSRIDPMYQFSLEAYIDLFTLSIDKSPKSTKLDDRIINLNDYHTYAVYRYTCRGLFERHKLLFSFHICLQILESAGKVNQDEYNFFLHGGVVLDRENQFDNPCSTWLTEQCWDNITELDKLASFHGIVTSFEQYSRDWNIWYTSSEPEKSSLPGEWDNILNEFQRMLIVRSLRPDRVSFCATSFIVNNLGSRFVEPPVLDMKQVVDDSSTRTPLIFVLSPG 2460          

HSP 2 Score: 1903.26 bits (4929), Expect = 0.000e+0
Identity = 903/1228 (73.53%), Postives = 1050/1228 (85.50%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALA-------SNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVEN------------GCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            MKTSRFVKPFEH VD WER LS I ET+E LLTVQRQ++Y+E IFLGEDIRKQLPKESA FD IN QW+ I T L + RN R C  K GLL+  N +   L++IQ+SLDMYLETKR IFPRFYFISNDDLLE+LGQ +NP+ V+PHLKKCFDNI  LK+EK     ++A SMFS DGEEV FK K+RL+GPVE+WLCD+E  M  TL+D+LR+CR ALKKAA+KRDK+IKEW GQLCITSSQIQWTADVT+ALQ V+ R DK+PL+ +K KQK +LEKFSE IRSNLTK+QRLKIN+L VIEVHQRDIIEKLYK+GC+D+NAF+WLSQLRFYWEKE DDC ++QTNTSF+YGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTET KDLGKSLG YVIVVNCSEGLDYKSMGRMF+GLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALA        N   +FMF+GRMI LV S GIFITMNPGYAGRTELPDNLKSMFRPIAMV PDS MIAEITLFAEGFS  K+LAKKVFTLY+L++QQLSKQDHYDFGLRALVSVLRYAG+KKRANP MPDEE+LLLS+NDMNLAKLTS DLPLFKGI++DLFP I+ P MDY+ +K A+++ C+   L+ T FT+TKV+QLYETK+SRHSVMIVGKTLSGKSTTWRLL++    L+K   S+FE   E+ LNPKS+SLGELYGEF+L+TNEWTDGVLS++MR+TC+D  P  KWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVE+LSVASPATVSRCGMVYNDVNDLGW PYVESWL +K + +L++   R F KYI+ +  FI++NC  +I  S TN++ISLCKL+D LAT ++              +P+D D Y R++E+ FQFCMIWS+ C VDEDGRKK+D YIRE+EG+FPNKD+IYEY+VD K+KSW HW+E+LK+GWKY+ +VPF+KI+VPTVDTVRYN+L+   V   +P +LVG VGTGKTS+A+N L  L+  +W  LTINMS+QT+SNNVQDIIE RVEKRTKDTFVPVGG +MLTFMDDFNMPAKD+ GSQPPLELIRQW++YGFWYDR+KQT+K+IK M LF AMG PGGGRM++S RLQ+RF+ + +TFPTE+NLKRI+G+MI QKLQ+F++E+K + D +TQATI++Y+ VV KFLPTPTKIHYLFNLRDISK
Sbjct:    1 MKTSRFVKPFEHLVDNWERTLSLITETIEALLTVQRQYMYMETIFLGEDIRKQLPKESASFDMINIQWQSITTFLYETRNTRTCACKPGLLDQINKLVYSLDEIQQSLDMYLETKRQIFPRFYFISNDDLLEVLGQGRNPEAVMPHLKKCFDNITLLKLEKTTFVVYDAVSMFSLDGEEVPFKNKVRLDGPVESWLCDIEDQMYKTLKDMLRECRFALKKAANKRDKFIKEWPGQLCITSSQIQWTADVTRALQMVSHRQDKRPLKSLKHKQKSLLEKFSEIIRSNLTKVQRLKINALAVIEVHQRDIIEKLYKTGCNDVNAFDWLSQLRFYWEKEADDCFVRQTNTSFRYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETTKDLGKSLGDYVIVVNCSEGLDYKSMGRMFAGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALALADQSGNQNTKTRFMFEGRMIQLVWSCGIFITMNPGYAGRTELPDNLKSMFRPIAMVVPDSTMIAEITLFAEGFSSTKILAKKVFTLYNLTVQQLSKQDHYDFGLRALVSVLRYAGKKKRANPNMPDEELLLLSLNDMNLAKLTSADLPLFKGIINDLFPSIEPPSMDYSKIKNALQEECNKINLRMTPFTLTKVIQLYETKSSRHSVMIVGKTLSGKSTTWRLLKAVHNSLAKVSNSEFETVTEYSLNPKSLSLGELYGEFNLSTNEWTDGVLSNIMRQTCSDGSPSLKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYNDVNDLGWWPYVESWLSKKTNKILIDATKRFFTKYIDNLYEFIRLNCNVIIPMSLTNTIISLCKLYDSLATPDSLESMVVERNKDFNANPADVDYYPRLLEMTFQFCMIWSVACLVDEDGRKKVDAYIREIEGSFPNKDSIYEYYVDPKSKSWIHWEEQLKSGWKYSPNVPFHKILVPTVDTVRYNFLLDCTVKQKYPALLVGSVGTGKTSLALNLLRNLDPTLWIHLTINMSSQTTSNNVQDIIEGRVEKRTKDTFVPVGGGKMLTFMDDFNMPAKDSSGSQPPLELIRQWLEYGFWYDRVKQTRKKIKGMQLFAAMGTPGGGRMVLSQRLQARFHQVAVTFPTEANLKRIYGTMITQKLQEFQDEVKSLADNLTQATIDLYHAVVNKFLPTPTKIHYLFNLRDISK 1228          
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Match: A0A4S2LRP6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005313 PE=4 SV=1)

HSP 1 Score: 1946.78 bits (5042), Expect = 0.000e+0
Identity = 910/1230 (73.98%), Postives = 1073/1230 (87.24%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIG--------GEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +LR +K   +T+ S+ RLWIHE  RVFADR++ DKD+ ++V+L+ + L + FDQT+H++CP +QSPIF D++++   YEDI D+++L++F+ + L EYN TPG V MDLVLFRDAIEH  K+ RV++QPRGNMLLVGIGGSGRQSL+RLAAY+CE+  FQIEV+K YRKQEFR+D+KR+Y+QAGV N+PTLF+F DTQVV+ESFLEDINN+LSSGE+P LYK DE +++R  L D AK++G+ ++TQSIF + I+RVR N+H VLCMSP+GEPFRNR+RMFPAFVNCTTIDWFSEWPL+ALLEVAE+YL ++ L +           E+R++  +  IF+ MHRSV+DM+  ML E++RH YVTPTNYLELV+GYK+LL +KR++LSD ANKL NGLGKIDETR KVEVMSIELE+ARKK+A FQKECDDYLV+IVQQKREAD+QAK+V+QTQE+IKVDE KC+ M ELA+ADLAQAMPALEAAMQALE+LNKKDITEIKSYGKPP LVQKVMEAVMILRGAEPTWAE+++ LGEQDFIKQL+NFDKDNI+DRTLKKIG Y AQDDF PD+VGKVS AAKSLCMWV A+EVYGRVYRVVEPKRQRLQ AE+VLREKQ  LAAAQAKLD V  +M+RLQQEYNEKM+QKEELR KAEHTEKMLDRASKLVSGLAGEK RWE TVADL  +I LLPGDCL+A+ FLSYMGPFLS+YRE LV  W   ++ E  PA   F F +FL++PTQ+R+WN+QGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKW+K MEGK L+VIDL MPD+IRVLE A+QFGQPVL+QN+ E+LD +LDP+L KS+ KIGG  +M+LGDKEIEYN DFRFY+TT+LPNPHY PE+  KT +VNFAVK+QGLEAQLLGIVVRKERPELEEQKDNLV+ IAAGKRKL ELEDEILRLLNEAQGSLLDDEQLVNTLQTSK+TSTEVTEQLQ+AEKTE  ID AR+GY  CA+RASILFF+LNDLG+IDPMYQFALD YIDLF++SI+KS +S K ++RI +LNDYHTYAVY Y CRGLFE+HKLLFSFQIC KIL+ +GK+N DEYNFFL+GG+VLDR+NQ DNPC  WLS+Q WDNI+ELDKL N+HGL+TSFEQYPRDW++W+T+  PETS LPGEWDN TNEFQRMLIVRSLRPDRV+FCATSFI +N+GN+FVEPPVLDMKQVV+DS+ +T LIFVLS G
Sbjct: 2937 QGLLRASKSQIETRTSMLRLWIHEGLRVFADRLINDKDRTSYVDLVGDALATHFDQTYHSLCPARQSPIFADFLNAEGEYEDIADLDRLRRFLTDTLKEYNETPGTVPMDLVLFRDAIEHTCKLTRVLKQPRGNMLLVGIGGSGRQSLSRLAAYICEFKIFQIEVTKAYRKQEFREDVKRMYFQAGVKNEPTLFIFTDTQVVEESFLEDINNLLSSGEVPTLYKPDEFEEVRQALLDIAKQEGVSESTQSIFQFFIERVRSNLHTVLCMSPIGEPFRNRMRMFPAFVNCTTIDWFSEWPLEALLEVAEKYLNNVSLIVSEPDPQILVKRENRLRASIVKIFANMHRSVADMALLMLAELRRHVYVTPTNYLELVAGYKVLLYQKRQELSDKANKLANGLGKIDETREKVEVMSIELEDARKKVAAFQKECDDYLVIIVQQKREADEQAKAVIQTQEKIKVDEVKCMHMAELAMADLAQAMPALEAAMQALEALNKKDITEIKSYGKPPFLVQKVMEAVMILRGAEPTWAESRRQLGEQDFIKQLVNFDKDNINDRTLKKIGLYCAQDDFHPDVVGKVSTAAKSLCMWVRAIEVYGRVYRVVEPKRQRLQQAEAVLREKQEMLAAAQAKLDEVNAQMRRLQQEYNEKMDQKEELRIKAEHTEKMLDRASKLVSGLAGEKLRWENTVADLSARIDLLPGDCLLAAGFLSYMGPFLSEYREKLVQNWLTLVRAEAAPATDPFVFTDFLADPTQVREWNLQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWVKSMEGKALRVIDLQMPDYIRVLETAVQFGQPVLMQNIHEQLDQALDPVLKKSLAKIGGVLIMRLGDKEIEYNEDFRFYMTTRLPNPHYAPEVCAKTTVVNFAVKQQGLEAQLLGIVVRKERPELEEQKDNLVIGIAAGKRKLTELEDEILRLLNEAQGSLLDDEQLVNTLQTSKVTSTEVTEQLQVAEKTEVQIDAAREGYRPCAERASILFFILNDLGRIDPMYQFALDGYIDLFHLSIDKSPRSGKLEDRIVHLNDYHTYAVYRYTCRGLFERHKLLFSFQICVKILEAAGKLNQDEYNFFLRGGIVLDRDNQFDNPCISWLSEQCWDNITELDKLPNYHGLVTSFEQYPRDWHIWFTAAEPETSPLPGEWDNTTNEFQRMLIVRSLRPDRVAFCATSFITSNMGNRFVEPPVLDMKQVVEDSNTRTPLIFVLSTG 4166          

HSP 2 Score: 1741.09 bits (4508), Expect = 0.000e+0
Identity = 835/1493 (55.93%), Postives = 1107/1493 (74.15%), Query Frame = 3
Query:  108 NKSNLETESLNITVTDEAVEINPNKEEQNEIFYEDDG------------TAELVMSYEEIPKSTPPDEEKSVIDLIRQRIRLSGYVEIENWTADHALQVQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSN-ADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKK-SIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            N SN E  +L    +    ++  ++E + EIF E D              AE + S ++ PK       + V D+IR RI L+G+  I++W+   A  + D FV+     +  Y++ KN LQ+    P    +EL YFI     + + + ++NF   + +GTV GRGI+SLLRIM  I+AP++F+N  WPDSIKNDFSLQLQRFMSALTDARWKLE KTVLY+P E    + E  A+ KD +NR EMI+IHWTRQIK VL++QN  ++ E +GPLDEIE+W+NRC+DL+GISKQLDK  VK+IT IL  AKSSYV AF++LA EIKFNTQQAQSNLKFLNTLK+MCH L++S P +IP  L ++I+ IRMIWVNS+HYN+++ +TGMFRK+SNEII RCC  + LD+IFDG+++SS   L++CI CCE+YK IYDK+  +H  +S+ PW+  K +IFAQ+DAFIQRC+DL+EICECQ +F R+E+G K  MPIFQGARG E+E+++  IE +F   +R L D++++ILDVKATSWHDDYNRFR G+KDLEVM QNAI TAFETVTTIQQG+EILDVFAHLQ RE IRRT D     +  +  +  N VKKE+      GLP P+   YAG  ++ R LR+R+E+ ML+LDQAFFL ++++  A+ RQQY+Q   ALE++ RKT +EF S +D+DPLK+L+  LL RS +   +++ N + A+ KLF ELHYW RL  +VP  AA+ + RR ELR   E VL++VRDYNRI+ +LN+EER+LF+E+IK LDKK+ PG  K+ W+ KG +E FV+D R+ A++LQ KVD+YKTAN+DI+  CE I+  L+I+++ NR+YENTEF+D Q AHRA+ K KL  LH  I+ QMR+  E F  +S+DIQ YW  Y  ++D++CEEAFRLNVK SL+EL +AINGDGRN+P+PLFKV+LNL    LVF+PTLP+LTN+V SLG  F E++  +PR+ ++L ++K  K  I + I+ D+EI KIQ +I+ GMQ+ISS++QEPL YWDQFREIWEL K++FI +Y  LNPHV SIDADI+RYTEVTNK  DAE MVT +FLQLDFS+LKN+IAAHCRDWQQ+LTNLLL M T SL  ++ Y++  SE++S+ PQNL+ELGES++LL+++  E++ IQ KF PL+E F ILDK EV Y+D +  ++ NL  +W +F   L+ AEQMIKK K+KFKTGLL  S++FK+ V+ L+ + Q+ GP++A + PQ AL  +A F+  L+ LK +E E+R GLNLFKIEQPP KEIA +EKDL+ ++ IW +  EWE NW  WK GRF EL+T EMENLAN+ FRK  K SRDLKD+NWE+IE +R RVDQFRRTMPLI DLRN AMR RHW Q+K E+ KQFDE S+DFTLE+I+ L F+QHAE+++E+SGAA+KELAIE+ L  ME+ W++ EL+I+P+  KEKN + L   ++++Q L+DN+  LS 
Sbjct:   17 NHSNTEETALRPGHSSPDEDVQEDEEVKKEIFLEPDDEFLGFTTNPDFEGAEYLESLDDAPKPGLVKPSQPVSDMIRDRIYLTGFESIKHWSEQIAQHINDGFVSGEKLQMFIYLNRKNELQVTYDVPMHWYSELNYFIHVPDAEGKPLTSDNFDVRVHYGTVVGRGIESLLRIMSTIFAPAFFANKTWPDSIKNDFSLQLQRFMSALTDARWKLESKTVLYMPTEEIERTSETEARNKDLVNRFEMIVIHWTRQIKAVLNSQNTTDEVEGTGPLDEIEFWRNRCEDLTGISKQLDKAEVKNITDILTAAKSSYVAAFIRLADEIKFNTQQAQSNLKFLNTLKEMCHQLAESTPREIPPKLPRIISVIRMIWVNSKHYNTKEIITGMFRKLSNEIINRCCSVISLDDIFDGKVISSSNNLRHCITCCEEYKAIYDKLQKIHSRHSAFPWDAQKGSIFAQVDAFIQRCRDLLEICECQKNFGRYEEGTKTTMPIFQGARGPELEVLLNTIEQMFGKLMRNLYDKRTSILDVKATSWHDDYNRFRVGIKDLEVMMQNAINTAFETVTTIQQGVEILDVFAHLQTREAIRRTIDNKTHELVARFGEILNQVKKEMTQRIYGGLPMPTEAHYAGQGLYWRFLRRRLEKTMLSLDQAFFLSLAAAGMAEHRQQYSQTLAALEDMTRKTFLEFQSTIDQDPLKALETPLLVRSAMQVCLIEPNLNAAVPKLFNELHYWIRLGVEVPPNAAEAFRRRHELRYLVELVLIIVRDYNRIMNSLNSEERALFRERIKILDKKLAPGFTKLHWTVKGLVEMFVSDVRVQASKLQGKVDDYKTANEDIKSNCEQIARTLLIRLEPNRVYENTEFDDCQSAHRAITKIKLFNLHEGIVEQMRQVKETFVSESADIQLYWGRYTERMDRYCEEAFRLNVKLSLSELQRAINGDGRNDPNPLFKVALNLDDDVLVFLPTLPQLTNVVASLGNKFTEIISAVPRLPDLLTRMKSSKVPICDAIANDEEINKIQASIKRGMQEISSAVQEPLSYWDQFREIWELPKDDFIQRYRQLNPHVSSIDADIARYTEVTNKVQDAETMVTTRFLQLDFSLLKNAIAAHCRDWQQRLTNLLLDMTTDSLNGIYTYIETSSERISRPPQNLDELGESIQLLERILTEQHEIQAKFGPLEEQFAILDKCEVTYTDSVAARRANLANDWIQFQNTLLAAEQMIKKCKEKFKTGLLGDSEEFKRAVANLLAELQSTGPYSADLAPQTALDAVAGFRERLDKLKARELELRHGLNLFKIEQPPCKEIAVIEKDLEYLDVIWTMNYEWEKNWEGWKCGRFCELQTTEMENLANTVFRKFVKLSRDLKDRNWEVIESSRIRVDQFRRTMPLIMDLRNPAMRSRHWVQLKLEMNKQFDENSADFTLERIVQLGFEQHAEIVHEISGAASKELAIEHTLDNMERFWQNNELDIVPY--KEKNTYKLRSTEEVFQALEDNQVQLST 1507          

HSP 3 Score: 1707.19 bits (4420), Expect = 0.000e+0
Identity = 801/1049 (76.36%), Postives = 920/1049 (87.70%), Query Frame = 1
Query: 5044 EASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALA----SNAP---PKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            EA SM+S DGEEV FK K+RLEGPVE+WLCD+E+ M  TLRD+LR+CR+ALKKAA+KR+K++++W GQ+CITSSQIQWTADVT+ALQ V QR DKKPL+ ++ KQ+ +LEKFSE IRSNLTKIQRLKIN LVVIEVHQRDIIEKLYKSGCSDINAF+WLSQLRFYW+KE DDC ++QT+TSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGK+LG YVIVVNCSEGLDYKSMGRMF+GLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALA    S+ P    +FMF GRM+ LV S GIFITMNPGYAGRTELPDNLKSMFRPIAMV PDS+MIAEITLFAEGF   K+LAKKVFTLYSL+IQQLSKQDHYDFGLRALVSVLRYAGRKKRANP MPDEE+LLLS+NDMNLAKLTSVDLPLFKGI++DLFPG+++P +DYT +K A+E  C +  L+  +FT+ KV+QLYETK+SRHSVMIVGKTLSGKSTTWR+LQS    L+K  E  FE+  E+PLNPK+VSLGELYGEF+L TNEW+DGVLSSVMR+TCAD     KWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVE+L+VASPATVSRCGMVYND +DLGW PYV SWL  K D  LV+E  R+F+KYIE +  +IK NC  L+  S TN+V+SLC+LFD LAT E   DP+DTD Y+R++E+ FQFCMIWS+CC VDEDGRKKID+YIRE+EG+FPNKD+IYEY VD K  +W HW+EKL+ GWKY  + PFYKI+VPTVDTVRY +L   LV N +P++L+GPVGTGKTS+AVN LN L+ +IWT LTINMSAQTSS+NVQDIIE RVEKRTKDTFVP+GG  MLTFMDDFNMPAKD FGSQPPLEL+RQW+DYGFWYDR+KQT +R+ +MYL  +MGPPGGGRM+IS RLQ+RFN I +TFPTESNLKRI+GSM+ QKL +FE+++K + + + QA+I++YN V+ KFLPTPTK+HYLFNLRDISK
Sbjct: 1886 EALSMYSMDGEEVPFKTKVRLEGPVESWLCDVEEQMYKTLRDMLRECRVALKKAATKREKFVRDWPGQMCITSSQIQWTADVTRALQLVGQRQDKKPLKSLRHKQRNMLEKFSEMIRSNLTKIQRLKINGLVVIEVHQRDIIEKLYKSGCSDINAFDWLSQLRFYWDKEPDDCFVRQTSTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGDYVIVVNCSEGLDYKSMGRMFAGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALALAAQSSNPMEKTRFMFDGRMLQLVWSCGIFITMNPGYAGRTELPDNLKSMFRPIAMVVPDSSMIAEITLFAEGFGSTKLLAKKVFTLYSLTIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPTMPDEEVLLLSLNDMNLAKLTSVDLPLFKGIMTDLFPGVEAPTIDYTKIKTAVESTCKSMNLRMISFTLNKVIQLYETKSSRHSVMIVGKTLSGKSTTWRVLQSVHNNLAKAGEPGFERVQEYPLNPKAVSLGELYGEFNLATNEWSDGVLSSVMRQTCADDTTMLKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVEDLAVASPATVSRCGMVYNDAHDLGWWPYVNSWLAAKQDKTLVDETRRLFEKYIENLHQYIKQNCTTLVPMSETNTVVSLCRLFDGLATPEAWVDPADTDYYTRLLEMTFQFCMIWSVCCMVDEDGRKKIDSYIREIEGSFPNKDSIYEYCVDPKGHTWMHWEEKLRGGWKYQPNEPFYKILVPTVDTVRYQFLASQLVGNHNPILLIGPVGTGKTSLAVNILNSLDPNIWTNLTINMSAQTSSSNVQDIIEGRVEKRTKDTFVPIGGTNMLTFMDDFNMPAKDAFGSQPPLELVRQWLDYGFWYDRVKQTIRRVTNMYLLASMGPPGGGRMVISRRLQARFNQIVITFPTESNLKRIYGSMLTQKLLEFEDDVKSMSESLLQASIDLYNMVINKFLPTPTKMHYLFNLRDISK 2934          

HSP 4 Score: 234.958 bits (598), Expect = 2.728e-57
Identity = 113/168 (67.26%), Postives = 133/168 (79.17%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQ 5037
            L  MK SRFV+PFE  VD+WER LS I ET+E LL+VQRQ+LYLE IFLGEDIRKQLPKES+ FD +N  W+ I   L   RN RAC  K GLL+  N +   LE+IQ+SLDMYLETKR IFPRFYF++N+DLLEILGQ +NPD V+PH+KKCFDNINSLKIEK+ S+
Sbjct: 1505 LSTMKASRFVRPFEVLVDRWERLLSLIMETLEQLLSVQRQYLYLETIFLGEDIRKQLPKESSAFDVVNMDWQSIAAFLYATRNTRACTTKPGLLDHLNRLVGSLEEIQQSLDMYLETKRQIFPRFYFLANEDLLEILGQGRNPDAVMPHMKKCFDNINSLKIEKVQSR 1672          
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Match: A0A4S2LRQ0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005313 PE=4 SV=1)

HSP 1 Score: 1946.01 bits (5040), Expect = 0.000e+0
Identity = 910/1230 (73.98%), Postives = 1073/1230 (87.24%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIG--------GEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +LR +K   +T+ S+ RLWIHE  RVFADR++ DKD+ ++V+L+ + L + FDQT+H++CP +QSPIF D++++   YEDI D+++L++F+ + L EYN TPG V MDLVLFRDAIEH  K+ RV++QPRGNMLLVGIGGSGRQSL+RLAAY+CE+  FQIEV+K YRKQEFR+D+KR+Y+QAGV N+PTLF+F DTQVV+ESFLEDINN+LSSGE+P LYK DE +++R  L D AK++G+ ++TQSIF + I+RVR N+H VLCMSP+GEPFRNR+RMFPAFVNCTTIDWFSEWPL+ALLEVAE+YL ++ L +           E+R++  +  IF+ MHRSV+DM+  ML E++RH YVTPTNYLELV+GYK+LL +KR++LSD ANKL NGLGKIDETR KVEVMSIELE+ARKK+A FQKECDDYLV+IVQQKREAD+QAK+V+QTQE+IKVDE KC+ M ELA+ADLAQAMPALEAAMQALE+LNKKDITEIKSYGKPP LVQKVMEAVMILRGAEPTWAE+++ LGEQDFIKQL+NFDKDNI+DRTLKKIG Y AQDDF PD+VGKVS AAKSLCMWV A+EVYGRVYRVVEPKRQRLQ AE+VLREKQ  LAAAQAKLD V  +M+RLQQEYNEKM+QKEELR KAEHTEKMLDRASKLVSGLAGEK RWE TVADL  +I LLPGDCL+A+ FLSYMGPFLS+YRE LV  W   ++ E  PA   F F +FL++PTQ+R+WN+QGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKW+K MEGK L+VIDL MPD+IRVLE A+QFGQPVL+QN+ E+LD +LDP+L KS+ KIGG  +M+LGDKEIEYN DFRFY+TT+LPNPHY PE+  KT +VNFAVK+QGLEAQLLGIVVRKERPELEEQKDNLV+ IAAGKRKL ELEDEILRLLNEAQGSLLDDEQLVNTLQTSK+TSTEVTEQLQ+AEKTE  ID AR+GY  CA+RASILFF+LNDLG+IDPMYQFALD YIDLF++SI+KS +S K ++RI +LNDYHTYAVY Y CRGLFE+HKLLFSFQIC KIL+ +GK+N DEYNFFL+GG+VLDR+NQ DNPC  WLS+Q WDNI+ELDKL N+HGL+TSFEQYPRDW++W+T+  PETS LPGEWDN TNEFQRMLIVRSLRPDRV+FCATSFI +N+GN+FVEPPVLDMKQVV+DS+ +T LIFVLS G
Sbjct: 2726 QGLLRASKSQIETRTSMLRLWIHEGLRVFADRLINDKDRTSYVDLVGDALATHFDQTYHSLCPARQSPIFADFLNAEGEYEDIADLDRLRRFLTDTLKEYNETPGTVPMDLVLFRDAIEHTCKLTRVLKQPRGNMLLVGIGGSGRQSLSRLAAYICEFKIFQIEVTKAYRKQEFREDVKRMYFQAGVKNEPTLFIFTDTQVVEESFLEDINNLLSSGEVPTLYKPDEFEEVRQALLDIAKQEGVSESTQSIFQFFIERVRSNLHTVLCMSPIGEPFRNRMRMFPAFVNCTTIDWFSEWPLEALLEVAEKYLNNVSLIVSEPDPQILVKRENRLRASIVKIFANMHRSVADMALLMLAELRRHVYVTPTNYLELVAGYKVLLYQKRQELSDKANKLANGLGKIDETREKVEVMSIELEDARKKVAAFQKECDDYLVIIVQQKREADEQAKAVIQTQEKIKVDEVKCMHMAELAMADLAQAMPALEAAMQALEALNKKDITEIKSYGKPPFLVQKVMEAVMILRGAEPTWAESRRQLGEQDFIKQLVNFDKDNINDRTLKKIGLYCAQDDFHPDVVGKVSTAAKSLCMWVRAIEVYGRVYRVVEPKRQRLQQAEAVLREKQEMLAAAQAKLDEVNAQMRRLQQEYNEKMDQKEELRIKAEHTEKMLDRASKLVSGLAGEKLRWENTVADLSARIDLLPGDCLLAAGFLSYMGPFLSEYREKLVQNWLTLVRAEAAPATDPFVFTDFLADPTQVREWNLQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWVKSMEGKALRVIDLQMPDYIRVLETAVQFGQPVLMQNIHEQLDQALDPVLKKSLAKIGGVLIMRLGDKEIEYNEDFRFYMTTRLPNPHYAPEVCAKTTVVNFAVKQQGLEAQLLGIVVRKERPELEEQKDNLVIGIAAGKRKLTELEDEILRLLNEAQGSLLDDEQLVNTLQTSKVTSTEVTEQLQVAEKTEVQIDAAREGYRPCAERASILFFILNDLGRIDPMYQFALDGYIDLFHLSIDKSPRSGKLEDRIVHLNDYHTYAVYRYTCRGLFERHKLLFSFQICVKILEAAGKLNQDEYNFFLRGGIVLDRDNQFDNPCISWLSEQCWDNITELDKLPNYHGLVTSFEQYPRDWHIWFTAAEPETSPLPGEWDNTTNEFQRMLIVRSLRPDRVAFCATSFITSNMGNRFVEPPVLDMKQVVEDSNTRTPLIFVLSTG 3955          

HSP 2 Score: 1929.07 bits (4996), Expect = 0.000e+0
Identity = 913/1219 (74.90%), Postives = 1051/1219 (86.22%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALA----SNAP---PKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  MK SRFV+PFE  VD+WER LS I ET+E LL+VQRQ+LYLE IFLGEDIRKQLPKES+ FD +N  W+ I   L   RN RAC  K GLL+  N +   LE+IQ+SLDMYLETKR IFPRFYF++N+DLLEILGQ +NPD V+PH+KKCFDNINSLKIEK  +   EA SM+S DGEEV FK K+RLEGPVE+WLCD+E+ M  TLRD+LR+CR+ALKKAA+KR+K++++W GQ+CITSSQIQWTADVT+ALQ V QR DKKPL+ ++ KQ+ +LEKFSE IRSNLTKIQRLKIN LVVIEVHQRDIIEKLYKSGCSDINAF+WLSQLRFYW+KE DDC ++QT+TSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGK+LG YVIVVNCSEGLDYKSMGRMF+GLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALA    S+ P    +FMF GRM+ LV S GIFITMNPGYAGRTELPDNLKSMFRPIAMV PDS+MIAEITLFAEGF   K+LAKKVFTLYSL+IQQLSKQDHYDFGLRALVSVLRYAGRKKRANP MPDEE+LLLS+NDMNLAKLTSVDLPLFKGI++DLFPG+++P +DYT +K A+E  C +  L+  +FT+ KV+QLYETK+SRHSVMIVGKTLSGKSTTWR+LQS    L+K  E  FE+  E+PLNPK+VSLGELYGEF+L TNEW+DGVLSSVMR+TCAD     KWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVE+L+VASPATVSRCGMVYND +DLGW PYV SWL  K D  LV+E  R+F+KYIE +  +IK NC  L+  S TN+V+SLC+LFD LAT E   DP+DTD Y+R++E+ FQFCMIWS+CC VDEDGRKKID+YIRE+EG+FPNKD+IYEY VD K  +W HW+EKL+ GWKY  + PFYKI+VPTVDTVRY +L   LV N +P++L+GPVGTGKTS+AVN LN L+ +IWT LTINMSAQTSS+NVQDIIE RVEKRTKDTFVP+GG  MLTFMDDFNMPAKD FGSQPPLEL+RQW+DYGFWYDR+KQT +R+ +MYL  +MGPPGGGRM+IS RLQ+RFN I +TFPTESNLKRI+GSM+ QKL +FE+++K + + + QA+I++YN V+ KFLPTPTK+HYLFNLRDISK
Sbjct: 1505 LSTMKASRFVRPFEVLVDRWERLLSLIMETLEQLLSVQRQYLYLETIFLGEDIRKQLPKESSAFDVVNMDWQSIAAFLYATRNTRACTTKPGLLDHLNRLVGSLEEIQQSLDMYLETKRQIFPRFYFLANEDLLEILGQGRNPDAVMPHMKKCFDNINSLKIEKYTATIHEALSMYSMDGEEVPFKTKVRLEGPVESWLCDVEEQMYKTLRDMLRECRVALKKAATKREKFVRDWPGQMCITSSQIQWTADVTRALQLVGQRQDKKPLKSLRHKQRNMLEKFSEMIRSNLTKIQRLKINGLVVIEVHQRDIIEKLYKSGCSDINAFDWLSQLRFYWDKEPDDCFVRQTSTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGDYVIVVNCSEGLDYKSMGRMFAGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALALAAQSSNPMEKTRFMFDGRMLQLVWSCGIFITMNPGYAGRTELPDNLKSMFRPIAMVVPDSSMIAEITLFAEGFGSTKLLAKKVFTLYSLTIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPTMPDEEVLLLSLNDMNLAKLTSVDLPLFKGIMTDLFPGVEAPTIDYTKIKTAVESTCKSMNLRMISFTLNKVIQLYETKSSRHSVMIVGKTLSGKSTTWRVLQSVHNNLAKAGEPGFERVQEYPLNPKAVSLGELYGEFNLATNEWSDGVLSSVMRQTCADDTTMLKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVEDLAVASPATVSRCGMVYNDAHDLGWWPYVNSWLAAKQDKTLVDETRRLFEKYIENLHQYIKQNCTTLVPMSETNTVVSLCRLFDGLATPEAWVDPADTDYYTRLLEMTFQFCMIWSVCCMVDEDGRKKIDSYIREIEGSFPNKDSIYEYCVDPKGHTWMHWEEKLRGGWKYQPNEPFYKILVPTVDTVRYQFLASQLVGNHNPILLIGPVGTGKTSLAVNILNSLDPNIWTNLTINMSAQTSSSNVQDIIEGRVEKRTKDTFVPIGGTNMLTFMDDFNMPAKDAFGSQPPLELVRQWLDYGFWYDRVKQTIRRVTNMYLLASMGPPGGGRMVISRRLQARFNQIVITFPTESNLKRIYGSMLTQKLLEFEDDVKSMSESLLQASIDLYNMVINKFLPTPTKMHYLFNLRDISK 2723          

HSP 3 Score: 1737.62 bits (4499), Expect = 0.000e+0
Identity = 835/1493 (55.93%), Postives = 1107/1493 (74.15%), Query Frame = 3
Query:  108 NKSNLETESLNITVTDEAVEINPNKEEQNEIFYEDDG------------TAELVMSYEEIPKSTPPDEEKSVIDLIRQRIRLSGYVEIENWTADHALQVQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSN-ADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKK-SIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            N SN E  +L    +    ++  ++E + EIF E D              AE + S ++ PK       + V D+IR RI L+G+  I++W+   A  + D FV+     +  Y++ KN LQ+    P    +EL YFI     + + + ++NF   + +GTV GRGI+SLLRIM  I+AP++F+N  WPDSIKNDFSLQLQRFMSALTDARWKLE KTVLY+P E    + E  A+ KD +NR EMI+IHWTRQIK VL++QN  ++ E +GPLDEIE+W+NRC+DL+GISKQLDK  VK+IT IL  AKSSYV AF++LA EIKFNTQQAQSNLKFLNTLK+MCH L++S P +IP  L ++I+ IRMIWVNS+HYN+++ +TGMFRK+SNEII RCC  + LD+IFDG+++SS   L++CI CCE+YK IYDK+  +H  +S+ PW+  K +IFAQ+DAFIQRC+DL+EICECQ +F R+E+G K  MPIFQGARG E+E+++  IE +F   +R L D++++ILDVKATSWHDDYNRFR G+KDLEVM QNAI TAFETVTTIQQG+EILDVFAHLQ RE IRRT D     +  +  +  N VKKE+      GLP P+   YAG  ++ R LR+R+E+ ML+LDQAFFL ++++  A+ RQQY+Q   ALE++ RKT +EF S +D+DPLK+L+  LL RS +   +++ N + A+ KLF ELHYW RL  +VP  AA+ + RR ELR   E VL++VRDYNRI+ +LN+EER+LF+E+IK LDKK+ PG  K+ W+ KG +E FV+D R+ A++LQ KVD+YKTAN+DI+  CE I+  L+I+++ NR+YENTEF+D Q AHRA+ K KL  LH  I+ QMR+  E F  +S+DIQ YW  Y  ++D++CEEAFRLNVK SL+EL +AINGDGRN+P+PLFKV+LNL    LVF+PTLP+LTN+V SLG  F E++  +PR+ ++L ++K  K  I + I+ D+EI KIQ +I+ GMQ+ISS++QEPL YWDQFREIWEL K++FI +Y  LNPHV SIDADI+RYTEVTNK  DAE MVT +FLQLDFS+LKN+IAAHCRDWQQ+LTNLLL M T SL  ++ Y++  SE++S+ PQNL+ELGES++LL+++  E++ IQ KF PL+E F ILDK EV Y+D +  ++ NL  +W +F   L+ AEQMIKK K+KFKTGLL  S++FK+ V+ L+ + Q+ GP++A + PQ AL  +A F+  L+ LK +E E+R GLNLFKIEQPP KEIA +EKDL+ ++ IW +  EWE NW  WK GRF EL+T EMENLAN+ FRK  K SRDLKD+NWE+IE +R RVDQFRRTMPLI DLRN AMR RHW Q+K E+ KQFDE S+DFTLE+I+ L F+QHAE+++E+SGAA+KELAIE+ L  ME+ W++ EL+I+P+  KEKN + L   ++++Q L+DN+  LS 
Sbjct:   17 NHSNTEETALRPGHSSPDEDVQEDEEVKKEIFLEPDDEFLGFTTNPDFEGAEYLESLDDAPKPGLVKPSQPVSDMIRDRIYLTGFESIKHWSEQIAQHINDGFVSGEKLQMFIYLNRKNELQVTYDVPMHWYSELNYFIHVPDAEGKPLTSDNFDVRVHYGTVVGRGIESLLRIMSTIFAPAFFANKTWPDSIKNDFSLQLQRFMSALTDARWKLESKTVLYMPTEEIERTSETEARNKDLVNRFEMIVIHWTRQIKAVLNSQNTTDEVEGTGPLDEIEFWRNRCEDLTGISKQLDKAEVKNITDILTAAKSSYVAAFIRLADEIKFNTQQAQSNLKFLNTLKEMCHQLAESTPREIPPKLPRIISVIRMIWVNSKHYNTKEIITGMFRKLSNEIINRCCSVISLDDIFDGKVISSSNNLRHCITCCEEYKAIYDKLQKIHSRHSAFPWDAQKGSIFAQVDAFIQRCRDLLEICECQKNFGRYEEGTKTTMPIFQGARGPELEVLLNTIEQMFGKLMRNLYDKRTSILDVKATSWHDDYNRFRVGIKDLEVMMQNAINTAFETVTTIQQGVEILDVFAHLQTREAIRRTIDNKTHELVARFGEILNQVKKEMTQRIYGGLPMPTEAHYAGQGLYWRFLRRRLEKTMLSLDQAFFLSLAAAGMAEHRQQYSQTLAALEDMTRKTFLEFQSTIDQDPLKALETPLLVRSAMQVCLIEPNLNAAVPKLFNELHYWIRLGVEVPPNAAEAFRRRHELRYLVELVLIIVRDYNRIMNSLNSEERALFRERIKILDKKLAPGFTKLHWTVKGLVEMFVSDVRVQASKLQGKVDDYKTANEDIKSNCEQIARTLLIRLEPNRVYENTEFDDCQSAHRAITKIKLFNLHEGIVEQMRQVKETFVSESADIQLYWGRYTERMDRYCEEAFRLNVKLSLSELQRAINGDGRNDPNPLFKVALNLDDDVLVFLPTLPQLTNVVASLGNKFTEIISAVPRLPDLLTRMKSSKVPICDAIANDEEINKIQASIKRGMQEISSAVQEPLSYWDQFREIWELPKDDFIQRYRQLNPHVSSIDADIARYTEVTNKVQDAETMVTTRFLQLDFSLLKNAIAAHCRDWQQRLTNLLLDMTTDSLNGIYTYIETSSERISRPPQNLDELGESIQLLERILTEQHEIQAKFGPLEEQFAILDKCEVTYTDSVAARRANLANDWIQFQNTLLAAEQMIKKCKEKFKTGLLGDSEEFKRAVANLLAELQSTGPYSADLAPQTALDAVAGFRERLDKLKARELELRHGLNLFKIEQPPCKEIAVIEKDLEYLDVIWTMNYEWEKNWEGWKCGRFCELQTTEMENLANTVFRKFVKLSRDLKDRNWEVIESSRIRVDQFRRTMPLIMDLRNPAMRSRHWVQLKLEMNKQFDENSADFTLERIVQLGFEQHAEIVHEISGAASKELAIEHTLDNMERFWQNNELDIVPY--KEKNTYKLRSTEEVFQALEDNQVQLST 1507          
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1809.65 bits (4686), Expect = 0.000e+0
Identity = 849/1212 (70.05%), Postives = 1003/1212 (82.76%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  MK SRFV+ FE EVD+WER LS + E +EM+LTVQRQW+YLE IFLGEDIRKQLP ES +FD IN  W+ IM  LN+  NA       GLLE  + MN+ LE+IQKSLDMYLETKR IFPRFYF+SNDDLLEILGQS+NPD V PHLKKCFDNI SL+I K+ +   EA+ MFS+DGE V F   + LEGPVEAWLCD+E+ MR TL+D LR+CR ALKK   KRDKW+K+W GQ+ IT+SQIQWT DVTK L    +  DK  L+ MKKKQ  +L ++S+AIR NL+KI RLKI +LV +EVH RD+I+KL K+GC D+NAF+WL QLR YWEK++DDC+I+QTNT FQYGYEYLGNSGRLVITPLTDRCY+TLTTALHLHRGGSPKGPAGTGKTETVKDLGK LG YVIVVNCS+GLDYKSMGRM+SGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSAL++     F+F+GR I LV S GIFITMNPGYAGRTELPDNLKSMFRPI+MV PDS +IAEITLF EGF+ CKVLAKKVFTLY L++QQLSKQDHYDFGLRAL S+LRYAG+K+R  P + DEEILL+SM DMN+AKLTS DLPLF GI+ DLFP +++P +DY  +KE IE+      LQ T FT+TKV+QLYETK SRHS MIVGKT S KS TW++LQ AL+ + ++ E  F    E+PLNPK+VSLGELYGE+DL+TNEWTDGVLSS+MR  CAD +PDEKWI+FDGPVDTLWIESMNSVMDDNK+LTLINGERI+MPEQVSLLFEVE+L+VASPATVSRCGMVYND +DLGW+PYV+SW+ ++   + V+ L R+FD+YI+K  +F + +C EL+  +  N VISLC+L+D LA+ ENG +P+D +NY R++ELWF F +IWSIC SVDEDGRKKIDN++REMEGTFPNKDTIYEY+VD KNK+W  +++KL  GW+Y ++ PFYKI+VPTVDTVRY++LV +LVC  +PV+L GPVGTGKTSVA + L  L+   WT+LTINMS+QT+SNNVQ IIE+RVEKRTK T+VPVGGK+ML F+DD NMPA D FGSQPPLEL+R WIDYGFWYDR  +      DM+L  +MGPPGGGR  IS RLQSRFNLINMTFP ES +K IFG+MINQKLQ+F+EE+KPIG I+TQAT+E+Y  +  +FLPTP KIHYLFNLRDISK
Sbjct: 1395 LSTMKASRFVRAFEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAAGMFSADGEFVEFTHPVLLEGPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVKDWPGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSMLHRYSDAIRGNLSKILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGL-TNFIFEGRDICLVSSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRVRPDIADEEILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPGFNLVHEYPLNPKAVSLGELYGEYDLSTNEWTDGVLSSLMRIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWIDKR-QKMEVDHLKRLFDRYIKKTISFKRTHCKELVPITELNGVISLCRLYDSLASPENGVNPADNENYGRMVELWFIFSLIWSICASVDEDGRKKIDNFLREMEGTFPNKDTIYEYYVDTKNKTWASFEDKLPKGWRYPSNAPFYKIMVPTVDTVRYHFLVNSLVCGQYPVLLTGPVGTGKTSVAQSVLQGLDPAKWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWYDRQMKM-----DMFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIFGTMINQKLQEFQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISK 2599          

HSP 2 Score: 1802.72 bits (4668), Expect = 0.000e+0
Identity = 857/1224 (70.02%), Postives = 1024/1224 (83.66%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +LR+++D+HDTK SITRLWIHE FRVF+DR+V   D  AFV LL+EKLGSLFD T+HNICPNKQ PIFGD++     YED+ D + LK FM+  L++YN TPGVV M LVLFRDAIEH+++++RVI QPRGNMLLVGIGGSGRQSL+RLAAY+CEY  FQ+EV+K YRKQEFR+D+K+LY   GVDNKPT+FLFNDTQ++DESFLEDINNILSSGE+PNLYK DE +++++ LSD A+++ + +T  ++F YLI+RVR N+H+VLCMSPVGEPFRNRIR +PA VNCTT+DWFSEWP DALLEVAERYL  L   I G  ++++  +A IF  MH+SV+  SQRM  E+KRHNYVTPTNYLELVSGYK LL EKR +L +  +KL+NGL KID+TR+KVE MS+ELE+A+KK+A  QK+C++YLVVIVQQKREAD+Q  +V    E+I  +E KC  M E A  DL +A+PALE AM+ALESLNKKD+TEIKSYG+PPALV+ VM+AVMILRG EPTWAEAK+ LGE +FIKQL++FDKDNISDR LKKIG Y  Q DFQP+++G+VSLAAKSLCMWV AMEVYGR+YRVVEPKR RL  A + L EKQA LA A+ K   V E++K+L+ +Y+EK+ QKE+LRKK+E  E  LDRA KLVSGLAGE+ RWE+TV  LE  +G L GDCL+A+AFLSYMGPFLS+YRE L+   W +  +  ++P +P F+F  FLS PT +RDWNIQGLP D FS ENGVIVTRG+RWPLMVDPQ QA KWIK ME K+ LKVIDL MPDF+R+LE A+QFG PVLLQNVQE+LDPSL PILNKS   IGG  ++KLGDKE+EYN DF+FYITTKL NPHYTPEISTKT IVNFAVKEQGLEAQLLGIVVR+ERPELEEQKD+LV++IA+GKRKL ELEDEILRLLNEA GSLLDD QLVNTLQTSKIT+TEV++QL+ +E+TE  ID AR+ Y  CAQRASILFFVLND+G+IDPMYQF+LDAYIDLFN+SI KS +S K +ERI NLNDYHTYAVY Y CRGLFE+HKLLFSF +CAKIL+ +GK+NMDEY+FFL+GG+VLD+E QMDNPC  WL+D  WDNI+ELDKLANFHGL++SFE+YP+DW+ WYTS  PE + LPGEW+   NE Q+MLIVRSLR DRVSFC  SFIINNLG++FVEPPVLDMK V++DS+ KT LIFVLSPG
Sbjct: 2602 QGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLAEKLGSLFDLTYHNICPNKQQPIFGDFLKEPHVYEDLLDFKALKGFMESQLEDYNLTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALSDSARKENVLETADAMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYLDGL---ILGNVEKIQTKVARIFVTMHQSVAQFSQRMKLELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVIVQQKREADEQQMAVSAHSEKIGAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPTWAEAKRQLGESNFIKQLVHFDKDNISDRVLKKIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCSPGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITELDKLANFHGLMSSFEKYPKDWHQWYTSSEPENAPLPGEWETVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPG 3822          

HSP 3 Score: 905.205 bits (2338), Expect = 0.000e+0
Identity = 454/1029 (44.12%), Postives = 676/1029 (65.69%), Query Frame = 3
Query: 1485 EICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQM--LNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQ------MRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVL-QKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            ++CECQ  FAR ++G +  +P F G +G EV   +L+IE  F+ +++ LR  +  ILDV+ TSWHD YNRFR+ VKDLEVM QN I TAF+TV ++++G+++LDVF HL  RE I+RT  +    +   L +E  LV KEL+                  A WAR +++RI+ QM    L+ A FLP   ++   R+   QL   L+E+VR+ + E+   LDR  LK+L+  L+ R     GMLDINF + LLK+F E++YWERLQF++PH+ ++ Y RR +LR  RE+VLLVVRDYNRI+  L+A+E  LF+E+I+ LDKK+QPGL K+LWSS GA  +F+++CR++A+++Q  VDEYK AN  I K+C  IS +L++++D   +Y + EF + Q+AHR     ++   +  I+N M   YE F  D  ++QQ+W  Y  K+D   EEA RLNVK+SL EL+KAI+GD ++ P PLFKV + L+         + F PTL +L  IV S+    I  +    R+ ++L +K   +K +   I  D+EI KIQ  I  GM   +S +Q  L  WD+ REIWE+NK+ FI +Y  LNP V S D+DI+RY+EV N     E +++V+F+ LD S LK S+  HC +WQ K T LL  MA+  L  LH+++++ + ++S+ PQ L EL E ++LL+ L  + N I+ +  P+ E F IL+KYEV    +++   + L  EWQ F Q +++++ M+KK KDKFK+GL   +++FKK++   + DF + GPF +++  + AL +I+  ++ LESLK +E  IR GL++FK EQP SK++  LEKD+D +  +W+++ +W+T+W +WK+G+F  L+T  ME+ A + ++   K SR+LKDK WEI+E+++NR++QF+RT+P+I DLR+ AMRDRHW QIK E+++ FD  S++FTLEKI+ L  +QHAE I E+SGAA KEL+IE +L+G+ K WE   L+I P+KDK        G ++++Q L+DN+ TLS 
Sbjct:  394 KVCECQQQFARRKEGEQMPLPCFAGRQGPEVTRNLLEIEATFDKSLQVLRSVRKGILDVRNTSWHDSYNRFRAEVKDLEVMMQNLINTAFKTVNSVEEGVQLLDVFQHLSAREAIKRTLSRKTVDVYAMLSKEVYLVNKELSQ-----------------AHWARAMQRRIQGQMQVCVLENAHFLPQIENDKKVREACMQLLQKLDELVRRMYSEWSQSLDRGSLKNLNQPLMIRCKEKAGMLDINFDKNLLKMFNEMYYWERLQFEIPHHVSEAYQRREDLRTMRENVLLVVRDYNRIISALSADEVGLFRERIRFLDKKLQPGLSKLLWSSHGASNFFISECRLHASKVQLIVDEYKAANLAISKHCGEISELLLVRLDGRTVYRDLEFEEDQQAHRLSQLLRIKTSYQHIVNTMSRVYETFHNDGPEVQQHWVSYTEKMDLMLEEALRLNVKWSLLELSKAISGDSKSPPDPLFKVQVVLRQYGPGSTAQVEFSPTLQKLAQIVNSINSQLISTISVFQRLPDLLTRKRSQRKPVHNIIEQDEEICKIQAAIAAGMTANASHLQAYLKTWDKHREIWEINKDSFIRRYQHLNPPVSSFDSDIARYSEVANNVQKEETVLSVQFVLLDCSPLKFSLVQHCNEWQGKFTQLLSLMASTRLKELHSFLQDNAHRLSQPPQTLVELVEGLKLLETLQGDLNKIESQIPPIHEQFAILEKYEVSVEREVQDLLEALNGEWQGFQQVVIDSDIMLKKHKDKFKSGLFFSAEEFKKKMQTTMQDFNSTGPFGSNVSSEAALEQISVLRAQLESLKEEEGTIRHGLSIFKTEQPTSKDMQNLEKDIDYLLQVWEISQQWDTHWDEWKAGQFASLQTENMESTAQTMYKNLNKLSRELKDKQWEIVEFSKNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNSAEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKDK--------GTEEVFQALEDNQVTLST 1397          

HSP 4 Score: 294.278 bits (752), Expect = 1.109e-78
Identity = 145/292 (49.66%), Postives = 206/292 (70.55%), Query Frame = 3
Query:  372 DEFVT-SNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKM 1244
            D+F+T S  ++L+ Y+    GL++    P+  V +L YFI+    +  +I  E+F   +Q G V G  ++SLLR+MMGI+A     +T WP+SIKN++S  + RF++ LTD R+KL GKTVLYIP EA  +S E  A++K+ + RME++MIHWTRQIKEVL+AQ   E  +SSGPL+EI++WK+RC DLSGIS+QL K GV HI  IL+ AKSSYV  F +LA +I+  TQQAQSNL FL+ L++ C +L+  KP ++   L+ +IN  R+IWVNS +YN+R+ +T +FRK+
Sbjct:  107 DKFITDSTIKILIIYLDPFTGLRVQHTMPSQVVEQLAYFIRE---EETVIMEESFESSVQFGIVRGGDMESLLRLMMGIHASQVALSTAWPESIKNNYSTHMNRFLTNLTDTRYKLVGKTVLYIPVEALQHSPEVAARDKELVKRMEVVMIHWTRQIKEVLNAQETVEIGDSSGPLEEIDFWKSRCSDLSGISQQLQKPGVLHIQAILQLAKSSYVPPFCRLAKQIQDGTQQAQSNLSFLSLLREPCEELALLKPREVEPKLAHIINVSRVIWVNSVYYNTRERLTTLFRKV 395          
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 978.778 bits (2529), Expect = 0.000e+0
Identity = 531/1246 (42.62%), Postives = 757/1246 (60.75%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKL---RLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKE-IDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEE----LSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELW----FQFCMIWSICCSVDEDGRKKIDNYIREM-----------------EGTFPNKDTIYEYFVDNKNKS-WGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLV---CNFHPVMLVGPVGTGKT-SVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQK-RIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQ--DFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            M+ S F+KPFE E+  WE  L  IQ+T++  L VQ QWLYLE IF  +DI +Q+P+E   F  ++K WR +M    +           GLLE     N  LE I K L+ YLE KR  FPRF+F+SND++LEIL ++K+P +V PHLKKCF+ I  L          +  +M+SS+GE V   Q +      G VE WL  +E  M  ++RD++   R+A  +  +KR +W++EW GQ+ + +SQ+ WT +V +A+     R+    L+    + +  L+   E +R  L K  R  + +LV I+VH RD++ ++ + G S    F+WL+QLR+YW  + +  C+I   N   +Y YEYLGNS RLVITPLTDRCY TL  A +L+ GG+P+GPAGTGKTET KDL K+L    +V NCS+GLDY +MG+ F GLA +GAW CFDEFNRI +EVLSVVAQQIL I  A+       F F+G  + L P+  + ITMNPGYAGR+ELPDNLK +FR +AM+ P+ A+IAEI+L++ GF   K L+ K+   Y L  +QLS Q HYD+G+RA+ +VL  AG  K   P   ++ +LL S+ D+N  K  S D+PLF GI SDLFPGI  P  DY    +  ++CC    +QP    + K++Q YE    RH  M+VG+  +GK+    +L   L  +++   +  EK     +NPKS+++G+L+G+FD  ++EWTDG++++  R+  +   PD KW++FDGP+DTLWIESMN+V+DDNK L L++GE I M  Q+SL+FE  +LS ASPATVSRCGM+Y + + LGW P V SWL      +  +E    L  +F+  I      ++ NC E++ T+ +N+V+SL +LF+ L T     +P   +  ++ I  W    F F ++WSI  S D D R++ D ++RE+                 E  F +K  +Y+Y  + K K  W HW+E +K     + +     IIVPT+DT+ +  L   L+     F P++ VGP GTGK+  V    +N LN + +    IN SA+TS+N  Q+II AR++KR K  F P  GK+ + F+DD NMPA + FG+QPP+EL+RQ+ D+G WYD LK T K  + D+ L  AMGPPGGGR  ++ R    FN+ +M   ++  + RIF +++   L+  DF  +   IG+ I  AT+E+Y   +   LPTP K HY FNLRD S+
Sbjct:  843 MRGSPFIKPFEKEIKAWEERLIRIQDTIDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGQLFQTVDKHWREVMRHCVKDPKVLPATSLTGLLEKLQESNNLLEQIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLDF----LPNLDIQAMYSSEGERVELIQLISTSEARGAVEKWLVQVEDVMLSSIRDVINRSRLAYPE--TKRSQWVREWPGQVVLCTSQMYWTQEVHEAI-----RSGVGGLKNYYNQLQSQLKDIVELVRGKLPKQTRTTLGALVTIDVHARDVVMEMIEKGVSHETDFQWLAQLRYYWNNDNVRVCII---NCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMKLE-FFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPAADYQLFLDCAQECCKKHNVQPVKVFLDKMIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNERGYNDEEKVQYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREYASAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWLPLVTSWLNTLPQPLQTQENSTLLLELFNWLIPPALRMLRKNCREVVSTTNSNTVVSLTRLFEMLLT-----EPVTEEPGNKNIRTWIMAAFAFSLVWSIGGSCDRDSRERFDQFLREILSGKLEEHPIPAAVSKWECPFNDKGLVYDYSYEFKGKGCWIHWNESIKNVTLGDKNTKVQDIIVPTIDTI-FCTLFTTLIIFFSPFRPLLFVGPTGTGKSVYVKEKLMNNLNKERYLPFFINFSARTSANQSQNIIMARLDKRRKGVFGPPMGKKCIIFVDDMNMPAMEVFGAQPPIELLRQYFDHGNWYD-LKDTSKITLVDVQLISAMGPPGGGRNAVTPRFLRHFNICSMNAFSDDTMSRIFSNVVAFYLRNNDFPNDCFSIGNQIVAATLEVYKKAMENLLPTPAKSHYTFNLRDFSR 2066          

HSP 2 Score: 975.696 bits (2521), Expect = 0.000e+0
Identity = 523/1267 (41.28%), Postives = 784/1267 (61.88%), Query Frame = 3
Query: 8151 FERYKQRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLS----EKLGSLFDQTFHNI--CP-NKQSPIFGDYMS-----STDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSD-----EAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKS-VMQTQERI---KVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPT---------------WAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGT-YVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLW--YTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            F R  Q  L   K+  + K ++ RL++HE FRVF DR+V D+D+    +L+     E     FD  F ++  C  + +S +FGDYM+     S   Y ++  +E   + ++  L EYN T    +M+LV+FR  +EH+S+I RV++QP GN LLVG+GGSGRQS+TRLA +M + T FQ E+SK+Y   E+R+DLK L  +AGV  + T+FL  D Q+ +E+FLED++++L++GE+PNL+  DE  ++   +       +A    +E +  ++F + ++R R N+HVV+  SP+G+ FRNR+R FP+ +NC TI+WF  WP +AL  VA ++L+ L++      D  +  +  I    H S   +S++ L E+ RHNYVTPT+YLEL++ +++LL  KR  + ++  +  NGL K+    ++V  M  EL + + KL   Q + D+  +V V +      +AKS V++ +E     K  EA+ LK +    +DLA+A+PALEAA+ AL++L   D+T +KS   PP+ V+ VM AV +++  +P                W  +KK LG+ +F++ L  +DKDNI    + KI + Y+   DF P  V K S AA+ LC W+ AMEVY RV +VV PK+  L  A+  L    A L   +A+L  V + +  L++   EK E++ +L+ + +   + L+RA KL+ GL GEK RW K   DL+N    L GD LI++  ++Y+G F + +R+    +WT+  K + IP++  FS  + L +P +IR WNI GLP D FS++NGVIV+   RWPLM+DPQ QA KW+K  E +  L VI L   D++R LE  IQFG P+LL+NV E+LDPSL+P+L K I K GG   ++LG+  IE++ DFRFYITTKL NPHY PE++TK  ++NF +  +GLE QLLGIVV KERPELEE+++ L++  AA K++L E+ED+IL  L  ++G++L+DE  +  L ++KI S E++++ QIAEKTE  I  +R+GY   A+ +SILFF + DL  IDPMYQ++L+ +++L+  SI  S KS   ++R+  L ++ TY +YC  CR LFEK KLLFSF +C+ +L    ++   E+ F L GGV L  +N + NP P WL D++WD I     L    GL     +YP   +    Y S  P  + LP  W +  ++FQ+M+I R LRPD++    +++I   LG KFVEPP  D+ +  +DS++   L+FVLSPG
Sbjct: 2064 FSRVVQGCLLLKKESLENKRTMIRLFVHEVFRVFYDRLVDDQDRDWLYKLMKNIVKEHFKESFDTVFEHLKLCEEDMRSLLFGDYMTPDVEASERLYAEVPSMESFSQVVESYLTEYNQTHKN-RMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMADMTLFQPEISKNYGMNEWREDLKLLLKKAGVKGQKTVFLLTDAQIKEEAFLEDVDSVLNTGEVPNLFAVDEKQEIMEVMHAVRPIAQAGNKSLEFSPLALFAFFVNRCRENLHVVVAFSPIGDAFRNRLRQFPSLINCCTINWFQPWPEEALERVANKFLETLEM-----SDHERQEVMLICKTFHTSAIHLSEKFLSELGRHNYVTPTSYLELIAAFRLLLTNKRDTVMNAKKRYTNGLDKLAFAESQVGEMKKELVDLQPKLE--QAKIDNIKMVQVIEVESVQVEAKSKVVRVEEEAASQKAAEAQALKNE--CESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVKLVMAAVCVMKDIKPEKINDPAGTGQKILDYWGPSKKLLGDMNFLRDLKVYDKDNIPAPVMHKIRSEYMTNPDFDPTKVAKASSAAEGLCKWITAMEVYDRVAKVVAPKKANLIVAQQSLAATMALLNQKRAELKEVEDRLAALKKTLEEKTEEQAQLQFQVDLCARKLERAEKLIGGLGGEKTRWSKAADDLQNTYDNLTGDVLISAGVIAYLGAFTAGFRQNCTKEWTKLCKSKNIPSSDDFSLSKTLGDPIKIRAWNISGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERENNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQIFKQGGMDCIRLGESVIEFSSDFRFYITTKLRNPHYLPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQSSEGNILEDESAIQILDSAKIMSNEISKKQQIAEKTELKIAESREGYRPIAKHSSILFFSIADLANIDPMYQYSLNWFVNLYINSIQDSNKSKILEKRLRYLINHFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYAEFMFLLTGGVGL--QNNVPNPDPNWLQDKSWDEICRASDLPGLQGL-----RYPPFCHFLPIYDSKEPYNTPLPKPWCDKLSDFQKMIIYRCLRPDKIEPAISNYITGKLGKKFVEPPPFDLSKSYNDSNSTIPLVFVLSPG 3313          

HSP 3 Score: 76.6406 bits (187), Expect = 6.417e-13
Identity = 55/229 (24.02%), Postives = 104/229 (45.41%), Query Frame = 3
Query: 3927 LFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNR------------------------------VDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDD 4523
            L+K +Q    EI  ++++++  + ++ L L+W+    +W  G F++L    ME   +  FR+  K  +  + K  +  E  R R                              + +F+  +P+++ L N  +R RHW Q+ +EI       +S  TL K++  N   + E    +S AA+KE ++E AL+ M + W+ +      H  +E    +L+ +D++   LDD
Sbjct:  611 LYKWDQTVYPEIDVMKENIEPYQKVFGLVLKWQRTEKRWMDGSFLDLNGESMEAELDEFFREIYKMLKSFQQKQ-KKAEQGRERQVAMKRRPGEGDDDHLESPTALMCIKVIEQIKEFKEHIPMVSILCNPGIRARHWEQM-SEIVNHDLTPNSGTTLRKVLKQNLSAYMEHFETISAAASKEFSLEKALQNMVETWDIISFS--HHAHRESGVSILTAVDEIQTMLDD 835          
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 974.541 bits (2518), Expect = 0.000e+0
Identity = 524/1246 (42.05%), Postives = 765/1246 (61.40%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDN--FQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLL---QSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADT-RPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIE---------LIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIR------------------EMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQ-KRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  M  SRF+ PF + + +WE++LS I E +E+ + VQR+W+YLE+IF+G DIR QLP+E+  FD I+K ++ IM++  +    + C      L     ++  LE  QKSL+ YL++KRN FPRF+FIS+D+LL ILG S+ P  V  H+ K +DNI SL+ +   +    A ++ S++GE +  KQ +  EG VE W+  +   MR T R + ++      +  S+ D W+ ++ G + +  +Q+ WT +V    Q ++   +K+ ++   KK    ++     I   L K  R K+N++++I+VH RDI++   +   +D   FEW SQLRFYW+K+ DD  ++Q +  F YGYEY+G +GRLVITPLTDR Y+TLT AL ++ GG+P GPAGTGKTE+ KDL K+LG   +V NC EG+DY ++G++FSGLAQ GAWGCFDEFNRI+  VLSV++ QI +I +AL      +F F+G+ I L   +GIFITMNPGYAGRTELP+++K++FRP+ ++ PD   I EI LF+EGF   KVLAKK+  LY L+ +QLSKQ HYDFGLRAL SVL  AG  KR +P + ++ +L+ ++ DMNL K    D+PLF G++SDLFPG+D P + Y N  +A+E   +   + L P    + KVVQ+YET  +RH+ M+VG T  GKS     L   Q+ L  L+K           + LNPK++S+ ELYG  D  T +WTDG+LS++ R     T + + ++I+FDG VD LW+E+MNSVMDDNK+LTL NGERI +    +LLFEV +L  ASPATVSRCGMV+ D  +L + PY + W+  +       +L ++F+KY+  I   +     +         ++  +  N V+ L  + D L       +P D    S  +E +F   +  S+  ++ E GRKK D+ ++                  E+ G  P   T++++  D   K W  W   L A + +N    F  I+VPTVDT R N+L++ +V    PV+LVG  GT KT+   N LN LN D   +LTIN S++T+S ++Q  +EA VEKRTK+T+ P  GK +L FMDD NMP  D +G+Q P+ L++  +D G  YDR K+   K++KD+    AMG  GGGR  + +R  S F++ N+ FP E  L  I+ S++    + FEE ++ + D +T  T+E+Y  ++    PTP+K HY+FNLRD+S+
Sbjct: 1314 LQSMAGSRFIGPFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSDLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSE-PACVQEHMIKMYDNIASLRFDSGTNGETVAGALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQKKSRVD-WMLDYQGMVVLAGNQVWWTWEVEDVFQKMSS-GEKQAMKQYAKKMHQQIDNLVRRITQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRFYWDKKPDDLFVRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQL-KRFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVETILEENKYSLLPNQ--VDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRLGLLTK----------MYALNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRPPKEQA-DLRKLFEKYVPSIIEMVVEGITDGKQGEKLKTIVPQTDLNMVVQLSMMLDAL------LEPEDLS--SEELECFFIEALYCSLGAALLETGRKKFDDLVKKLSCLVSVQDEKTLAGPGEIPGYLP---TLFDFHFDGTTKKWMPWS-SLVAKYIHNPDTKFIDILVPTVDTTRVNWLLEQMVKVKRPVVLVGESGTSKTATTQNFLNNLNPDFTMVLTINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKGHTRPFEECIRNMCDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSR 2530          

HSP 2 Score: 812.372 bits (2097), Expect = 0.000e+0
Identity = 461/1233 (37.39%), Postives = 739/1233 (59.94%), Query Frame = 3
Query: 8181 TNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVE-----LLSEKLGSLFDQTFHNICPNKQSPI-FGDYMSSTD-----TYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRG-AEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVID-LHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKL--ANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            TN +   T+    R+W +E  RVF DR++ + DK A V+     L+ E  GS  D    +       PI FGDY ++        YEDI D +  K   +E+L+EYN      +M+LVLF DA++H++++ R+IR  RG+ LLVG+GGSG+QSLT+LAA+      F+I +S+ Y +  FR+DLK LY + G++NK T+FLF D  V +E FLE INN+L+SG +P L+  DE + + NQ+ DEA + G   + +S++ Y I++   N+H+VL MSPVG+  R R R FP  VN T IDWF  WP  AL  VA+ +L +  +      + +  H+     ++H SV + S     +++R NYVTP NYL+ +S Y  LL +K + +     +L+ GL K++E   ++  ++ +L E +  LA     C+  L  I      A+++ K   +  + I+      L  ++ A + LA+A+PALEAA  AL+ L+K D+TEI+S+ KPP  VQ V E ++++RG  E  W  AK  + E +F++ L+  D D+IS   +K +  ++   +   + +  +S A   +  +V A+  Y  V R ++PKR+++   E    + + +L   Q++L+A+ +E+  L ++Y+  M +K+ L+++A+  E+ L  A KL+SGL  E  RW + + +L+ +   L GDCLI++AFLSY G F  D+R  +V + W + + +  IP +  F     L++  +I  W  + LP D  SV+NG++ TR SR+P+ +DPQ QA  WIK+ E K    I   + PDF++ LE+AI++G P L Q+V E +DP +D +L K++    G  V+ LGDKE++Y+ +F+ Y+ TKL NP Y+P +  K  ++N+ V  +GLE QLL ++V  ER ELEEQ++ L+   +  KR L +LED +LR L  + G++LD+ +LV+TL+ +K  + EV E+L++AE T   ID  R GY   A+R +ILFFVL ++  ++ MYQ++L +++++F+ S+ KS  +    +R+SN+ +  T  VY Y C GLFE+HKLLFSF +  KI Q  G+   +E  FFLKG + L++  +   PC  WL DQ W++I  L++L    F  LI   E+ P++W  W+  DSPE +  P ++ ++   FQ++L++R  R DRV    + ++   +G K+V+PPV+  + + + S+  + ++F+LSPG
Sbjct: 2538 TNAERFLTEAQFVRVWRNECLRVFYDRLINETDK-ALVQGHIKSLIQEHFGSELDSAMRD-------PILFGDYRTALSESEPRVYEDIQDYDACKALFQEILEEYNENK--TRMNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMGSGHSKESVWQYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLGESPMIPAAHSETVIGHVC----MVHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPKQVQVVCECILVMRGHKEINWKTAKGMMSEANFLRSLMEMDCDSISGGQVKTVRGFLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQPFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNVKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEFFLKGNLSLEKSKR-KKPC-DWLPDQGWEDIVRLNELFPNEFGALIEDIEKNPKEWKNWFDLDSPEQAPFPMKYRDSLTVFQKLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQSTPNSPIVFILSPG 3754          

HSP 3 Score: 131.339 bits (329), Expect = 0.000e+0
Identity = 160/888 (18.02%), Postives = 360/888 (40.54%), Query Frame = 3
Query: 1947 PKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSII----SQG----MLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKI-------DSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRE-TYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPR------IGEVLQKVKLKKSIWEF-----ISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPH-KDKEKNHFLLSGIDDLYQTLDDN 4526
            P  AG   W R L  RI+  ++   +   LP    N   +   T+  + +   +R   ++ + G  ++  + L   L++R+++    S G     L +NF+  L ++  E  Y +RL + VP  A ++ ++        + +  +V+  + ++ +LN  E  L   Q++ L + ++ G  ++ W+S G  E F+        + +  V + K    D+    + I +  + K        D   + E  E  + Q     ++   +    G ++ +      +  +  +  + QY+  +  KV     +A    V  +L   N A+ G      +PLFK+   L   ++V  P   ++  ++    ++ +E  K   R      I    Q+V  +   + F     I    ++ +    +    Q +  S+   LG W ++  +W L+K   + ++    P   + D  +  Y+ +  +      +  V  ++LD   L +++  + + W   L  LL   A + L  L + ++ +SE + K P  LE+L   +  +  + +    ++ +F  + E +  L  Y +Q  ++      N+   W +      + ++ + ++K  F      Q   +K++V+     F  +GP   ++       ++      L  ++   Q++     LF +      E+  +++++  +  I+++   ++   T+W    ++ L    ++       +   K  +D+  +   +  +   R+ +F+ ++PL+ DL+NEA+RDR+ F                + L  + D +     + + EV                    WE ++  +  + K  ++  ++L  +D++ Q LDDN
Sbjct:  475 PPVAGAVYWERLLFHRIKDPIIRFQE---LPEMLDNEQGKS-VTEKYLEVGRRMRDYEVKKVEGWRKETERMLP-ELMNRTLLLTVDSSGDRGIRLVVNFAPELKEIISETIYLDRLGYAVPELARNVALQEHRFLRCVDELKNLVKRCHSLMDSLNDAEFLLLTPQVQELRRVLRAGWRRLNWNSLGIAE-FIGRSEQAVTKFESLVSQIKKNARDVDAKLQDIETANLFKFPAPDKAGDLPGVKEFFELVEKQRVKDVILLSLMYTAIGPLLTKTESLIMQTSTGRAESMTQYYAYWERKV----YDALTKMVLKNLQVFNTALMGS-----TPLFKIETILSAPEIVLHPKSNDVYKLMMQSVRDCLECTKRFVRWMNGTCIECPPQRVDGEDEPFVFSFYSEIYPQPQVNECAVAVSQSAQQLLGSLGRYLGRWKRYHPLWNLDKSIMMEKFAAKKPACVTYDEKLKFYSNIGQEVAQQPLVKDVHVVRLDLEPLAHTVQENVQAWVSSLGRLLNDSAREDLYALRSELQQLSENLKKSPDTLEDLKFVLSTISNIRDMSVDVELRFRDIQERYRTLTMYNIQVPEEELQLAANIRNMWSDLFSESRQVDRSLGRAKKTFTEITKEQIVQYKQEVAIFAESFNMHGP--GAVGDNLDKGRLRYCSEELAKIEAGRQDLVGAEKLFDLPITTYPELLNVQREMRALRQIYEV---YKAAKTEWSQTLWVNLNIQLLQEGTEGFIKSLRKLPKDV--RAMPVAFFLEGRMKEFKESLPLLLDLKNEALRDRYLFL-------------HCYRLYLLKDWSLIGSPQGVKEVVDT-----------------WEVMKFSVQRYFKGTQERGYILGSVDEIQQNLDDN 1310          

HSP 4 Score: 91.2781 bits (225), Expect = 2.941e-17
Identity = 65/265 (24.53%), Postives = 129/265 (48.68%), Query Frame = 3
Query:  720 GKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKP-----EDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKP-WNLDKTNIFAQIDAFIQRCKDLIEICE 1496
            G   L+IP       VE     ++ +  +E  +++W  QI  VL  Q   +  ++ GPL EI++W+ R   LS +S+QL    VK I +++  A+ + V       +E+     +A +N+ FL+TL+    +L+         E IP M+    N ++++W+ S HYN+ + M  +  +++ E+ +R    +++  +F  +   +  K+ +     +Q+K  Y ++    +T  + P W  D+  +F + D     C+DL  + +
Sbjct:  130 GGIKLHIPELDLKQEVEALLANQEAVEILEQCVMNWQAQITIVLEEQQK-KKPQAPGPLAEIDFWRERAAALSALSEQLKLPVVKKILEVMTRAEPATVQNLDLTVTELNNYLVEAVNNVDFLSTLERHFKNLATGVSFIVILETIPQMM----NGLQLVWIISSHYNTDERMVPLMERIAWELSERVARVVNIRLLFKERREVAKAKVLDGKKVLDQWKSCYFEVRARIETSGTDPRWEFDRKKLFEKTDYMASICQDLYNVLQ 389          
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 886.33 bits (2289), Expect = 0.000e+0
Identity = 482/1228 (39.25%), Postives = 712/1228 (57.98%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLG-EDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIE-----KLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEG---------TFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKL--QDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDIS 8166
            L  + +S+ V  F  EV  W++ LS     + +   VQR W +LE+IF+G EDIR QLP++S  F+ I+  ++ +  + ++  N      K GL      +   L   +K+L  YL+TKR  FPRFYFIS+ DLL+IL    +P +V  HL K FDN   +K E     K    G     MFS + E V F +     G VE WL  +   MR T+R  + +  +A +     R++W+ ++  Q+ +T +QI WT+DV  A   + +   +  ++   KKQ   L      +   L+   R K+ ++  I+VH RD++ K+      +  AF WLSQLR  W++    C     +  F Y YEYLGN+ RLVITPLTDRCYITLT +LHL   G+P GPAGTGKTET KDLG++LG  V V NCSE +DYKS G ++ GLAQTGAWGCFDEFNRI++EVLSVVA Q+ SI  A+  +   +F F G  I+L PSVGIFITMNPGYAGRTELP+NLK++FRP AMV PD  +I EI L AEGF   ++LA+K  TLY L  + LSKQDHYD+GLRA+ SVL  AG  KR +P  P++++L+ ++ D N+ K+ + D+P+F G++ DLFP +D P     + ++ + +   + +LQ  +  + KVVQL E    RHSV +VG   +GKS         L  L+K  ++   + +   LNPK+V+  EL+G  +  T EW DG+ S++MR+    +    KWI+ DG +D +WIES+N+VMDDNK+LTL + ERI +   + L+FE+ +L  A+PATVSR G++Y +  DLGW P V SW+ ++        L+ +FDKY+    + ++    ++I     + V  LC L +CL T E+    +  D +  + EL+F F  IW+   ++ +D   ++ +Y  E             FP++ T+++Y++D + K +  W  K+   ++ +  +P    +V T +T+R +Y ++ L+    P+MLVG  GTGK+ +    L  L+ D +TI  +  +  T+S  +Q ++E  +EK+    + P G KR++ F+DD NMP  D +G+  P  LIRQ +DY  WYDR K   K I  +     M P  G    I+ RLQ  F++  ++FP    L  I+ S++ Q L  + F   ++  G  + Q  ++ +  V   FLPT  K HY+FNLRD+S
Sbjct: 1318 LQNLMSSKHVAFFLEEVSSWQKRLSVADSVISIWFEVQRTWSHLESIFIGSEDIRSQLPEDSKRFEGIDTDFKELAYDAHKTPNVVEATNKPGLYSRLEDIQGRLALCEKALAEYLDTKRLAFPRFYFISSADLLDILSNGTDPHQVQRHLSKLFDNTAKMKFETDADGKPSKTGI---GMFSKEEEYVPFNEPCDCTGQVEMWLNRVLDTMRATVRHEMTEAVVAYED--KPREQWLFDYPAQVALTCTQIWWTSDVGLAFSRL-EEGYENAMKEYYKKQVSQLNTLITMLIGQLSPGDRQKVMTICTIDVHARDVVAKIIAQKVENSQAFVWLSQLRHRWDEREKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAI-RDKKKRFNFMGEEINLFPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPERPEDQVLMRALRDFNVPKIVTDDMPVFMGLIGDLFPALDVPRKRDLDFEKFVRESVLDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGNAGTGKS-------QVLKSLNKTYQNMKRRPVWADLNPKAVTNDELFGIINPATREWKDGLFSNIMRELANVSHAGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLVFEISHLRTATPATVSRAGILYINQADLGWNPPVSSWIDKREIQSEKANLTILFDKYLPACLDTLRSRFKKIIPIPEQSMVQMLCHLLECLLTPEH----TPPDCHKELYELYFVFAAIWAFGGALFQD---QLVDYRVEFSKWWVTEFKTIKFPSQGTVFDYYIDPETKKFEPWS-KMVPRFEMDPEIPLQACLVHTTETIRVSYFMERLLERRRPIMLVGNAGTGKSVLVGGKLGSLDPDKYTIKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGSKRLIYFIDDMNMPEVDAYGTVQPHTLIRQHMDYNHWYDRSKLQLKEIHSVQYVSCMNPTSGS-FTINPRLQRHFSVFALSFPGVDALNTIYCSILGQHLSREGFSAVVQKSGPQLVQLALDFHQRVTATFLPTAIKFHYIFNLRDLS 2522          

HSP 2 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 463/1236 (37.46%), Postives = 702/1236 (56.80%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDT--YEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECD-DYLVVIVQQKREADDQAKSVM-QTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILR---GAEP---TWAEAKKHLGEQD-FIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIK--KEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q ML    +   T   + ++++HE+ RV+ D+MV DKD   F +L SE +G  ++     +   K   ++  +        Y  +   E L K + E LD YN       M+LVLF DA+ HI +I R++  PRGN LLVG+GGSG+QSLTRLAA++     FQI + K Y   + + DL  L  +AGV N  T+FL  D QV DE FL  +N++L+SGEIP+LY  DE++++ N + +E +  G+ D+ ++ + + I+RVR  + V LC SPVG   R R R FPA VNCT IDWF EWP +AL  V+ R+L++++      E  +K  ++   + +H SV+  S+  L   +R+NY TP ++LE +  Y+ LL  KRK L+    +L+NGL K++ T A+V+ +  +L  A +++ + QK  D D L+ +V  + E   + K+V  + +E++        + Q+    DLA+A PAL AA +AL +LNK ++TE+KS+G P A V  V  AVM+L    G  P   +W  AK  + + D F+  L+NF+K+NI +  LK I  Y+   +F+P++V   S AA  LC WV  +  +  VY  VEPKRQ L  A + L   Q +L+  +AK++ + E + +L  ++ +    K + +++AE T + +  A++LV GLA E  RW + V + + Q   L GD L+ +AF+SY+G F   YR  L+   W   +   K  IP  P    +  L +   +  W  +GLP D  S EN  I+T   RWPLMVDPQ Q  KWIK   G  L+VI +    ++  +E A+  G+ VL++N++E +DP L P+L +  +K G    +K+GDKE EYN  FR  + TKL NPHY PE+  +  ++NF V   GLE QLL  VV  ERP+LEE K NL       K  L  LED +L  L+ A G+ L D +LV  L+ +K T+ E+ E+++ A+ TE  I+ AR+ Y   A RAS+L+F++NDL KI PMYQF+L A+  +F  ++ K+       +R+ NL D  T +V+ Y  RGLFE  KL ++ Q+  +IL  + ++N  E +F L+  V     + +D     +LS  +W  I  L  +  F  L    E   + W  +   + PE    P EW N T+  Q++ ++R+LRPDR+++    F+   LG+K+V    +D     ++S A T + F+LSPG
Sbjct: 2526 QGMLFCKSECMKTPQDLVKVYLHESNRVYRDKMVEDKDFSTFDKLQSEMVGKFYEDMEEALEEAKVMNMYCHFALGIGEPRYMPVQSWESLNKTLLEALDSYNEVNAA--MNLVLFGDAMSHICRINRILESPRGNALLVGVGGSGKQSLTRLAAFISSLEVFQITLKKGYGITDLKSDLGALCIKAGVKNIGTVFLMTDAQVADEKFLVLVNDLLASGEIPDLYPDDEVENIINSVRNEVRGQGLLDSRENCWKFFIERVRRQLKVALCFSPVGSKLRVRSRKFPAVVNCTVIDWFHEWPQEALESVSLRFLQEVEHI----EPEVKDSVSKFMAYVHVSVNKTSKDYLANERRYNYTTPKSFLEQIKLYRNLLALKRKDLTMKMERLENGLQKLNSTSAQVDDLKAKL--AAQEVDLKQKNEDADRLIQVVGVETEKVSREKAVADEEEEKVASIAVVVTRKQKDCEEDLAKAEPALIAAQEALNTLNKNNLTELKSFGSPVAAVTNVTAAVMVLMAPGGRVPKDRSWKAAKVMMAKVDAFLDSLMNFNKENIHENCLKAIQPYLQDPEFKPELVAAKSNAAAGLCSWVINIVKFYEVYCEVEPKRQALNKANAELASAQEKLSVIKAKINHLNENLAKLTAKFEKATADKLKCQQEAETTARTISLANRLVGGLASENVRWAEAVNNFKQQERTLCGDVLLITAFVSYLGYFTKRYRHELMDNTWKPYLSQLKVPIPVTPGLDPLSMLMDDADVAAWQNEGLPADRMSTENATILTSCERWPLMVDPQLQGIKWIKNKYGDNLQVIRIGQRGYLDSIERALSAGEVVLIENLEEAVDPVLGPLLGQETIKKG--RYIKIGDKECEYNPRFRLILHTKLANPHYQPELQAQCTLMNFTVTRDGLEDQLLAAVVSMERPDLEELKSNLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGDTELVENLEITKRTAAEIEEKVKEAKVTEAKINEAREHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQKAVLKAAPDEALKQRVLNLIDSITSSVFQYTTRGLFECDKLTYTAQLAFQILLMNKEINPSELDFLLRYPVQPGVTSPVD-----FLSHHSWGGIKALCSMDEFRNLDRDIESSAKRWKKFVECECPEKEKFPQEWKNKTS-LQKLCMMRALRPDRMNYAIRDFVEEKLGSKYVMGRSVDFAVSFEESGAATPMFFILSPG 3745          

HSP 3 Score: 128.257 bits (321), Expect = 1.821e-28
Identity = 216/1049 (20.59%), Postives = 417/1049 (39.75%), Query Frame = 3
Query: 1551 FQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQ----GIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGL-DRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWE-RLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQ-------MRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLP-----ELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKKSIWEFISTDDEITKIQTNIRHGMQD----ISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSID-----AD----------------ISRYTEVTNKALDAEAM-VTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMK----NMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIP-PQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQI--KNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            F G RG  +   ++ +   F+   +   ++    LDV    +  D+N F+  ++D +         AF+    ++     G+E+L  F +L               I+    +  ++ V K             ++P  AG   WA+ L++RI                           Q + A + V  K+       L  RDP  +L              + +NF+  L+ + +E+ Y + R   D+P   ADIY  +  L     ++ L+V  YN+++ T+   E  L ++Q++T+D +++     I W+S G  EY +   R     L+K++ + K   D+I+          ++K  +N ++E  +  +    +     E+L   +G+           ++    +F  D S  +  W  Y+  +D+   + F  ++  SL       N D +   +PLF+  L+LQ+ DLVF P+L         ++V SL  +   +   +PR+ E         S +     D E      ++R  + +    + +   E    ++++  ++  +++EF+ Q+  L  HV + +     AD                +  Y  +  +    E + V   ++++D    K+++    + W       L+   T SL  L  ++K     +  KV +   +   L + M  L  + E +    E F PL     +L  YE +  D +  + + L ++W    +  V  +Q +   +      L  +   F  +       F+ NGPF   I  P E L         +ES+  +  E      LF++  P  K++    K++  ++ +W +      N   W++  + E+   EME L    F K  +   D + + W+      + V     ++  I +L+N A+R RHW Q+     +R   DE+++   L  +   +F+     +  +   A KE+ +E  L  ++  W ++E     H        LL   +DL +TL+DN+  L N
Sbjct:  380 FGGVRGRSLSQQVVWLHEEFQERFKTFAEKSYDCLDVCNLEFEADFNDFKHKLEDTDRRLGAIFCQAFDDSGNLEHAFKIGVEVL--FTNLF--------------IVA---LPGYSPVNK-------------NMPVVAGGLRWAQQLQERI---------------------------QTTAACKSVGEKSQYNLNQPLISRDPTTTL--------------ITVNFNPQLVSVLREVKYLKARESEDIPDLTADIYSNKELLWQYVANLDLMVGWYNKVIGTVLEVEFPLIQDQLRTIDLQLKEAEDTINWTSNGIWEY-IQGVREAVHDLEKRLQKTKDNVDEIQS---------IMKTWANPVFERKDGKNDSLLNLEDRPERLEKTYGQFRTSGAKIHLLLKNNLSLFKADPSSDE--WRSYVEYIDEMVIDGFFNSIDSSLKFFLD--NTDQKPGLAPLFEAQLDLQVHDLVFHPSLEFGASDGFYDLVESLINDVYRISSLVPRLAE--------HSSFPHYQADMEDMADLADMRQLLMERVHRVMAQCCEHRNAFERYAYLYVDDRKEFMRQFL-LYGHVLTTEEIEAHADEGVPEDPPTLERFREQVDSYERMYEEVQKLEPVHVFEGWMRVDARAFKSALLNIIKKWSLMFKQHLIDHVTNSLSELEEFIKCTEGGLGIKVEE--GDYAGLVKVMGHLMAVKERQGATDEMFEPLQHTIDLLKTYEQELPDVVYKQLEELPEKWINMKKQAVVVKQHVAPLQASEVANLRRKCATFDVEQFKFREHFRKNGPFRFDIVNPYEMLDTTHKQIQEMESIMAKLIE---SAGLFEVNIPDYKQLKQCRKEVSILKELWDVVSVVRFNLEAWRTTPWREINVEEME-LECKRFSKELRL-LDKEARAWDAFCGLDSTVKNTLTSLRAIAELQNPAIRPRHWQQLMTATGVRFSMDEDTTLTDLLNLNLHHFEDE---VRAIVDRAVKEMGMEKVLTELDATWTAMEFGYESHPRTSVP--LLKSDEDLVETLEDNQVQLQN 1320          

HSP 4 Score: 103.605 bits (257), Expect = 4.685e-21
Identity = 95/447 (21.25%), Postives = 196/447 (43.85%), Query Frame = 3
Query:  366 VQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSL------LRIMMGIYAPSYFSNT----MWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIE--YWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQ---------IVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEIC--ECQAHFARF----EDGNKKEMPIFQGA---RGAEVEMIILQIETVFEN 1616
            +QD    S++  LV  + +   L     F   + N+ VYFIKR       +  ++    +  GT+CG  ++ L      + ++  +   S   NT     WP  +  D         ++++    + +GKTVL +P  +    +E+   +K  I+ +E ++I W+ QI  VL   ++    E + P  ++E  +WKNR  DL  I+ Q     V  + ++L+  +SSY  A+  +  +++   ++A     FL  L+ +  DL  ++  ++   ++ L++ + ++W NS+HYN+   +  + ++  N  I++       + +   Q          V  M KL+   +   + + +  ++ ++H+ +  +               F ++  D +++C  E +A F  F    ED +++   IF  A    G       + +E +F N
Sbjct:   39 IQDFLDKSDHTTLVISLTAAGQLIPAVDFAVSQKNKAVYFIKRGQTS---LTPDSVKTNVYFGTMCGPPLEQLPAFVEEVTLIFDLTYASILCNTKNHFHWPCVVSEDLMRHAHVLRTSVSVVVGQAKGKTVLPLPPGSE--RIEHLV-DKSIIHSIESMVIDWSHQIHGVLKRDSSEPLLEGTNPTPQVELNFWKNRYADLQCINDQFKSPKVTKMAQLLDVIESSYYPAYRNMVQDVERALEEATDINLFLKPLQRLTEDLESTEFSNVKERIAPLMHTVCLVWANSKHYNTPARVIVLLQEFCNLFIQQSVFEDKRNSLSQYQRNGMEALLLAVVDMMKLEKLEFGGVRGRSLSQQVVWLHEEFQER------------FKTFAEKSYDCLDVCNLEFEADFNDFKHKLEDTDRRLGAIFCQAFDDSGNLEHAFKIGVEVLFTN 467          
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Match: dnah9l (dynein, axonemal, heavy polypeptide 9 like [Source:ZFIN;Acc:ZDB-GENE-050506-1])

HSP 1 Score: 830.476 bits (2144), Expect = 0.000e+0
Identity = 476/1193 (39.90%), Postives = 680/1193 (57.00%), Query Frame = 1
Query: 4636 LTVQRQWLYLENIFL-GEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFE-----ASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDG----RKKIDN-YIREMEGT-FPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQ-DIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEEL---KPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDIS 8166
            L VQR W +L++IF   EDIR QL +++  F     Q  VI+                     F+     L   +K+L  YLETKR  FPRFYF+S  DLLEI+ +   P +V  HL K FDN+  LK      Q  E     A  M+S +GE V F +    EG  E WL  LE  MR T+R  + +   A +     RD+W+ ++  Q+ +T SQI W  DV  A + V +   +  L+   KKQ   L      +   LT   R KI +L  I+VH RD++ KL      +  AF WLSQLR  W+++   C +   +  FQ+ YEYLGN+ RLVITPLTDRCYITLT +LHL   G+P GPAGTGKTET KDLG+SLG  V V NCSE +DYKS+G ++ GLAQTG WGCFDEFNRI++EVLSVVA Q+ +I  A+  N   +F F G  I+L P+VGIFIT+NPGYAGRTELP+NLK++FRP AMV PD  +I EI L AEGF   ++LA+K  +LY+L  + LSKQDHYD+GLRA+ SVL  AG  KR +   P+E++L+ ++ D NL K+ + D+P+F G++SDLFP +D P      +++ + +     +LQP    I KV QL E    RHSV +VG   +GKS   + L    + +         K +   +NPK+V+  EL+G     T EW DG+ SS MR+  A +    KWI+ DG +D +WIES+N+VMDDNK+LTL + ERIS+   + LLFE+ +L  A+PATVSR G++Y +  DLGW  YV SW+  +        L+ +FDKY+      ++ N   +     T+ V +LC L DCL T EN    +  D+   + E++F F  +W+   ++ +D     R +    + +EM    FP++ T+++Y++D   K +  W E+    ++    VP   ++V + +T+   Y ++ L+    PVMLVG  G GKT +  +T+++   + + +  +  +  T+S  +Q    E  +EK+    F P G K+++ F+DD NMP  DT+G+  P  LIRQ +DY  WYDR +   K I +      M P  G    ++ RLQ  F++  + FP    L  I+ S+++             + +G ++ QA I ++  +   FLPT  + HY+FNLRDIS
Sbjct:   11 LAVQRTWAHLQSIFTNSEDIRNQLAQDAERF-----QDTVIIC-------------------LFSICTLRLSVCEKALAEYLETKRLTFPRFYFVSAADLLEIVSKGTQPRQVTRHLLKLFDNLADLKFRDEEEQEDEGRTEVAVGMYSREGEYVPFSEPCVCEGQAECWLGGLELAMRSTVRHEISEAVSAYED--KPRDQWLLDYPAQVALTGSQIWWATDVGIAFERV-EEGFETALKDYNKKQVSQLNSLINMLLGELTPGDRQKIMTLCTIDVHARDVVAKLISQKVMNGQAFAWLSQLRHRWDEQQKHCYVNICDAQFQFSYEYLGNTNRLVITPLTDRCYITLTQSLHLTMSGAPSGPAGTGKTETTKDLGRSLGIMVYVFNCSEQMDYKSIGNIYKGLAQTGVWGCFDEFNRISVEVLSVVAVQVKTIQDAV-RNKKHRFHFLGEEIELRPTVGIFITLNPGYAGRTELPENLKALFRPCAMVIPDFELICEIMLVAEGFIDARLLARKFISLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKREDRNHPEEQVLMRALRDFNLPKIVTSDVPIFLGLISDLFPLLDVPRKRDLQLEQHVRQAVTELRLQPEENFILKVTQLEELLAVRHSVFVVGGPGTGKSQILKTLHKTYSNMKL-------KPVWTDINPKAVTTDELFGFLHPATREWKDGLFSSTMRELSALSHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERISLTSSMRLLFEISHLKAATPATVSRAGILYVNPQDLGWSSYVTSWIDTRKAQSERANLTILFDKYVPYCLEQVRCNLKTITPIPETSMVQTLCCLLDCLLTDEN----TPADSPRELYEIYFVFACVWAFGGALFQDHLIDYRAEFSRWWCKEMRAVKFPSQGTVFDYYIDPNTKKFTPWSERTPP-FELEPDVPMQMVLVHSAETISLAYFMELLLEKGKPVMLVGNAGVGKTILVWDTISKRKEE-YMVAKVPFNYYTTSAMLQRKCGEKSLEKKAGRNFAPPGTKKLIYFVDDLNMPEVDTYGTVQPHTLIRQHLDYSHWYDRQRLVLKEIHNCQYITCMNPTAGS-FSVNPRLQRHFSVFAVHFPGAEALSTIYSSILSGHFLQGGYSYGVSRSVGTLV-QAAICLHQKMTQNFLPTAIRFHYIFNLRDIS 1160          

HSP 2 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 421/1220 (34.51%), Postives = 682/1220 (55.90%), Query Frame = 3
Query: 8214 ITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTD--TYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECD-DYLVVIVQQKREADDQAKSVMQTQE-RIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILR---GAEP---TWAEAKKHLGE-QDFIKQLINFDKDNISDRTLKKIG-TYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKI-LQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            +  LW+HE  RV++D+++ +KD   F ++L +     F+    +I  + Q  I+  +        Y  ++D EKL+K + E L+ YN       M+LVLF +A++HI +I R++  P GN LL+G+GGSG+QSL RLAA++     FQI + K Y   + R D+  LY + GV N  T+FL  D Q+ DE FL  IN++L+SG+IP+L+ ++E+D +   +  E +  G+ DT ++ + + IDR+R  + VVLC SPVG   R R R FPA VNCT IDWF  WP  AL  V+  ++ +    I G E  +K  ++   S  H SV+++S +     K  NY TP ++LE +  Y  LL  K+++L+    +L+NGL K+  T ++VE +  +L  A +++ + Q+  D + L+  + Q+ +  +Q KSV   +E ++   +A+  K Q+ +  DLA+A PAL+AA  AL +LN+ ++TE++++  PP +V  V+ AV++L    G  P   +W  AK  + +  DF++ L+NFDK++I D T++ +   Y++  DF P+ V   S AA  LC WV  +  +  V   VE KR  L  A + L E   +L   + KL  +   +  L   + +   +K   + +   T K +  A++LV GL       E  ++    Q   L GD L+ +AF+SY G F   YR  L+ K W   ++ +++        I  L++   +  WN +GLP D  S +N  I+    RWPL++DPQ Q  KW+K   G  L+VI+L    ++ V+E A+  G+PVL++N++E +DP +DP+L +  +K G    +K+GDKE  YN +FR  + TKL NPHY PEI  +T ++NF V   GLE QLL           E  K  L       K +L +LEDE+L  L+ A+ + L D  LV  L+T+K T+ E+  ++  A+  E  I+ AR+ Y   A RAS+L+F++NDL KI+PMYQF+L A+  +F  ++  +      + R++ L D  T++ + Y  RGLFE+ KL F+ Q+  ++ L  S ++N+ E +F L+  +     + +D     +LS+ +W  I  +     F GL    E  P+ W     S+ PE   LP EW + ++  Q+++++R+LRPDR+++   +F+   LG ++ E   ++  +   +S   + + F+LSPG
Sbjct: 1180 LVYLWLHECSRVYSDKLMEEKDVELFNKILLDTGKRYFEGIDESIFIH-QPLIYSHFAHGVGEPRYAQVSDWEKLQKTLTEALEHYNELHA--NMNLVLFEEAMQHICRISRILEAPVGNALLIGVGGSGKQSLCRLAAFLSMLEVFQITLRKGYGISDLRSDIAALYIKVGVKNIGTVFLHTDAQIPDERFLVLINDMLASGDIPDLFSEEEVDMIVASIRLELRGLGLLDTRENCWNFFIDRIRKQLKVVLCFSPVGFTLRTRARKFPALVNCTAIDWFHPWPQHALQSVSRTFINN----ISGLEPAVKLSISDFISFAHTSVNEVSVKYQQNEKHFNYTTPKSFLEFMKLYGNLLGAKQRELTQKMERLENGLQKLLSTASQVEDLKAKL--ALQEVELHQRNTDTEALIAKIGQQTDKLNQEKSVADEEEQKVAAIQAEVTKQQQESEDDLAKAEPALQAANAALNTLNRLNLTELRTFANPPVIVANVLAAVLVLMAPGGRIPKDRSWKTAKVIMSKVDDFLQALVNFDKEHIPDATVRVLREEYLSDPDFNPEFVRLKSSAAAGLCAWVINIIHFHEVTCEVEMKRMCLSQANADLIEAAEKLEVIRKKLSELDNSLDTLTAAFEKATSEKLRCQDEVNRTNKTIQLANRLVKGL-------EVRLSQYREQEATLCGDVLLTAAFISYAGSFSKRYRLELLHKLWMPYLRTQKV-CLCGLDPISMLTDDATVAKWNNEGLPGDKMSTQNATILLNCERWPLLIDPQLQGIKWLKSRYGSSLRVINLGQKGYVDVIEQAVVTGEPVLIENLEETIDPVIDPLLGRHTIKKG--RFIKVGDKECTYNPNFRLILHTKLANPHYKPEIQAQTTLINFTVTRDGLEDQLLA----------EHLKVCLTKQQNTFKIELKQLEDELLTRLSAAESNFLGDNMLVEKLETTKHTAAEIEMKVLEAKVNEVKINEAREHYRPVAVRASLLYFIINDLNKINPMYQFSLKAFNVVFRKAVQNAELCVDVNTRVNTLIDCITFSTFNYINRGLFERDKLTFTSQLAFQVLLLMSKEINVRELDFLLRFSIDHSYISPVD-----FLSNSSWSAIKTMSFTDEFRGLDRDIEGSPKRWKKVVESECPEKEKLPQEWKSKSS-LQKLILMRALRPDRMTYAVRNFVEEKLGVQYTEGRKMEFARSFKESGPASPVFFILSPG 2364          
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 1040.8 bits (2690), Expect = 0.000e+0
Identity = 541/1264 (42.80%), Postives = 792/1264 (62.66%), Query Frame = 1
Query: 4483 FFLE*MTSIKLLMTTEIL--YQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEAS-------SMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAAS-KRDKWI-KEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEA---IRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQ----FEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSV---LVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCD-PSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM-----EGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDI-WTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKD-------MYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            F L     I++L+   I+    + +SR+V P +  VD+W+R L    +T+E  +T QR WLYLE+IF   DI++QLP E+  F +++K W+ IM ++ ++ NA     + GLL+TF   N  LE IQK L+ YLE+KR +FPRFYF+SND+LLEIL Q++NP  V PHL+KCFD I  L+     ++G +         +M S +GE+V   + L+  G VE WL  +E+ M  +LR L    ++A+ +  S  R +W+      Q+ +T +Q+ W  D+T+ L+      D   L+ +   +K   E+ +     +R NL KI R  I +L+ ++VH RDI+  + +      N FEW  QLR+YW+ E+D+CV +   + + YGYEYLG   RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK MGR FSGLAQ+GAW CFDEFNRI+IEVLSV+AQQ+++I +A A+   P+FMF+GR I L+ +   FITMNPGYAGRTELPDNLK++FRPIAM+ P+ A+IAE+ L++EGF   +VLA+K+  +Y L  +QLS+QDHYDFG+RA+ SVL  AG  KR NP + ++ +L+ ++ D NL K  + D  LF GI+SDLFPG++ P  DY +++ +IE      +LQ     + KV+QLYET   RH VM+VG T  GK+T +  L  AL  L +  ES+    ++K     LNPKS+S+GELYGE +  T EW DG+++  +R   AD   D KWI+ DGPVD LWIE++N+V+DDNK+L L N ERI +  Q+ ++FEV++L VASPATVSRCGMVY D  +L W PYV++W+   +D       + +  +F+ Y+E    F+   C + +     + V +L  L + L   + G D   +    + ++   F FC +W++  ++ E+   + D +++       +   P+   ++ Y++D  +K    W E++   ++YN  VPF++++VPT DT+R+ YL++ L+   H V+  G  G GK+ VA   L+++  +  +  L IN SAQTSS   Q+IIE+++EK+ K+     G KR++ F+DD NMP  D +GSQPP+EL+RQ+ D+G +YDR K   K I+D       M  F A  PPGGGR  ++ R    F+++ +  P+E +LK+IF +++   L DF   +K +   I +A +EMY  +  + LPTP K HY+FNLRD+SK
Sbjct: 1005 FILAGTDEIQILLDDSIINISTITSSRYVGPIKSRVDEWQRQLLLFNQTLEEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMQVDKSWKDIMRKIYRLPNALRAATQPGLLDTFKNNNALLEQIQKCLEAYLESKRVVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAIARLEFALAPAEGEQERTFTNDILAMVSPEGEKVSLGKGLKARGNVEDWLGKVEEAMFQSLRRL---TKMAIGEYQSMPRTEWVVSGLPSQVVLTVAQLMWCRDLTQCLEG----GDHDHLQSVANFEKENFERLNSLACLVRGNLPKIHRCIITALITVDVHARDIVTDMVQEKVETANNFEWQRQLRYYWDLELDNCVARMALSQYVYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKV-PRFMFEGREIKLIQTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSRVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPHLREDVVLIRALRDSNLPKFLADDAMLFSGILSDLFPGVEIPNHDYGSLQSSIENALKARKLQAVPSMVHKVIQLYETMLVRHGVMLVGPTGGGKTTVYTALSDALGSLHEAGESKHNPFYQKVHTTVLNPKSISMGELYGEVNNLTLEWRDGLMALSVRVAVADDSEDHKWIVCDGPVDALWIENLNTVLDDNKMLCLANSERIKLTPQIHMIFEVQDLKVASPATVSRCGMVYIDSEELKWMPYVQTWMNGIIDKFGEDTGQYIMALFENYVEDGLRFVNKKCTQAMPQVDISKVTTLSCLLESLLLGKGGPDLKMEHSRLTSIVCQTFVFCYLWAVGGNLVENCWDQFDTFVKHQFEENHDAKLPSSGDLWSYYMDYDSKRLDPW-ERIVPNFRYNKEVPFFEMLVPTTDTMRFGYLMEKLLAVKHSVLFTGTTGVGKSVVARGLLDKIQEEAQYVPLYINFSAQTSSTRTQEIIESKLEKKRKNIIGAPGKKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDAREDRGAMQPFCA--PPGGGRNPVTPRFIRHFSMLCLPSPSEHSLKQIFQAILTGFLVDFPVAVKQVATNIVEAAVEMYGRMSTELLPTPAKSHYIFNLRDLSK 2257          

HSP 2 Score: 989.564 bits (2557), Expect = 0.000e+0
Identity = 526/1250 (42.08%), Postives = 782/1250 (62.56%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMS-----STDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGI-EDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISEL-DKLANFHG----------LIT----SFEQYPRDWN------LWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +L+ +      +N I RL+ HE  RVF DR++ ++DK  F  +L+E     F          K   +FGD+M      +   YED+TD+EKLK  +++ LD+YN +    +M LV F+DAIEH+++I R+IRQ RGN LLVG+GG+G+QSLTRLA +MC Y  FQIE+S+ Y    F +DL++LY  AGV++K T+FLF DTQ+V E FLEDINNIL+SGE+PNL+++DE++ +      +AK  GI E     +  + I+RVR  +H+VLCMSPVG+ FR R RMFP+ VNC TIDWF +WP +ALL V++ +   + L      D +K +L+ +   +H SV+++++    E++R  Y TPT+YLEL++ Y  +L EKR QL++S +++KNGL K+ ET   V+ + +EL      L    ++ +  +  +   +  AD   + VM+ +   KV   +   M   A  DL +A+PAL+AA +AL+SL++ DI+E++ +  PP  V+ VMEA+ I+   +P WA AK+ LG+ +F+K+L ++DK+NIS+  ++K+  Y+   DF P+ V +VS A KS+CMWV AM++Y RV + V PKRQRL  A++ L    A L   Q +L  V +++  LQ +++  + +KE L K    T+  + RA KL S L  E+ RW+++VA  + +I  + G+  IASA ++Y G F S YR+ L+ +W    ++  IP N +FS I  L +P +IR WN  GLPRD  S ENG++VTRG RWPLM+DPQ QA +WI+  E K  LK+I L   +F+R LE AI+ G PVLL+ ++E LDP+L+PIL K     GG  +++LGD +++Y+ +FRFY+TTK+ NPHY PE+  K  I+NF V + GLE QLL  VVR E+PELEEQ++ L++ I A K +L  +ED IL+LL  ++G++LD+E+L+ TLQ SK+TS  +  +L+ AE TE  I+ AR+ Y   A R S+++FV+  L +IDPMYQ++L  +  LFNM+I  S K     ER+  L      A Y    RGLFE+HKL+FSF +C +IL+  G ++  E+N FL+G   +D+E     P  GWL++  W+   +L D L  F G          L+T         P  W       L +T +  E + + G W+   ++FQ++++V+S   ++V F  T F+I NLG  F+E P +D+  +  D SA T L+FVLS G
Sbjct: 2260 QGILQCDSGTVRDQNQIFRLFCHECQRVFHDRLINNEDKDYFNTMLAEMASKQFGVQVEAEYFVKHPILFGDFMKVGVQRADRVYEDLTDVEKLKGVLQDYLDDYNLS-SAKEMKLVFFQDAIEHVTRITRMIRQERGNALLVGVGGTGKQSLTRLACHMCGYRCFQIELSRGYSYDTFHEDLRKLYTIAGVEDKDTVFLFTDTQIVIEEFLEDINNILNSGEVPNLFEKDELEKVLAATRPKAKEAGIPEGNRDEVLQFFINRVRARLHIVLCMSPVGDAFRARCRMFPSIVNCCTIDWFVQWPREALLSVSKTFFTPVDL----GSDELKENLSEMCVEIHMSVTELAEHYYAELRRRYYTTPTSYLELINLYLSMLGEKRSQLTNSRDRIKNGLTKLLETNELVDKLQLELSALEPVLKQKSEDVEALMEKLATDQENADQVRRVVMEDEAVAKVKAEETQAMAADAQRDLDEALPALQAANRALDSLDRSDISEVRVFTNPPEGVRTVMEAICIVLSKKPDWASAKQLLGDSNFLKRLTDYDKENISEDVIQKLKVYINNKDFVPEKVERVSKACKSMCMWVRAMDLYSRVLKDVGPKRQRLATAQAELDATMAMLNDKQRRLKQVEDQIGALQDQFDMSVAEKESLAKNMALTQARMSRAGKLTSALGDEQIRWQESVAQFQVEINNVIGNVFIASACVAYYGAFTSHYRQMLIDRWISRCQELGIPINANFSLIGILGDPFEIRQWNTDGLPRDTVSTENGILVTRGRRWPLMIDPQDQANRWIRNKEMKNGLKIIKLTDGNFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRLLIRLGDSDVDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRNELIVRINADKNQLKVIEDRILKLLFTSEGNILDNEELIKTLQESKVTSGAIKTRLKEAEATEEMINTAREKYRPVAARGSVMYFVIASLSEIDPMYQYSLKYFKQLFNMTIETSEKRSDLAERLELLLKQTLLATYTNISRGLFEQHKLIFSFMLCIEILRQHGHVSDAEWNLFLRGAAGMDKERPT-KPEIGWLAESTWNLCCDLEDHLPCFKGLKREIVAIPILVTLGRLEIRLNPEAWEGCMKEPLHFTEEVSE-NEIQGHWNERLSKFQKLVLVKSFMEEKVVFAMTDFVIENLGKAFIENPPVDLATLYQDMSASTPLVFVLSTG 3502          

HSP 3 Score: 90.1225 bits (222), Expect = 1.359e-17
Identity = 116/568 (20.42%), Postives = 246/568 (43.31%), Query Frame = 3
Query: 2904 PLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRI----------GEVLQKVKLKKSIWEFISTDD--EITKIQTNIRHGMQDISSSIQEPLGYW----DQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQ-----TNGPFAASIPPQEALAKIANFKSSLESLKIQEQEI--RRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATK----FSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            PLF     L+   L+F P+  E  + ++ +  +F + V  +  +            ++ K   +KS  E  S +   +  K    I  G+Q++  +     G +    +QFR  ++ N+   +    +    V   +  +++Y E    A+  +    +  L +D + LK  +       Q  + +LL  ++ K    + +  ++   K+  +P    E   S+  LD++ +    ++E+   + + + ++++++V    +  +    LE       Q+++  +  I K+  +    L        K +  L M+ +        P    I   +   +    +  + + + Q+Q +  R     FK+E      +  +  +L   + +W    EWE    +W   +F   +T++ E L NS   K  K      + L   N  ++   + +V+  R  +P++  LRN +++ RHW  ++  I     ++ +  TL  +I+L    +AE I +VSG A+ E ++E+ LK +E  W++ E  ++PH+D  K+ F+L+G D++   LDD+
Sbjct:  467 PLFLTEFMLEPESLMFAPSQNEFQDGLSVVIDSFKDTVLSVDNLVTDIYFDAFTQPIINKKHEEKSCGEGPSLETIFQDDKHLHKIIGGVQEVIRTAFNAAGLYADTFEQFRLFYKENESLDLEALKNKEHDVAFFEESLAKYHEQHKDAVAIKERRDLGMLLVDATKLKKKLIPSPLRCQNAINDLLPVLSRKKTDAIISEARDGQFKLEIVPSTTFEFVNSLTFLDEIQDRIQVLEEEMQIVVQMYQLIEQFKVPTPPEDLVVYSTLE-------QSIISVQNTIDKAVGERDGNLEKFCQHLDKDILELNMEVKIVKQRAQDPMILDITSDKTKVREILKEQMIATDEFQQQALQYRAYQKNFKVEVTNFDALNEVCDELKRKQMMWDSLDEWEVFTKEWLECQF---ETLDPEQL-NSEVAKYAKIVNQLEKGLPPNN--VVPLLKKKVEFIREKLPVVAFLRNPSLKARHWEMLEEIIGAPLRDKETPLTLAGLIELEVFHYAEQIQDVSGQASGEASLESILKKVEDGWKTAEFVVLPHRDS-KDVFILAGTDEIQILLDDS 1020          
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003955.1 (pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003955.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 521/1240 (42.02%), Postives = 748/1240 (60.32%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKL---RLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEE----LSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELW--FQFCMIWSICCSVDEDGRKKIDNYIREM-----------------EGTFPNKDTIYEYFVDNKNKS-WGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTL-NQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQK-RIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQ--DFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            M+ S F+KPFE E+  WE  L  IQET++  L VQ QWLYLE IF  +DI +Q+P+E   F  +++ WR +M    +           GLLE     N  L+ I K L+ YLE KR  FPRF+F+SND++LEIL ++K+P +V PHLKKCF+ I  L     +  G    +MFSS+GE V   +++      G VE WL  +E  M  ++RD++   R A   A ++R  W++EW GQ+ I  SQ+ WT +V +A++   Q+     LR   ++ +  L+   E +R +L+K  R+ + +LV I+VH RD++  +   G S+   F+WL+QLR+YWE E     ++  N + +Y YEYLGNS RLVITPLTDRCY TL  A +L+ GG+P+GPAGTGKTET KDL K+L    +V NCS+GLDY +M + F GLA +GAW CFDEFNRI +EVLSVVAQQIL I  A+ +     F F+G  + L P+  + ITMNPGYAGR+ELPDNLK +FR +AM+ P+ A+IAEI+L++ GF   K L+ K+   Y L  +QLS Q HYD+G+RA+ +VL  AG  K   P   ++ +LL S+ D+N  K  S D+PLF GI SDLFPGI  P  DYT   EA  +CC    +QP    + K++Q YE    RH  M+VG+  +GK+   ++L   L  +S+  +   E+     +NPK++++G+L+G+FD  ++EWTDG++++  R+  +   PD KW++FDGP+DTLWIESMN+V+DD   L L++GE I M + +SL+FE  +LS ASPATVSRCGM+Y + + LGW+P V+SWL     ++  E+    L  +F   +      ++  C  L+     N+   LC          N  +     + + +  L   F F ++WS+  S D DGR K D+++RE+                 E     +  +Y+Y  + K +  W HW+E +K     +       IIVPT+DT RY YL+   + +  P++ VGP GTGK+    N L N L+ + +    +N SAQTS+N  Q+II ++++KR K  F P  GKR + F+DD NMPA + FG+QPP+EL+RQ+ D+G WYD LK T K R++D+ L  AMGPPGGGR  ++ R    FN+  +   ++  +  IF S++   L+  DF  E   +G+ I  AT+E+Y   +   LPTPTK HY FNLRD S+
Sbjct:  877 MRGSAFIKPFETEIKVWEERLVRIQETLDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGRLFQTVDRNWREVMKFCTRDPKVLVATSMTGLLEKLQNCNGLLDKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIARLGFLPNLDIG----AMFSSEGERVELVERVSTSEARGAVEKWLLQVEDVMLRSVRDVIVRARTAY--ANTQRKDWVREWPGQVVICVSQMFWTTEVHEAIKGGPQQG----LREYSERLQDQLKDIVELVRGDLSKQTRVTLGALVTIDVHARDVVFDMIDKGVSNETDFQWLAQLRYYWESE--QVRVRIVNCNVKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMV-TFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLFLEAARECCSRHNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLMSERGQGGEERVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCKMLMLKLWLNTRTQLCPSDITKERYSNAPESCIFMHANSIYSLQASFAFSLVWSVGASCDSDGRVKFDSFLRELLTGKSKDHPLPPTVGKWECPLEERGLVYDYMYELKGRGHWVHWNELIKNPHLGDKGTKVQDIIVPTIDTARYTYLMDLCIQHSRPLLFVGPTGTGKSVYIKNKLMNNLDKERYLPFFVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYD-LKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSR 2102          

HSP 2 Score: 126.716 bits (317), Expect = 0.000e+0
Identity = 75/201 (37.31%), Postives = 117/201 (58.21%), Query Frame = 3
Query: 8151 FERYKQRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFV----ELLSEKLGSLFDQTFHNI-------C-PNKQSPIFGDYMSS-----TDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLK 8702
            F R  Q +L   ++  D + S+ RL++HE +RVF DR+V D+D+        +LL +     FD  F ++       C  + +  +FGDYM+         Y ++  +++    +++ L+EYN T    +M+LV+F   +EH+S+I RV++QP G+ LLVG+GGSGRQSLTRLA  M     FQ E+SK Y   E+R+D+K
Sbjct: 2100 FSRVIQGVLLLRREAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFEDLKEEGRPLCQEDMRKLMFGDYMNPDLMDEERLYAEVPSVQQFSSVVEQCLEEYNQTHKN-RMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVK 2299          

HSP 3 Score: 70.8626 bits (172), Expect = 7.627e-12
Identity = 119/573 (20.77%), Postives = 234/573 (40.84%), Query Frame = 3
Query: 2880 GDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPL-GYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLD-----KLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEW-QEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQE-------IRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRR-----------TMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDD 4523
             DGR  P   F+V L      +   P+  +L   V ++       ++ +P +   L      ++I +  + +D +T+    + H +Q      QE L  Y D++  +      E +  +   +         +  +  +  +     +++    ++L  S LK  +    R +   L + LL         +    + M ++  K+P+N EE+ E    +D      + +  + IQE +  +     +LD + +   +DI    Q L   W +E   A    E++++ ++ K ++ LL + +    ++  L    + +G FA        L  IA + S +  +  + Q+       I +   L+K E     E+ A+   LD  + ++ L L W+    +W  G F+EL    M       FR+  K  +  + +  +  E  R R D  R+                +D   +  RDRHW Q+   +      +S   TL K++  N   + +   ++S AA+KE ++E AL  M + W+++    + +  +E    +LS +D++  TLDD
Sbjct:  318 ADGRALPH--FRVQLTFDDESMESYPSSEDLRGAVLAVAAQIGRSLQAVPMVHAWLAGSSSPETI-KVQTPEDVLTRASAALLHAVQANMQGPQEHLQSYIDRYGWLVNGTAMERVHTFISEDRSFDECATLVEEFRALVRELQGLPSVLHFPMVRLVCSELKQGLMDKARGFINLLLDKLLNQHRAHNAMICQAFEVMRQRCLKVPENSEEMIELGSYVDNARSKGIADLNDKIQECYRRMS---FLLDVH-ILSPEDIAFNSQVLC--WPREIAPAFDRNEELMEVAQRKGESELLARRERLLLELDKL--SRRVDG-FAEC----SELDMIAQYVSDMRMIGKRLQDADDTITFINKEEVLYKWELTSYPEVDAIRTKLDPFQKLFTLILRWQRAEKKWMDGSFLELNGETMATELEEFFREMYKHLKFFQQRQ-KKAEQERQR-DAPRKKRGDSAEAEMEEAQEQSDPSVQMCRDRHWVQMSEVVENDITPDSGT-TLRKVLKQNLIPYLDKFEQISAAASKEYSLEKALHTMVETWDTIAFTTLQY--RETGVSILSSVDEIQSTLDD 869          
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003959.1 (pep scaffold:Pmarinus_7.0:GL495754:4357:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003959.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 964.526 bits (2492), Expect = 0.000e+0
Identity = 524/1251 (41.89%), Postives = 756/1251 (60.43%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKL---RLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEE----LSRMFDKYIEKIQNFIKMNCIEL----IRTSPTNS---VISL-CKLFD-CL----ATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM-----------------EGTFPNKDTIYEYFVDNKNKS-WGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTL-NQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQK-RIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQ--DFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            M+ S F+KPFE E+  WE  L  IQET++  L VQ QWLYLE IF  +DI +Q+P+E   F  +++ WR +M    +           GLLE     N  L+ I K L+ YLE KR  FPRF+F+SND++LEIL ++K+P +V PHLKKCF+ I  L     +  G    +MFSS+GE V   +++      G VE WL  +E  M  ++RD++   R A   A ++R  W++EW GQ+ I  SQ+ WT +V +A++   Q+     LR   ++ +  L+   E +R +L+K  R+ + +LV I+VH RD++  +   G S+   F+WL+QLR+YWE E     ++  N + +Y YEYLGNS RLVITPLTDRCY TL  A +L+ GG+P+GPAGTGKTET KDL K+L    +V NCS+GLDY +M + F GLA +GAW CFDEFNRI +EVLSVVAQQIL I  A+ +     F F+G  + L P+  + ITMNPGYAGR+ELPDNLK +FR +AM+ P+ A+IAEI+L++ GF   K L+ K+   Y L  +QLS Q HYD+G+RA+ +VL  AG  K   P   ++ +LL S+ D+N  K  S D+PLF GI SDLFPGI  P  DYT   EA  +CC    +QP    + K++Q YE    RH  M+VG+  +GK+   ++L   L  +S+  +   E+     +NPK++++G+L+G+FD  ++EWTDG++++  R+  +   PD KW++FDGP+DTLWIESMN+V+DD   L L++GE I M + +SL+FE  +LS ASPATVSRCGM+Y + + LGW+P V+SWL     ++  E+    L  +F   +      ++  C ++    +R S   +   ++S+ C+L   CL     +VE          ++      F F ++WS+  S D DGR K D+++RE+                 E     +  +Y+Y  + K +  W HW+E +K     +       IIVPT+DT RY YL+   + +  P++ VGP GTGK+    N L N L+ + +    +N SAQTS+N  Q+II ++++KR K  F P  GKR + F+DD NMPA + FG+QPP+EL+RQ+ D+G WYD LK T K R++D+ L  AMGPPGGGR  ++ R    FN+  +   ++  +  IF S++   L+  DF  E   +G+ I  AT+E+Y   +   LPTPTK HY FNLRD S+
Sbjct:  877 MRGSAFIKPFETEIKVWEERLVRIQETLDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGRLFQTVDRNWREVMKFCTRDPKVLVATSMTGLLEKLQNCNGLLDKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIARLGFLPNLDIG----AMFSSEGERVELVERVSTSEARGAVEKWLLQVEDVMLRSVRDVIVRARTAY--ANTQRKDWVREWPGQVVICVSQMFWTTEVHEAIKGGPQQG----LREYSERLQDQLKDIVELVRGDLSKQTRVTLGALVTIDVHARDVVFDMIDKGVSNETDFQWLAQLRYYWESE--QVRVRIVNCNVKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMV-TFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLFLEAARECCSRHNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLMSERGQGGEERVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCKDIHEKELRLSEAFTKALIVSVDCRLSGLCLKGLWVSVEALLVLLMLKLWAS-----FAFSLVWSVGASCDSDGRVKFDSFLRELLTGKSKDHPLPPTVGKWECPLEERGLVYDYMYELKGRGHWVHWNELIKNPHLGDKGTKVQDIIVPTIDTARYTYLMDLCIQHSRPLLFVGPTGTGKSVYIKNKLMNNLDKERYLPFFVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYD-LKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSR 2108          

HSP 2 Score: 127.102 bits (318), Expect = 0.000e+0
Identity = 75/201 (37.31%), Postives = 117/201 (58.21%), Query Frame = 3
Query: 8151 FERYKQRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFV----ELLSEKLGSLFDQTFHNI-------C-PNKQSPIFGDYMSS-----TDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLK 8702
            F R  Q +L   ++  D + S+ RL++HE +RVF DR+V D+D+        +LL +     FD  F ++       C  + +  +FGDYM+         Y ++  +++    +++ L+EYN T    +M+LV+F   +EH+S+I RV++QP G+ LLVG+GGSGRQSLTRLA  M     FQ E+SK Y   E+R+D+K
Sbjct: 2106 FSRVIQGVLLLRREAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFEDLKEEGRPLCQEDMRKLMFGDYMNPDLMDEERLYAEVPSVQQFSSVVEQCLEEYNQTHKN-RMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVK 2305          

HSP 3 Score: 67.3958 bits (163), Expect = 8.402e-11
Identity = 119/575 (20.70%), Postives = 237/575 (41.22%), Query Frame = 3
Query: 2880 GDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPL-GYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLD-----KLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEW-QEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQE-------IRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRR-----------TMPLITD--LRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDD 4523
             DGR  P   F+V L      +   P+  +L   V ++       ++ +P +   L      ++I +  + +D +T+    + H +Q      QE L  Y D++  +      E +  +   +         +  +  +  +     +++    ++L  S LK  +    R +   L + LL         +    + M ++  K+P+N EE+ E    +D      + +  + IQE +  +     +LD + +   +DI    Q L   W +E   A    E++++ ++ K ++ LL + +    ++  L    + +G FA        L  IA + S +  +  + Q+       I +   L+K E     E+ A+   LD  + ++ L L W+    +W  G F+EL    M       FR+  K  +  + +  +  E  R R D  R+                +D  ++  ++RDRHW Q+   +      +S   TL K++  N   + +   ++S AA+KE ++E AL  M + W+++    + +  +E    +LS +D++  TLDD
Sbjct:  316 ADGRALPH--FRVQLTFDDESMESYPSSEDLRGAVLAVAAQIGRSLQAVPMVHAWLAGSSSPETI-KVQTPEDVLTRASAALLHAVQANMQGPQEHLQSYIDRYGWLVNGTAMERVHTFISEDRSFDECATLVEEFRALVRELQGLPSVLHFPMVRLVCSELKQGLMDKARGFINLLLDKLLNQHRAHNAMICQAFEVMRQRCLKVPENSEEMIELGSYVDNARSKGIADLNDKIQECYRRMS---FLLDVH-ILSPEDIAFNSQVLC--WPREIAPAFDRNEELMEVAQRKGESELLARRERLLLELDKL--SRRVDG-FAEC----SELDMIAQYVSDMRMIGKRLQDADDTITFINKEEVLYKWELTSYPEVDAIRTKLDPFQKLFTLILRWQRAEKKWMDGSFLELNGETMATELEEFFREMYKHLKFFQQRQ-KKAEQERQR-DAPRKKRGDSAEAEMEEAQEQSDPSVQMCSIRDRHWVQMSEVVENDITPDSGT-TLRKVLKQNLIPYLDKFEQISAAASKEYSLEKALHTMVETWDTIAFTTLQY--RETGVSILSSVDEIQSTLDD 869          
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001140.1 (pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 gene:ENSPMAG00000001005.1 transcript:ENSPMAT00000001140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 951.814 bits (2459), Expect = 0.000e+0
Identity = 512/1263 (40.54%), Postives = 752/1263 (59.54%), Query Frame = 1
Query: 4507 IKLLMTTEIL--YQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKL---RLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEE---LSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLA---TVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIRE-MEG-------------------------TFPNKDTIYEY-FVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVN-TLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQ---DFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            I++L+   I+    M+ S F+KPFE ++ +WER L  +QE ++  L VQ  WLYLE IF   DI  Q+P+E   F  ++K WR ++ +     +  A    + +LE        LE I K L+ YLE KR  FPRF+F+SND+LLEIL ++K+P +V PHLKKCF+ I+ ++     ++  + + M SS+GE V   + +   +  G VE WL +LE  M  ++ +++ +   A    ++ R +W++ W GQ  +  SQ  WT++V +A+     R  ++ L     +    +++    +R  L++  R+ + +LVV++VH RD++  L K G +  + F+WLSQLR+YWE        +  N    YGYEYLGN+ RLVITPLTDRCY TL  AL+LH GG+P+GPAGTGKTET KDL K++    +V NCS+GLDY ++G+ F GL   GAW CFDEFNRI++EVLSVVAQQIL+I   + + +    MF+G  + L P+  +FITMNPGYAGR+ELPDNLK++FR +AM+ PD AMIAEI L++ GF   + L+ K+   Y L  +QLS Q HYD+G+RA+ SVL  AG  K   P   ++ ++L S+ D+NL K  + DLPLF+GI SDLFPG+  P  DY  + EAI++ C+   LQ T+F   K++Q+YE    RH  MIVG+   GK+  +R+L +AL ++ ++      K     LNPK++++G+LYG+FD  ++EW+DGVL+   R     T PD KW++FDGPVD +WIE+MN+V+DDNK L L++GE I +    +L+FE  +L VASPATVSRCGM+Y + + LGWRP + SWL  +   +       +  +F++ +     F++ +  EL  TS TN V SL  L DC       E      D  + S  IE  F F ++WS+  S    G+   D  +RE M G                          FP   ++YEY F+      W  W E L         + F  IIVPT+DT+R+  L++ LV +  PV+ VGP GTGK+    N  L  L+ + +  LTIN SAQT++   Q+II  ++++R K  + P  GKRM+ F+DD NMPA++ +G+QPP+EL+RQW+D+  WYD    +  +++++ +  AMGPPGGGR  ++ R    FN + +    + ++  IF  ++         F  +   + + + Q+T+E+Y       LPTPTK HYLFNLRD S+
Sbjct:  815 IQMLLDDHIVKTQTMRGSPFIKPFESDMKEWERKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFTTVDKTWRDLIKQTLTDTHVLAVVSIDKMLERLQKSTELLELILKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGISRVEF----TEALDITHMKSSEGEVVQLIETISTSKARGQVEKWLLELEAVMIRSVHNVIGEAMEAY--PSTPRAEWVRAWPGQTVLCVSQAFWTSEVHEAI-----RGGQQVLERYLAQCNGQIDEVVGLVRGQLSQQSRVTLGALVVLDVHARDVLVALLKGGIAHDSDFQWLSQLRYYWED--GHLQTRMINAGLPYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSD-TLMFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIMLYSFGFVSARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPSENEDILMLRSIVDVNLPKFLAHDLPLFEGITSDLFPGVKLPKPDYVVLLEAIKENCEKMNLQMTDFFAEKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAAALGDICEKALMAENKVQITVLNPKAITMGQLYGQFDAISHEWSDGVLAVSYRAFATSTSPDRKWLVFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHILGWRPLLTSWLNARPPPLSAPHKALICALFERLVPCCLQFVRKSTKELSPTSDTNLVCSLMNLMDCQMDDFHDETKIKAMDDRDVSAWIEGIFLFSLVWSVGASCSTHGQVLFDQLLRELMSGPLSADTSKRFHLSENVEPPAEPFSVPFPAAGSVYEYRFIQEGKGRWELWTEALSLAPPIPRDMNFNDIIVPTLDTIRFTALMEMLVTHQKPVLFVGPTGTGKSVYITNFLLKHLDKNTYKPLTINFSAQTTAAQTQNIIMGKLDRRRKGVYGPAQGKRMVLFVDDVNMPAREEYGAQPPVELLRQWLDHSNWYDLKDCSMIKLENVQILGAMGPPGGGRNAVTARFLRHFNTVTINEFDDKSMFTIFSRIMGWHFTARFAFPTDFSVLTEQLVQSTMEVYKAATQNLLPTPTKSHYLFNLRDFSR 2063          

HSP 2 Score: 479.559 bits (1233), Expect = 0.000e+0
Identity = 284/751 (37.82%), Postives = 434/751 (57.79%), Query Frame = 3
Query: 8151 FERYKQRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSL----FDQTF-HNICPNKQ-------SPIFGDYMSSTD---TYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSD-EAKRDGIEDTTQS---IFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLK-MQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEP---------------TWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKI-GTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYRE 10295
            F R  Q +  +  +      SI RLW+HE  RVF DR+V D D+   V  + + + +     F Q F H+   + Q       S +F D+  S D    Y +++D+E+L+  ++  L+E+NN      M+LVLFR AIEH+ +I R+++QPR + LLVG+GGSGRQSLTRLAA+M +   FQ+E+SK Y   E+R+DLKR+  ++    +  +FLF DTQ+  ESFLEDINN+L+SGEIPNL+  DE  ++  ++   + +RD  + T  S   +    +DR R  +HVVL MSP+G+ FRNR+R FP+ VNC TIDWF  WP DAL  VA RYL+D+++      +        +  L H S   +SQ+   E +R+NYVTPT+YLEL+S +K LL +KR ++     + + GL K++   ++V  M  EL   + +L     +  + + VI ++  E   + + V++  E +  ++A   K +++   ADLA+A+P L +A+ AL++L ++DIT +K+   PPA V+ VMEA+ IL+G +P                W  AK+ LG+  F++ L +FDKDNI    +K I   Y+   +F PD +   S AA+ LC WV AME Y +V +VV PK+ +L  AE+ L      L   Q  L  V +++  LQQ      ++K +L  + +   K LDRA +L+ GL GE+ RW +    L  +   L GD L++S  ++Y+G F+S +R+
Sbjct: 2061 FSRVIQGVCLSLPETCPVAASIQRLWVHEVLRVFYDRLVDDADRTWLVAFIRKTIHTYMKEDFTQLFQHDSNGDGQVEDDDLRSLMFCDFSDSKDDAKRYVEVSDVERLRLVVEGHLEEFNNLSKK-PMNLVLFRFAIEHVCRISRILKQPRSHALLVGVGGSGRQSLTRLAAHMADCELFQVEISKGYATNEWREDLKRILRRSTDGEQNGVFLFTDTQIKQESFLEDINNLLNSGEIPNLFAPDEKQEICEKMRQIDRQRDKDKQTDGSPLALLNMFVDRCRDQLHVVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPGDALQAVATRYLEDVEV-----SEETLASCIDMCKLFHTSTIALSQKFQAEQQRYNYVTPTSYLELISTFKDLLEKKRLEVMRMKRRYEVGLEKLESATSQVAGMQAELAALQPQLLEAGIQVVNTMAVIERESEEV-SRTERVVKADEAVANEQAMAAKVIKDECDADLAEALPILRSALAALDTLTQQDITVVKTMKSPPAGVKLVMEAISILKGVKPDRVPDPSGSGRMVEDLWGPAKRLLGDMKFLQSLHDFDKDNIPVAIMKTIRAKYITNLEFDPDKIRNASTAAEGLCKWVIAMESYDKVAKVVAPKKVKLNQAEAELAVAMGSLRRKQEALREVQDKLAGLQQTLEANKQKKADLENQVDMCTKKLDRAEQLIGGLGGERSRWMEAARLLGIRYNDLTGDTLVSSGIVAYLGAFISSFRQ 2804          

HSP 3 Score: 74.3294 bits (181), Expect = 7.741e-13
Identity = 97/490 (19.80%), Postives = 219/490 (44.69%), Query Frame = 3
Query: 3108 KIQTNIRHGMQDISSSIQEPLGYWDQFREI----WELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKAL-DAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLN-EERNHIQEKFHPLDEHFI-ILDKYEVQYSDDIRLKKQNLEKEWQEFLQAL-VEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIM---DFQTNGPFA---ASIPPQEAL-AKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEII--EYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            ++Q+++R  +   S   +E L +++ F  +     E + E F+S+    + H    +  +S Y E+++  L  ++ +V +   +L    L  ++A    +   +L   +     K +  L    ++++EK    P N + L E    + K+  +E + +Q K +   +H + +LD   +  S+   ++  N   +W   +  +  E  +++ +  ++++  L  +   F++ + A      +F T G  A     +   + L  K+      +ES   +E+        +   Q P K+   ++  L     ++++A+E+ +    W  G   ++    +E    + +R   K  R L+     ++  +  ++ V+ FR  +P+   L N  +R RHW  +   +      +     LEK +++N +      N++S  A+KE ++E AL+ M + W+ ++  +I ++D   +  +LS +DD+   LDD+
Sbjct:  350 ELQSHVRAEIIQQSLLPREHLRHYEPFEGLVGGQAERDVERFLSEEHTFSEH----EQLVSHYRELSHSILYSSQLVVRLGMFELHCDELVAALAKRAENLGSRLLGRMSQEHQKFIQRLCEEFESIAEKALSTPINTKALMELKEYIQKVEVQEMSQLQVKLNEAKDHLLFLLDHASLSPSE---MRHNNTAFQWCGRMPGIFTEHRRILTEKTEQYQESLKFRRRRFEEDLEAYAKQAEEFSTLGDLADVNKYLKKAQVLHTKLEAATEMIESFNAEEEAFA-----WPTSQYPQKK--KIQDVLMPYLRLYEMAVEFTSKHKAWMEGPLADVNPDVVEQDVGNYWRGLYKLERSLQASPQALLIQQQLKSNVEAFRTHLPMAQVLCNPGLRGRHWDALSEVVGFPLLTQEQ-VCLEKFLEMNLESFLSKFNDISDTASKEYSLEKALEKMVREWDEMQFTLIVYRDSGTS--ILSAVDDIQMLLDDH 822          
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006497.1 (pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 gene:ENSPMAG00000005847.1 transcript:ENSPMAT00000006497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 840.491 bits (2170), Expect = 0.000e+0
Identity = 462/1232 (37.50%), Postives = 711/1232 (57.71%), Query Frame = 1
Query: 4531 ILYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRN-ARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKI-EKLMSQGFEASSMFSSDGEEVLFKQKLRLE----GPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMF-QGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRV-IELWFQFCMIWSICCSVDEDGRKKIDNYIR------EMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYK-IIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQ-KRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKL---QDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            +L  + ++R+  PF+  + +W + LS+  E +E  + VQ  W+YLE +F+G DI KQLP+E+  F  I+K W+ IM   ++I      C   E L +    +   LE  QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +  HL   FDN+N +   EK   Q     S+ S +GE V   + +  +    G VE WL  L   +R T+  ++R     ++  A K  ++   +  Q+ + +  I WT D   AL N   +ND+K +    +K   +L +  +    +LTK +R+K  +L+ I VHQ+DI + L +        FEWL Q RFY+ +E D C+I+ T+  F Y  EYLG + RLVITPLTDRCYITL+ AL +  GG+P GPAGTGKTET KD+GK LG YV+V NCS+ +DY+ +GR++ GLAQ+GAWGCFDEFNRI + VLSV AQQI  +L     N   +F+F  G ++++    GIF+TMNPGYAGR ELP+NLK  FR +AM+ PD A+I  + L + GF   ++L++K +TLY L  +QLSKQ HYDFGLR ++SVLR  G  KR+NP  P++ +++  + DMNL+KL   D PLF  +++DLFPGI      Y  ++EAI        L      + K++QLYET+  RH +M +G + +GK+    +L  A+ +         E   E  +NPK+++  +++G  D+ TN+WTDG+ S++ RKT    + +  WI+ DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FE  N+  ASPATVSR GMV+   + L WRP V++WL+  + +   + L    D   + + NF+          +P   ++    +   +  ++     +D        ++    F ++WS+   ++ + R +++ ++R      ++ G+  N D+I+EY V +    W HW+ ++        +VP Y  I+VP VD VR ++L+Q ++     V+L+G  GT KT +    +N+ + ++    ++N S+ T+ N  Q  +E+ V+KR   T+ P  G++M  F+DD NMP  + +G Q   E++RQ ++   +Y+  K  +   I D+    AM  PGGGR  I  RL+ +F + N T P+ +++ +IF +         + F EE+  +   +   T  ++    +K LPTP K HY+FNLRD+S+
Sbjct: 1561 VLASLMSNRYNVPFKPTIQQWVQKLSNTTEIIENWMMVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHEIPGIVVCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDPHTIQAHLLGLFDNVNQVGFHEKNYEQIL---SIESQEGESVTLVEPVMAQRGWQGNVETWLGSLLTGVRSTVHAVIRQAAAIIEDGAFKLHEFQTSFPAQVGLLAQMI-WTRDSEVALNNA--KNDRKIMPATNQKFLDLLNELIDMTTRDLTKRERVKYETLITIHVHQKDIFDDLVRMNIKSTADFEWLKQSRFYFVEETDKCLIQITDVDFHYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQC-KKNKRTQFVFTDGDIVEMDREFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPEEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPELEEAILAQTKAAGLVHHPPWVLKIIQLYETQRVRHGMMALGPSGAGKTCCIHMLMKAMTDCG-------EPHREMRMNPKAITAPQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWILLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPIVQAWLQ-GLPTEQAQVLWSTMDSVFQDLINFV------FTAVNPKMDILECMYIKQAIELLKGLLPEADERRLEHSHLQRLLVFSLMWSVGALLELEDRARMEAFLRAHPSHLDLPGS-ANDDSIFEYVVGDSG-GWEHWNTRVPEFAYPRDTVPEYSAILVPNVDNVRTDFLMQCIMKQEKAVLLIGEQGTAKTVMIKGYMNKYDAELHLTKSLNFSSATTPNMFQRTVESYVDKRMGTTYGPPAGRKMTIFIDDINMPIINEWGDQITNEIVRQLMENNGFYNLEKPGEFTTIVDVQFVAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNASIDKIFRTFAEGHFCPERGFPEEVNQLAVALVPTTRRLWQATKVKMLPTPAKFHYIFNLRDLSR 2769          

HSP 2 Score: 374.4 bits (960), Expect = 0.000e+0
Identity = 233/709 (32.86%), Postives = 366/709 (51.62%), Query Frame = 3
Query: 8151 FERYKQRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYM----------------SSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIE--DTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIK--VDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMIL--------------RGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEK 10175
              R  Q ML  N +   + + +  L+ HE  RV ADR    +DK  F   +S+ +  L D         +    F D+M                 +   YE I    +L + ++  L +YN +     MDLV F DA+ H+ KI R+IR PRGN LLVG+GGSG+QSLTRLA+++  Y+SFQI +S+ Y      +DLK+LY + G   K   F+F D ++ DE+FLE +NN+L+SGE+ NL+ +DEID++  +L    K++      T ++++ Y + RVR N+HVVLC SPVGE FR R   FPA ++  T+DWF  WP DAL  VA  +L + ++    E  R       +F  M   V++      +  +R  YVTP +YL  + GYK +  EK   ++  + +++ GL K+ E    V  +S ELE   K+LA+  +  D+ L  +  + + A+   + V + +++ +  VDE    K   +A   L  A PALE A  AL+++   DI  ++   KPP L+ ++M+ V++L                  P+W+EA+K +    F+  L+ F KD I++  +  +  Y+  +D+  +    V      LC W  AM  +  + + V P +  L   ES L   Q +L  AQA+LD    E+  +Q  Y+  + +K+ L   AE   + ++ A+ L+ GL GEK
Sbjct: 2767 LSRIWQGMLIMNSEVCRSSDMLLALFGHECVRVIADRFTAQQDKDWFNGTMSKIM--LDDHGTAAAASMEAEVYFVDFMRDAPEPTGEEPDDADLEAPKVYEPIPSFPQLAERLQAFLVQYNESVRGANMDLVFFADAMVHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYSSFQITLSRTYNMSNLMEDLKQLYRKTGQQGKGVTFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEITQELIPVLKKEHPRRPPTNENLYDYFLSRVRANLHVVLCFSPVGEKFRARALKFPALISGCTMDWFQSWPRDALTAVAGHFLAEYRVECTPEVKRGVVDAMAVFQDM---VAERCVEYFERFRRQTYVTPKSYLSFIGGYKSIYSEKLSNVALLSERMRTGLSKLQEAEKSVSQLSRELEVKEKELAVASRRADEVLCEVTSKAQAAESVKQQVQKVKDKAQAIVDEIAADK--AVAEKKLEAAKPALEEAEAALQTIKPADIGTVRKLSKPPHLIMRIMDCVLLLFRRRVDTVVPEPERPCMRPSWSEAQKLMNFAGFLNSLLTFSKDTINEEMVDLLMPYMEMEDYNLETARNVCGNVAGLCSWTKAMVTFFGINKEVLPLKANLIIQESRLAVAQGELDRAQAQLDEKQRELDAVQAMYDTAVREKQILVDDAEACRRKMNNATALIDGLGGEK 3468          

HSP 3 Score: 136.732 bits (343), Expect = 9.561e-32
Identity = 145/681 (21.29%), Postives = 308/681 (45.23%), Query Frame = 3
Query:  567 RGIDSLLRIMMGIYAPSYFSNTMWP--DSIKNDFSLQL-----QRFMSALTDARWKLEGK---------TVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVL-SAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRC--CLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKI-CYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLD--RDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKK 2543
            +G++S L  +M    P+  S   W    S +ND ++++       FM +L+  R  ++ K         T+ Y+     +          + + R+E  +  W +QI++VL  ++   ++ ++ GP  E+ YWK R    + + ++L    V+ +T +L+ A+S  +  + +L S I     +A+ N+K+L +L+     L+   P  I S +  L++ IRM+   S +YNS + MT +F K++N++I  C   L     +I+D    + ++++  CI   E+Y+  + +   ++ ++ + + +   +  IF + D+F  R + L ++ +     A             Q  R   ++ I L+ + +  N     + +   +LD + + +  DY  F S  + L    Q  + + F      ++ +E+L  F  +      R    +  Q++ ++  ++ ++V++             +IP  +G  +WAR L ++I+  M  L+    +  +S      + Y +++  L E     H  +   +D  R+ L S   +LL R    +    +NF  A+ +L  E  +  +L F VP    ++  +  +++     +L  +++Y + + ++    + L    +  ++  I PGL  I W+S   I+ ++ +  I AA +Q K
Sbjct:  150 QGVESFLSSLM---IPALKSQETWGVIKSGENDPAVEVFLDSVNYFMQSLSGVRQNIQQKVQLMEADLGTITYL---CCIPHCPVTVGNTEMVERLEAALRVWMKQIEQVLVESEQIRKEADNVGPSAELVYWKKRTSRFNSLLEELKSERVQKVTGLLQAARSRSLKHWKELDSRITEEASEAKDNVKYLYSLEKFFGPLAKYSPVSIKSGIEGLMSNIRMVHTISRYYNSSEHMTSLFVKVTNQMIATCKAYLHQGGGKIWDHDWDNLLQRMSECIRLNEEYQHCFHETKQHLRQSNNPRQFEFSENYIFGKFDSFCMRLRKLSDMLQTMQSLAG-----------LQHVRIEGIDKIFLRYQALATNT----KAKTYDVLDHRKSEFDIDYKEFCSQTEGLYQSLQTFVDSWFGDALKTEKMLELLGKFERIAGG---RLQLMEKYQLVLHRYARDMDMVRRTYQKQKQNPPIPRNIPPVSGKIMWARQLFRKIDIPMKFLNNKRDVLQTSEGKITVRNYNKMAAVLLEFELLYHRAWSRAVDLVRNSLLS---SLLVRYPKKKEFF-VNFDLAIFELLMEAKHLHKLGFQVPEAVINLCQKEQQIKHHHTRLLEALQEYTQAVSSIPPILQPLMTPCVALVEDAILPGLTIISWTSLN-IDTYIEE--IQAAVVQLK 799          

HSP 4 Score: 124.79 bits (312), Expect = 4.246e-28
Identity = 110/480 (22.92%), Postives = 208/480 (43.33%), Query Frame = 3
Query: 3084 ISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKL---ALE-----WETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGID 4499
            I+   ++ K+  ++   +  +     E L  +  F  +W    EE + ++   +P +   +A +  Y ++  +  D  A   V  +      LK ++   CR W++     L   A+ S   +  + + M++ +++   +LE++  +M  L +L      ++    P++E F +L KY++ + D    +   L   W+  +   V+ +  +   +   K  LL    +F K +S+  +D+ T GP  A I PQEA  ++   +   + L  +      G  LF +      E+  + ++L  ++ ++ L    +E     +E  W+       IE    E+ +  N    K  K  + LK+  W+  E  + ++D F  T PL+  + N+AM  RHW +I N     FD ES  F L+ I++       + I ++  +ATKE  I+  LK +   W S      P K   +   LL G D
Sbjct: 1080 ITEHKDVGKVMFHLSSVLSFLRVESTEVLKNFSCFSSLWSQEPEEMVKEFMTTDPTMSEFNAQMVYYAQLEQQVQDLPAHFAVGPVLAMTEPLKLALVQECRTWKRAFGAALNRKASASTDEVLAFSEAMAKHLARPICDLEDVRAAMAALAELRAAEIQMESAIGPVEEAFAMLAKYDLTFRDSSADRVDGLAYCWKNLMTQSVQVQNTLVILQPTMKADLLTGVAEFHKDLSSFQLDYDTQGPGEAGIAPQEASDRLQMCQMQFDDLWRKFTTYSGGEELFGLPVTDYPELQRIRRELALLQKLYGLYNTVIESVDGYYEILWSDLD----IEKINNELLDFQN----KCRKLPKALKE--WQAFEDLKKKIDNFNETCPLLEMMANKAMMSRHWERITNVTGHTFDIESDHFALKNIMEAPLLTFKDDIEDICISATKERDIDAKLKAVVSEWSSQCFTFAPFKS--RGELLLKGSD 1547          
BLAST of Dynein heavy chain axonemal vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 484.182 bits (1245), Expect = 0.000e+0
Identity = 376/1266 (29.70%), Postives = 632/1266 (49.92%), Query Frame = 1
Query: 4528 EILYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGE--DIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEA--WLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKE-IDD---CVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPD----EEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTIT-----KVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEK----WIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMF--DKYIEKIQNFIKMNCIELIRTSPTNSVISL-CKLFDCLATV---------------ENGCDPSDTDNYSRVIELWFQFCMIWSICC-SVDEDGR---KKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKD---TFVPVGG-KRMLTFMDDFNMPAKDTFGSQPPLELIRQWID-YGFWYDRLKQTQKR---IKDMYLFVAMGPPGG-GRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            E L  MK S + K FE +    E  L+ + E     + VQ  WL L  I LGE  DI+  LP E++ F  +  ++++I T   Q+              T       L+ I+ SL  +LE +R  FPRFYF+ NDDLL+I+G  K+ D+V   +KK F +I S+    +  + F  + + S +GE +   +K+ L+  ++A  WL  L+  +++++    RDC   LK   +  +  + ++  Q  + S+Q+ WT  V K LQ        K  + +  K K +L+K +++   N+ K    KI +L+V  +H  ++I +L      +     W    +FY + + +DD     I Q+    QY +EY+G   RL+ TPL    + TLT +LH   GG   GPAGTGKTETVK  G++LG  V+V NC +  DY+ + R+  G+ Q GAWGCFDEFNR++ +VLS V+  I  I + L        + +     L P   +FIT+NPGY GR+ELP+NLK  FR  +M +P S  IAE+ L   GF   K LA K+     L   + S  +HY FGLR L  VLR        +PL+ +    E+ ++ S+  + L  L   D  +FK  +S +F    +P+    N K AI +C  +   Q + F+++     K +Q Y  + ++ ++++VGK   GK+ TW+ +  A+A             + + ++ K ++   LYG     T EW DG+ +S++R+   D     K    W++FD  +D  ++E+MNSV+DDNKILTL NGER+ +P    +LFE +NL   +PAT++RCG+++   +       ++  L +  ++ L  +LS MF  DK  + I +   M  +  I T   + V  L  + F+ L T                +N  D S  D    VI L  +  +++++   S  E  R   + I+ Y         +  TI    + N   S+  +  ++ +       V    I++PT+DT+++  +  +L+ +   ++L GP G+GKT +  N L   N+ ++ ++ IN S  T++ ++   +       T     T +P    K ++ F D+ N+P  D +GSQ  +  +RQ ++  GFW    K  + +   I+ +++  A  PP   GR+ +S R      ++ + +P+  +L +I+  +  + +     E +   +   +A++ +YN    ++  T  + HYLF+ R++++
Sbjct: 1410 EELVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGI-LGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESI----IFLEDF-ITGVRSVEGEVLNLNEKIELKDSIQAQEWLNILDTEIKLSVFTQFRDCLGQLKDG-TDIEVVVSKYIFQAILLSAQVMWTELVEKCLQT---NQFSKYWKEVDMKIKGLLDKLNKS-SDNVKK----KIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEET-PLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLR------NCSPLISEFGEGEKTVVESLKRVILPSLGDTDELVFKDELSKIFDSAGTPL----NSK-AIVQCLKDAG-QRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAMAIFDGHAN------VVYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFSTDVCSISSKIDHLLNKSYEA-LDNKLS-MFELDKLKDLISDSFDMASLTNIFTCSNDLVHILGVRTFNKLETAVQLAVHLISSYRQWFQNLDDKSLKD----VITLLIKRSLLYALAGDSTGESQRAFIQTINTYFGHDSQELSDYSTI---VIANDKLSFSSFCSEIPSVSLEAHEVMRPDIVIPTIDTIKHEKIFYDLLNSKRGIILCGPPGSGKTMIMNNALR--NSSLYDVVGINFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFW----KTPENKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIY-EIYYKAIFKLVPEFRSYTEPFARASVHLYNECKARY-STGLQSHYLFSPRELTR 2624          

HSP 2 Score: 317.005 bits (811), Expect = 0.000e+0
Identity = 253/1081 (23.40%), Postives = 523/1081 (48.38%), Query Frame = 3
Query: 8202 TKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGS-LFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEK--LKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIE-DTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMF---PAFVNCTTIDWFSEWPLDALLEVAERYLKDLQL----FIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNY------VTPTNYLELVSGYKILL---VEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAE-PTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKI--GTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAE-SVLREXXXXXXXXXXXXD--AVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVEN-GVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFN-MSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFS 11360
            T  S+ RLW +E +R+FADR+V  K+K +F +LL E +   L +Q   NI              S     D  ++ K  L  F++E    + +    +++ +V+    ++HI +I R ++Q +G+M+L+G   +G+  LTR  A++      Q ++ +H    +F   LK+      +    T  + +++ +++ +FLE +N +L++ +IP+L++ +E D L N L ++ +  G+  DT Q ++ + +  +  N+HVV     + +P  N+       PA  N   I+W  +W    + +VA   +  + +    FI  E ++       +F+   +++ D    +L    R+ Y      V P +    + G + L+     K + L ++   +  GL K++E+  KV  ++  L +   +L   +KE    L  ++ ++ E++ + ++  + ++ +KV E    K +E+ +  +    P +  A + ++++ K+ +TEI+S   PP+ V+ VMEAV  + G +   W + ++ + + DFI  ++++D        ++K     +++  +F  + + + S A   L  WV A   + +V   V+P RQ ++  E   L+ K   LAA +   D  A +E  KR   +Y+  +   E ++ +  + +  LDR+  LV  L  EK+RW  T          L G+C+I+S + +Y G      R  +++     + K  +  + ++ FI++L    +   W   GL ++ + +EN  +++      P ++DP       I    G K  ++      F++ LE AI+FG  V++Q+  E  DP +  ++++     G    +++GD E++ + DF+ +I +  P+      + ++  +V+F   ++ +E ++  I + +E  E++ ++++L+      K KL  LE  +L  LN +QG++L++++L+ TL   K  +  + ++L  +E+     D   + Y+   + +  +F +L   G+    Y  ++  ++  F  + I KS ++     R+  +       VYC     L +K K++ +
Sbjct: 2640 TLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYLPNQDLGNISSTSLL-------FSGLLSLDFKEVNKTDLVNFIEERFKTFCDEE--LEVPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRNKTRSLGLLLDTEQELYDWFVGEIAKNLHVVFT---ICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNK-----ELVFTEPIQTIRDAVVNILIHFDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQEEDIRKRKEVVMKSIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQFSNWRDIQQFIRKDDFIHNIVHYDTTLHMKPQIRKYMEEEFLSDPNFTYETINRASKACGPLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKR---KYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGNKTVLLSFLEEGFVKRLENAIRFGSVVIIQD-GEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTALDKKFKMIMA 3699          

HSP 3 Score: 72.7886 bits (177), Expect = 0.000e+0
Identity = 158/798 (19.80%), Postives = 326/798 (40.85%), Query Frame = 3
Query: 2208 LDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYN--RILQTLNAEERSL---------FKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINA-ARLQKKVD----EYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYE-IFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKKSIWEFISTDDEITKIQTNIRHGM---QDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRD-----------WQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEK---FHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWK-LALEWE----TNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEI-RKQFDEESSD---FTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEK 4472
            L +NF  AL   + EL     + F VP +          +RI+R  + L  R  N   ++QT  +  +SL          K  ++T+   +Q  LI   W S    E     C +++ ARL+K +D    +Y+   +   ++ +  S +        + ++ T  +D  E               EII+ ++  +E +F+K  +++  + + + N +     E  RLN+K               + P  + K+S N + R    I + P L  +  SL K+   ++ ++  I  +        +   F S    + K++ +I++ +   Q++   I   +  W +   +W++ +E F+            +D    R   +    LD+++   +   + +FS    ++  H  D           W   ++  LL +  +    LH  M    E V  +  N   L     +++ +N  + H+ E+      L      L K +V++        Q L+ ++    Q+L   EQ ++K +      L    ++      +L   +    P + ++ P EAL  +  F  S+  LK +   +     +  I    + ++  + +++   + +W+ +   WE    T  T W     + L++    +LAN   R+A +  R +K   +E+ +   ++V+       ++ +L++ A++ RHW  I  +I ++Q  +   D   F+L+ ++ LN   +  ++ ++   A KE  IE +L  ++K W+  + E+I H    K
Sbjct:  671 LKVNFDFALAAAYSELRSLTYMAFQVPSHI---------VRIARTYMYLYPRAINLVELIQTFFSLSKSLSYTFYTNIFLKRNVQTVWLLLQQILITP-WESLQE-ESSEMSCSVHSLARLEKSIDGILSDYQILKNSEPQFAKEFSGL--------KSFDGTA-DDLHEVE-------------EIISNIQAIFENLFTKGLTNVSDHISTFNNLIISIILEKVRLNLK-------------KMHFPKHVLKLSFN-EGR----ITSSPSLAAMKRSLLKDIEALLNKVVLINFLHDPDHPLSTTLTFNSL---VIKLKDDIQNCIEQVQNLHCKINSYVKEWQKMEFLWQITEEAFLE----------VVDNSTQRCFGILKGLLDSQSKFDLIISRNNFS---KNLVLHTEDAQRHIRSKMDSWILYVSKHLLTIYERDARKLHEDMNRDREAVEDMDINFTSLKNITVIIEAVNVNKRHLTERDIQIKLLGSVMRALTKLKVRFPSHFVYIDQ-LDNDFSSLRQSLSYVEQELQKHRVVIAKSLEEGVENINNLSQSLNESWSVRKPISPTLTPPEALKILEFFNESITKLKKKMHSVAAAAKMLLIPVVLNDQLTHVVEEVKTYDLVWRSIKNLWEDVQRTFETPWCRVDVLLLQS----DLANF-LRRADELPRAVK--QFEMYKSLFSQVNMLTSVNKILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFWKEAQYEVIEHSSGLK 1393          
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 1837.39 bits (4758), Expect = 0.000e+0
Identity = 874/1214 (71.99%), Postives = 1024/1214 (84.35%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEK--LMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  MK SR+VK FE EVDKWER LS I E VEM+LTVQRQW+YLENIFLGEDIRKQLP+ESA+FD +N  W++IM  LN+  NA       GLLET N MNT LE+IQKSLDMYLETKR IFPRFYF+SNDDLLEILGQSKNP+ V PHLKKCFDNI +LK+ +  L     EA  M+S++GE V F   + LEGPVEAWLCD+E+ MR TL++LL+ CR+ LKK+ SKRDKW+KEW GQL ITSSQ+QWT+D  KAL +  +R DKK L+ +KKKQ  +L KFSE IR +LTK+QRLKI +LV IEVH RD+IEKL K+GC+D+ AFEWLSQLR YW+K+IDDCV++QTNT FQYGYEYLGNSGRLVITPLTDRCY+TLTTALHLHRGGSPKGPAGTGKTETVKDLGK+LG YVIVVNCSEGLD+KSMGRM+SGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSAL++ A  +F+F+GR I+LV S GIFITMNPGYAGRTELPDNLKSMFRPI+M  PDS MIAEI LFAEGF+  KVLAKKV TLY+L++QQLSKQDHYDFGLRAL SVLRYAGRKKRANP M DEEILLLSM DMN+AKLT+ D PLF GIVSDLFPGI++PV+DY  ++ AI     +   QPT  TI K++QLYETK SRHS ++VG+T SGKS TWR+LQSA+  L ++ E  F    EFP+NPK+VSLGELYGEFDLNTNEWTDGVLSSVMR+TC+D +P+EKWI+FD PVDTLWIESMNSVMDDNK+LTLINGERISMP+ VSLLFEVE+L+VASPATVSRCGMVY D  DLGW+PYV+SWL R+VD   VE L R+F+K++ K+  F K +C E + TS  NSV+SLC LFD LAT ENG   S+ ++Y+R++ELWF FC+IWS+C SVDED RKK+DN++RE+EG FP KDT+YEY VD K K+W  W++KL++GW+YN SVPFYKI++PTVDTVRY++LV NL+    PV+L GPVGTGKTSVA   L +L+   + +L INMSAQTSSN+VQ+IIE++VEKRTK  +VP+GGK+M+TFMDDFNMPAKDTFGSQPPLELIR WIDYGFWYDR+KQT K +KDM+L  +MGPPGGGRM+IS RLQSRFNLINMTFP ES +KRIFG+MINQKLQDFEE++KP+GDI+TQATIE+YN +V K LPTPT+IHYLFNLRDISK
Sbjct: 1230 LSTMKASRYVKAFEAEVDKWERTLSLILEVVEMILTVQRQWMYLENIFLGEDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYPGLLETLNDMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSKNPEAVQPHLKKCFDNIKTLKMARVGLTFDKTEAVGMYSAEGEYVEFGHSVLLEGPVEAWLCDVERSMRWTLKELLKHCRLGLKKSLSKRDKWVKEWPGQLTITSSQMQWTSDCNKALSSSKERGDKKALKSLKKKQVSMLNKFSEMIRGSLTKMQRLKIVALVTIEVHGRDVIEKLIKAGCNDVTAFEWLSQLRLYWDKDIDDCVVRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGNYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGAT-RFVFEGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMCVPDSGMIAEIILFAEGFNNTKVLAKKVHTLYTLAVQQLSKQDHYDFGLRALTSVLRYAGRKKRANPDMSDEEILLLSMKDMNVAKLTTQDAPLFNGIVSDLFPGIEAPVIDYGKLRNAIVAELKDGGYQPTPNTILKIIQLYETKNSRHSTIVVGQTGSGKSVTWRVLQSAMTRLKRDGEPGFNVVREFPINPKAVSLGELYGEFDLNTNEWTDGVLSSVMRQTCSDEKPEEKWILFDAPVDTLWIESMNSVMDDNKVLTLINGERISMPDMVSLLFEVEDLAVASPATVSRCGMVYTDFRDLGWQPYVDSWLDRRVDKQSVEHLQRLFEKFVPKVLEFRKHHCKEPVPTSELNSVVSLCVLFDALATEENGVRMSNGESYARMLELWFLFCLIWSVCASVDEDSRKKMDNFLRELEGQFPAKDTVYEYHVDIKQKTWASWEDKLRSGWRYNPSVPFYKIMIPTVDTVRYDFLVYNLIQAKRPVLLTGPVGTGKTSVAQKVLQKLDPKTYGLLVINMSAQTSSNDVQEIIESKVEKRTKGVYVPIGGKQMITFMDDFNMPAKDTFGSQPPLELIRLWIDYGFWYDRMKQTVKYVKDMHLLASMGPPGGGRMVISKRLQSRFNLINMTFPQESQIKRIFGTMINQKLQDFEEDVKPLGDIMTQATIEIYNTIVAKMLPTPTRIHYLFNLRDISK 2442          

HSP 2 Score: 1825.06 bits (4726), Expect = 0.000e+0
Identity = 866/1224 (70.75%), Postives = 1039/1224 (84.89%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +LR NKD HDTK +I+RLW+HE FRVF+DR++ + D+ +FV LLS+KLGS+FD TFHN+CPNKQSPIFG++M     YED+ D + +K++M++ +++YN  PGV+ ++LVLFRDAIEH+++I+RVI QPRGNMLLVGIGGSGRQSLTRLA+Y+ EY  FQIEV+KHYR+QEFRDDLKRLY+QAGVDNKPT+FLFNDTQ ++E FLED+NNILSSGE+PNLYK DE +++R  LSD A ++ ++DT +S+F + I+RVR N+H+VLCMSPVG+PFRNRIRM+PAFVNCTTIDWFSEWP DALLEVAERYL++++L  G EE   K ++A IF  +HRSV DMS RML E+KRHNYVTPTNYLELVSGY+ LL EK+K+L D+A+KL+NGL KID+TRAKVEVMS+ELE+A  K+A FQK+C++YLVVIVQQKREAD+Q K V    E+I ++E KC  M E A  DL +A+PAL+ AM+ALESLNKKD+TEIKSYG+PPALV+KVMEAVMILR +EPTWAEAK+ LG+ +FIKQL+N+DKDN++DR LKKIGTY AQ DFQP+++G+VSLAAKSLCMWV AMEVYGR+YRVVEPK+QRL  A + L EKQA LA A+AKL  V + M+ L+++Y+EK  QKEELR KAE  E  LDRA KLVSGLAGE+DRWE +V  LE  IG L GDCLIA+AF+SY GPFLS+YR+ LV+K W   +++  +  NP+FSF  FL+ PT +R+WNIQGLP D FS ENGV+VTRG+RWPLM+DPQ QA KWIK MEGK  LK+IDL   D++R LE A+QFG PVLLQNVQE+LDPSL PILNKS+VK+GG  ++KLGDKE+EY+ DFRFYITTKL NPHYTPEISTKT IVNFAVKEQGLEAQLLGIVVR+ERPELEEQKD LV++IAAGK+KL ELEDEILRLL  AQGSLLDDEQLVNTL +SK TS EV EQL ++E+TE  ID AR+GY  CAQRASILFFVLND+G+IDPMYQF+LDAYIDLFN SI KS +SP  D RI NLN+YHTYAVY Y CRGLFE+HKLLFSFQ+C+KIL+ +GK+NMDEYNFFL+GGVVLDRE QMDNPC  WL+D +WDN++ELDKL NFHG++TSFEQYPRDWN WYTS  PE + LPGEW+NA NE QRML+VRSLRPDRVSF ATSFI+NNLG+KFVEPPVLDM  VVDDSS +T LIFVLSPG
Sbjct: 2445 QGLLRANKDLHDTKTAISRLWVHECFRVFSDRLIDNTDRESFVTLLSDKLGSMFDLTFHNLCPNKQSPIFGNFMKDDTMYEDLVDFKAIKRYMEDQMEDYNMEPGVIAINLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVTKHYRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQALEEGFLEDVNNILSSGEVPNLYKPDEFEEVRTALSDIAAKEDVQDTPESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAERYLENIEL--GDEE--TKANVAQIFVTVHRSVVDMSARMLLELKRHNYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDKIDDTRAKVEVMSVELEDATLKVAEFQKQCEEYLVVIVQQKREADEQQKMVQARSEKIAIEEDKCRVMAENAQHDLDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAVMILRQSEPTWAEAKRQLGDGNFIKQLVNYDKDNMTDRILKKIGTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLGVACNPNFSFSGFLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEGKSGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQRSPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQMCSKILEAAGKLNMDEYNFFLRGGVVLDREGQMDNPCTQWLTDTSWDNVTELDKLPNFHGIVTSFEQYPRDWNQWYTSSEPENTPLPGEWENACNELQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSSTRTPLIFVLSPG 3664          

HSP 3 Score: 999.579 bits (2583), Expect = 0.000e+0
Identity = 492/1023 (48.09%), Postives = 701/1023 (68.52%), Query Frame = 3
Query: 1479 LIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVK-LKKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            L ++CE Q HFAR  +G +  +P F G RG E+   +L+IE  FE NI+ L+  K TILDVKAT+WHDD+NRFR+GVKDLEVM QN I +AFETVTT+++G+EILD+F HL  RE IRRT DK    +     +E NLVKKE    T + LP P  PKYAG A WAR L++RI++ M  L +AFFLP   S  + R QY QL+ AL+E VRKT  E+ + +D+D  + L++ L+ RS    G LD+NF + LLKLF E+HYWE+L  + PHY +++Y ++ +LRI RE+VLLVVRDYNRI+  L+ EER LF+E+I++LDKKI PGL K+ W+SKG  +YF+ +CR N +++Q  VD+YK AN  I K C  IS ML++KIDS R+Y+N EF + Q+ H  +V+ +L   H EI+  M+ TYE+F  D  ++Q +W  Y  K+D+  EEAFRLNVK+SL EL++AINGDG++ P+PL +V + L+   + F PTL +L +++ ++       ++   R+ ++L + K +K+ +   I  D+E  KIQT+I+ GM   +S +Q  L  WD +REIWE+ K+ FI +Y  LNP V S DADI+RYTE+ N     E ++ + F+ LD S LK ++ +HC +WQ K T LL  MA++ L  L+N++K  ++K+S  P+ L+ELG+S+ LL++L  +  +I+ KF PL + F IL+KYEV   ++++     L  EW  F Q L++++ M+KKSK+KFKTGL+  S++FKK V+ L  DFQ+ GPF++SI  +EAL ++  +   + +LK QE  +RRGLN+FKIEQ  SK++  LEKDL+++E +W +  EWE  W  WK G+F+EL T +ME  A   F++  K  R++KDKNWEI +  ++R++QF+RTMPLI DL+N AMRDRHW QIK E++K FD    DFTLEKII+L  DQ  E I E+SGAA+KEL+IE A+ G+  +W+ V L+I P+KD  + HF L   D+++Q L+DN+ TLS 
Sbjct:  214 LRKVCEGQMHFARMYNGEQSPLPCFHGVRGPEIVRNLLEIEATFEKNIQILKAVKKTILDVKATTWHDDFNRFRAGVKDLEVMVQNLIASAFETVTTVEEGVEILDIFQHLSTREAIRRTIDKKTVEVYQLFNEELNLVKKEFNTKT-VDLP-PLYPKYAGSASWARMLKRRIDKSMNVLSKAFFLPQIGSGDEIRTQYQQLAQALDEFVRKTFNEWTATVDKDCGRLLEIPLMRRSAERAGTLDLNFDKVLLKLFNEIHYWEKLMLETPHYVSEVYQKKEDLRILRENVLLVVRDYNRIIAVLSPEERGLFRERIRSLDKKIHPGLTKLSWASKGISDYFIGECRNNCSKVQGIVDDYKNANLVISKNCIKISEMLLVKIDSKRVYDNLEFEEEQKKHMGLVQTRLQVAHVEIVGTMKNTYEVFKNDGQEVQAHWLRYTEKMDRMVEEAFRLNVKWSLQELSRAINGDGKSIPNPLLRVKVVLEGDKVEFSPTLTKLASMMDNIASTLTTCLQIFKRLPDLLTRKKSIKEPVHLVIERDEETKKIQTSIKAGMSANASHLQSYLSTWDGYREIWEIQKDAFIRRYQRLNPPVSSFDADIARYTEIANNFQKEETVLNIDFVLLDCSPLKFALLSHCNEWQNKFTTLLREMASQKLTELNNFLKGNAKKLSAPPETLDELGDSLSLLEQLQNDLPNIEAKFAPLHQQFAILEKYEVAIPEEVQGMLDALSGEWLLFQQCLIDSDVMLKKSKEKFKTGLIHSSEEFKKTVNGLFDDFQSKGPFSSSIGVKEALEQVTQYHEQVVNLKSQETSLRRGLNIFKIEQALSKDLQNLEKDLEHLEQVWTVTKEWEELWDTWKVGKFVELVTTDMETQAQLLFKRLNKIIREVKDKNWEICDSIKSRIEQFKRTMPLIQDLKNSAMRDRHWSQIKTEVQKPFDHTGDDFTLEKIIELGLDQFGEQICEISGAASKELSIEQAISGIASIWDQVSLDIGPYKD--RGHFRLKQTDEVFQQLEDNQVTLST 1232          

HSP 4 Score: 280.411 bits (716), Expect = 5.603e-75
Identity = 124/217 (57.14%), Postives = 169/217 (77.88%), Query Frame = 3
Query:  594 MMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKM 1244
            M  +YAP  F N  WPDSIKNDF   L +FM+ LTD R+K++GKTVLY+P+E+   ++E  +K K+F+ R+E  MIHWTRQIKEVLS+Q+ FE  E+SGPL+EIE+W++RC DLSGIS+QLDK GVK I   LE +KSSYV  FLKL+  I+  + QAQSNLKFL+TLK  C +L+ ++P+D+P+ML ++++ IRM+W+NSEHY SR+ +TG+ RK+
Sbjct:    1 MSNVYAPLLFGNQSWPDSIKNDFLAHLHKFMANLTDTRYKMQGKTVLYVPSESTTINIEQASKNKEFVQRLEAAMIHWTRQIKEVLSSQDTFETAENSGPLEEIEFWRSRCADLSGISEQLDKPGVKRIQATLELSKSSYVTPFLKLSKLIQDGSSQAQSNLKFLSTLKGPCEELAQAQPKDVPAMLPRILHTIRMVWMNSEHYRSRERLTGILRKV 217          
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Match: EDO35852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK91])

HSP 1 Score: 1008.82 bits (2607), Expect = 0.000e+0
Identity = 537/1240 (43.31%), Postives = 772/1240 (62.26%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDE-KWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIE---------LIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNY--SRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPN---------------KDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQ-TQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  M  SRFV PF   V+KWE+ LSHI E VE+ + VQR+W+YLE+IF+G DIR QLP+E+  FD I+K ++ IM +  +             L+    +   LE  QKSL+ YL++KRN FPRF+FIS+D+LL ILG S +P  V  H+ K FDNI SL+ ++  ++   A++M SS+GE + F+Q +  EG VE W+  + K MR T R + ++         + R +W+ ++ G + +  +Q+ WT +V    + V ++ DK  ++   +K    ++     +RSNL+K  R K N++++IEVH RDII+   +    D   FEW SQLRFYW++  D+ +I+Q    F YGYEY+G +GRLVITPLTDR Y+T+T AL ++ GG+P GPAGTGKTET KDL K+LG   +V NC EG+D+KS+G++FSGLAQ GAWGCFDEFNRI++ VLSVV+ QI ++ ++L+S    +  F+G  I L   +GIFITMNPGYAGRTELP+++K++FRP+  + PD   I EI LF+EGF   KVLAKK+  LY L+  QLSKQ HYDFGLRAL +VL  AG  KR +P + ++ +L+ ++ DMNL K    D+PLF G+++DLFPG+D P + Y N  +A+E    + +         KVVQ+YET  +RH+ MIVG T  GK+     L  A   L    +        + +N K+ ++ ELYG  D  T +WTDG+LS++ R+    T  +E K+I+FDG VD LW+E+MNSVMDDNK+LTL NGERI + +  +LLFEV +L  ASPATVSRCGMVY D  +LG+RPY + W   + ++   EEL R+F+KY+    + I    ++         +I  +  N V  L  + D L        P+++ N+    V E  F   +IWS    + EDGR   D  I+ + G   N               + T+YEY+ D+K   W  W + +   + +N  + + +I+VPTVDTVR  +L+Q +V    PV+LVG  GT KT+   N L  ++ D   +L IN S++T+S NVQ  +EA VEKRTKDT+ P  GKR+L FMDD NMP  D +G+Q P+ L++  ++ G  YDR K+   K ++D+    AMG PGGGR  +  R  S F++ N+TFP+E +L+RI+ S++   LQ F + ++ + + IT +T+E+Y  ++    PTP+K HY+FNLRD+S+
Sbjct: 1301 LQSMSASRFVGPFLETVNKWEKSLSHIGEVVEVWMVVQRKWMYLESIFIGGDIRAQLPEEARKFDDIDKTFKKIMADTAKNPKVLEACHAPNRLDQLQFIVNGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SHDPTCVQEHMIKMFDNIASLRFQEGSNKETLATAMISSEGESMDFRQAVPAEGRVEDWMTSVLKEMRRTNRLITKEAIYNYCNQIT-RIEWMMQYQGMVALAGNQVWWTWEVEDVFRKV-KKGDKMGMKNYARKCHRQIDDLVVKVRSNLSKNDRKKFNTVLIIEVHARDIIDSFVRDSIMDSREFEWESQLRFYWDQAPDELMIRQCTGEFGYGYEYMGLNGRLVITPLTDRIYLTITQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDFKSIGKIFSGLAQCGAWGCFDEFNRIDVSVLSVVSTQIKTLQNSLSSGL-KRLQFEGTEIALDARMGIFITMNPGYAGRTELPESVKALFRPVVCIVPDLQQICEIMLFSEGFLYAKVLAKKMTVLYKLASGQLSKQSHYDFGLRALKAVLVMAGELKRGSPELSEDVVLMRALRDMNLPKFVFEDVPLFLGLIADLFPGLDCPRVRYPNFNDAVESSLTDNKYILLPHQADKVVQMYETMLTRHTTMIVGPTGGGKTVVINTLAMAQTRLGMHTKL-------YVMNAKACTVIELYGTLDPVTRDWTDGLLSNIFREINKPTDKNERKYIVFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQKHCALLFEVADLRYASPATVSRCGMVYVDPKNLGYRPYWQKWCNARSNAKEREELDRLFEKYVPASVDLILEGILDGKQGKKLKTIIPLTNLNMVEQLSHMLDAL------LPPAESSNFLGPDVTEAIFISSLIWSTGAGLLEDGRIVYDQLIKRLAGIPANPAEGTVVGPGELPSAQPTLYEYYFDSKKLLWVPWLDVVPE-YVHNPDLKYNEILVPTVDTVRTTWLLQLMVNIHRPVLLVGETGTSKTATTANYLRGMDQDTTLLLNINFSSRTTSINVQHNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPQVDEYGTQQPIALLKLLLEKGGMYDRGKELIWKNVRDIGFVAAMGKPGGGRNEVDPRFISLFSVFNVTFPSEESLRRIYSSILTGHLQPFPKNIQDLVEHITTSTLELYTNIIRDLPPTPSKFHYIFNLRDLSR 2522          

HSP 2 Score: 789.645 bits (2038), Expect = 0.000e+0
Identity = 454/1243 (36.52%), Postives = 731/1243 (58.81%), Query Frame = 3
Query: 8151 FERYKQRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTF--HNICPNKQSPIFGDYMSSTD----TYEDITDIEKLKKFMKEMLDEYN--NTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKE--CDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQ-ALESLNKKDITEIKSYGKPPALVQKVMEAVMILRG-AEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIK-WTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWI-KQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLAN--FHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
              R  Q +  T  D  D+     R+W +E  RVF DR+  + D+    E +S  + SL DQ F  H     +   +FGDY ++       YED+ D +  K   +E+L+EYN  + P    M+LVLF DA+EH+++I RVIR  +G+ LLVG+GGSG+QSLT+LAA+      F+I +++ Y +  FR+DLK LY   G++NK  +FLF D  V  E FLE INN+L+SG +P LY  DE + +  Q+ DEA + G+    +SI+ Y +++   N+H+VL MSPVG+  R R R FP  +N    D + E  +D ++                               +H++V   SQ  L +++R NY TP NYL+ +S Y  LL  K K + +  ++L+ GLGK+     ++  ++ +L  A +K+A+ +K   C+  LV I +  ++A+++ +  +  ++ I  ++ K + +++    +   A        + AL+ L+K D+TEI+S+ KPP  VQ V E ++ LRG  E +W  AK  + E +F+K L   D D I+   +KK    + + +   + + +VS A   L  +V A+  Y  V R ++PKR+++   E      + +L   + +L A+ EE++RL ++Y++ M +K  L+++AE  E+ L  A KL+SGL  EK RW K + DL++Q   L GDCL+ +AFLSY+G F  D+R  ++ K W   + + +IP +  F     L+N  ++  W  +GLP D  S+ENG++ T+ SR+PL +DPQ QA  WI K+ E   LKV+  +  DF++ LE+AI++G P+L ++V E +DP +D +L+K+I    G   + LGDKE++Y+  FR Y+ TKL NP YTP   ++  +VN+ V  +GLE QLL ++V  ER ELEEQ++ L+   +  KR L +LED +LR L  +QG++LD+ +LV TL+ +K  + EV+E+L++  KT   ID  R GY   A+  ++LFFVL+++  ++ MYQ++L++Y+++F++S+ KS       +R+ N+ D  T  VY YAC GLFE+HKLLFSFQ+  KI++  GK+  +E +FFLKG + L++ ++   P   W+ DQ W+++  L ++    F  L    E+  + W  W   D+PE+   PG+++ + ++FQR+L++R  R DRV    T F+   +G K+V PPVL  + +++ S+  + +IF+LSPG
Sbjct: 2520 LSRVYQGLCLTTPDRFDSPAKFVRVWRNECMRVFCDRLTNEADR----ETVSGYISSLVDQNFSEHTDIAMRDPCLFGDYRNTLTEDPRLYEDVVDYDATKAIFEEILEEYNMDHAP----MNLVLFDDALEHLTRIHRVIRMDQGHALLVGVGGSGKQSLTKLAAFSAGCGVFEITLTRGYDENSFREDLKELYNSLGLENKKMVFLFTDAHVAQEGFLELINNMLTSGMVPALYPDDEKEGIIGQVRDEANKAGVPPARESIWQYFVNKCANNLHIVLAMSPVGDILRTRCRNFPG-LNDKIPDQYRETVVDHVV------------------------------FVHQTVGTYSQSFLQKLRRVNYTTPKNYLDFISTYNRLLEIKDKYVLEQCHRLEGGLGKLLAASEQLAELNEKL--AVQKIAVTEKSEACEKLLVEIQRATQQANEKKEMAIGKKKEI-AEQNKVIVVEKTEAEEALAAALPALEEAKLALQDLDKSDVTEIRSFAKPPRAVQMVSECIVALRGYKEISWKSAKAMMSEGNFLKSLTEMDVDGITTGQVKKCRDMLKEMNTTVEEMKEVSKAGAGLFKFVIAVMGYCSVAREIKPKREKVARLERNFHLSKRELEKIEKELKALEEELERLGKQYDDAMREKSSLQEEAEIMERRLIAADKLISGLGSEKIRWTKDLQDLKDQRVRLLGDCLLGAAFLSYLGAFTWDFRRDMLRKQWENDVIQREIPLSKPFKVDVLLTNDVEVSKWTSEGLPPDDLSIENGILTTQASRYPLCIDPQQQALNWIKKKEEKNNLKVVTFNDHDFLKQLELAIKYGFPILFKDVDEYIDPVIDNVLDKNIKGEPGREFVVLGDKEVDYDPSFRLYLNTKLSNPKYTPAHFSRCMVVNYTVTMKGLEDQLLSVIVGVERKELEEQRERLIQETSENKRLLKDLEDTLLRELATSQGNMLDNVELVQTLEDTKTKAVEVSEKLKLGAKTAIDIDKLRDGYRPAAKLGAVLFFVLSEMSVVNSMYQYSLNSYLEVFDLSLRKSLPDTILSKRLKNIMDTLTMNVYNYACTGLFERHKLLFSFQMTIKIMEADGKLKQEELDFFLKGNIALEKSSR-QKPY-SWMPDQGWEDVIRLCQVTPEVFGSLADDIERNEKGWREWSDLDAPESHPFPGKYEESLSDFQRLLLLRCFRVDRVYLAITHFVTGRMGEKYVTPPVLSFESILEQSTPFSPVIFILSPG 3718          

HSP 3 Score: 303.138 bits (775), Expect = 0.000e+0
Identity = 280/1343 (20.85%), Postives = 582/1343 (43.34%), Query Frame = 3
Query:  648 IKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTL----KDMCHDLS-DSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIY-DKICYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIIL---QIETVFENNIRALRDRKSTILDVKA----TSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLD----INFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKI----------DSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRE-TYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVK-----------EIPRIGEVLQKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPH-KDKEKNHFLLSGIDDLYQTLDDNRNTLSNEDIS 4556
            ++++F + +Q+F S +     +LEG   L +P       +   +K+ + +N +E  + +W   I   L  Q   +  + SGPL EI++W+ R   LS I++QL    VK I  +L    S  +  F    +E+     +A+ N++FL+TL    K++ H  S +   E IPSM+    N +RM+W+ S HYN  + M  +  +++ E+ +R   ++++  I         +K          +K+ Y D    +  +     W  D+  +F + D     C+DL E+ +    F            IF    G E++ +     +IE V +     ++  ++   D  +     SW +  + F   V  +E   ++ I  +F+++ + +   ++L  F H+++RE I            +++M++FN +  +              P  AG   W R+L  RI+R +L   +   +  +       ++Y  ++  ++E   K +  +   ++ + L  L   LL++   S         ++F+  L ++  E  Y E+L F VP  A ++ ++  +     + + L++  Y+ +  +L+  E  L  + IK L + ++PG  ++ W+S G  +Y V  C     + +  V++ +    DI    E+I    + K           D+   ++  E   SQE      K + +G    ++ +M        +  +  +Q Y+  + N V     EA    V  +L   N  +         PLF++   L   ++V  P   E+  +V    ++ +E  K           E P      +   +  S +  IS    I ++ T +   +Q+   ++ + L  W ++R +W+L+K   + ++   NP   + D  +  Y+ +  +         V+F++L+   L  +I A+ R W ++L  +L   A  +LM L   ++ +   + + P  LE+L   +R++  + +    ++ +   + E +  L  YE++ SD+       +++ W +        +  +   K KF      Q  +F   +S     F   GP +        +  +  F+    + + + QE+     LF +      E+  +EK+L  +E ++ +  + +    +W +  +  L    + +  +   ++  +  R++  K   +      ++ +F+ ++PL +DL+NEA+R+RHW ++ +    +FD     FTL+ +  +     +++I +++ +ATKEL IE  +  +   W +++  +  + K  ++  F+L  +D++ Q LDDN   L +   S
Sbjct:   18 LRDEFLMNIQKFSSNINRTIHQLEGDIRLEMPDLVLGDDITELSKDPEIVNTLEETLHNWEVTISSALEMQLK-KTPQGSGPLAEIDFWRERNATLSAIAEQLKLPTVKKIVAVLTKVNSENLANFEYHRAELNKYYTEAKDNVRFLSTLERHFKNLAHGASFNIVLETIPSMM----NALRMVWIISRHYNRDERMVPLMERIAWELSERVAKTVNIRTILKEPPYVVKQKTSEARDTLRTWKESYFDVRAKIESSGRDARWEFDRKRLFERTDYMASICEDLQEVAQVMEEFYN----------IF----GPELKAVTGDPKRIEDVLKRVHELVKPIENVAFDPFSLRHLASWRNVMDWFHREVNAIENEAKHFIDNSFKSLRSAEGAFDMLLNFRHIRSREAIN-----------SQMMKKFNDILVQFGKENQ--------PPVAGAISWERSLFYRIKRTILRFQEMEDMLNNEHGKQASKKYLSVARLMKEYEDKKYEAWREQVEANLLIYLKKNLLTKPSTSSATTHRSYVVDFAPELAEIITETKYLEQLGFQVPELARNVALQEEKYLKYVDGLKLMLERYHTVTGSLDVAETQLLDDNIKELKRVLKPGSKRLNWNSLGISDY-VTRCGQAIGKFESLVNQIQKNAKDIYSRLEMIEITELFKTPPPKTNGIMPDAKEYFDFLEKGRSQELEVLARKYRAIG---PLLTKMEGLVAHTNTGRAPKLQPYYAFWENAV----YEALTKMVTRNLQVFNTKLQSK-----LPLFQIETALSAPEIVLSPPANEIYKLVMQSVRDMVEGTKLFVRWMNGTCIETPPQHAEGEDEPVVFSFFTDISASPAIIELVTTVSKSVQNTLGTLNKYLNRWKRYRLLWKLDKSNMVMKFAAKNPTCIAYDEKLQFYSNLVLEVGTQPMSRDVEFVRLNLDPLATTIQANARAWVKELGKMLNESAKDNLMTLKGEIETLCTDLKRAPDTLEDLKFVLRVIADIRDMSLDVELRTADIKERYRTLKMYEIEVSDNETELVNGIDQLWDDLFVESRRVDYSLVSVKMKFTEITQDQVSNFTSDISKFKESFINEGPSSIGTDLDAGVELLKKFQEEYNTFEKERQELTNAERLFGLSITMYPELQQMEKELKGLEQVFGIYEKQKEARDEWANTLWANLDVSVLSDGIDGYIKQLKRLPREV--KALPLCHVLEEKMKEFKNSIPLFSDLKNEALRERHWKKLMDMTGMKFDLNPETFTLQNMFAMELHNFSDVIADITASATKELGIEKGIAEVSDTWNAMKFTVAKYMKGTQERGFVLGTVDEILQILDDNAMNLQSMSAS 1307          
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Match: EDO45806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR2])

HSP 1 Score: 1005.74 bits (2599), Expect = 0.000e+0
Identity = 533/1254 (42.50%), Postives = 765/1254 (61.00%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKL---RLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEE----LSRMFDKYIEKIQNFIKMNCI-ELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQ----FCMIWSICCSVDEDGRKKIDNYIREM-EG-------------------------TFPNKDTIYEY-FVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKL------QDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            M+ S F+KPFE+E+ +WE  L   QE ++  L VQ  WLYLE IF   DI  Q+P+E   F  ++K WR  M      ++       E +L      N  LE I K L+ YLE KR  FPRF+F+SND+LLEIL ++K+P +V PHLKKCF+ I SL+     +   + + M SS+GE VL K  +   +  G VE WL +L++ M  ++R ++ +   A  K   +R KW+++W GQ  +  +Q  WTA+V KA+     R  +K L    ++    ++     +R  L+K  R  + +LVV++VH RD++ KL + G S  + FEWL+QLR+Y+E+E  + + +  +    YGYEYLGNSGRLVITPLTDRCY TL  AL LH GG+P+GPAGTGKTET KDL K++    +V NCS+GLDY ++G+ F GLA  GAW CFDEFNRI++EVLSVVAQQIL+I   + S      +F+G  I L P+  +FITMNPGYAGR+ELPDNLK++FR +AM+ P+ AMIAEI+L++ GF   + LA K+ T Y+L  +QLS Q HYD+G+RA+ SVL  AG  K   P   ++ ++L S+ND+NL K  + DLPLF GI SDLFPG+  P  DYT +  A  + C +  LQ  +  +TK++Q+YE    RH  MIVG+   GK+  +R+L  AL++++++   +  K     +NPKS+++G+LYG+FD  ++EW+DGVL+   R   + T PD KW+IFDGPVD +WIE+MN+V+DDNK L L +GE I +    +L+FE  +L VASPATVSRCGM+Y + + LGW+P + SWL   +   L EE    +  +FD+  E +  FI+     EL  T+ TN V S   + D L   E   +    +   R +  W +    F  +WS+  ++D +GRK  D  +RE+ EG                          FP+K T+Y+Y F+      W  W E++K        + F +II+PTVDTVRY YL++ LV +  P + VGP GTGK+    N L +   + +  L IN SAQT++   QDII ++++KR K  + P  GK+ + F+DD NMPA++ +G+QPP+EL+RQW+D+  WYD    +   + D+ +  AMGPPGGGR  I+ R    FN I++T   +  + +IF  ++N  L      + F ++  PIGD++   T+E+Y   ++  LPTP K HYLFNLRD ++
Sbjct:  869 MRGSPFIKPFENEIKEWEGKLILTQEIIDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKNWRETMKVAVLDKHVLTVIGIEKMLGKLKKSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLQF----TDTLDITHMKSSEGELVLLKDVISTSKARGQVEKWLLELQEDMVASVRKVIMEAMEAYLK--EERVKWVRDWPGQTVLCVTQYYWTAEVHKAI-----RGGQKQLDQYLQQNNSQIDDIVTLVRGKLSKQNRATLGALVVLDVHARDVLTKLCELGISSEDDFEWLAQLRYYFEEE--NVMTRMISAHLAYGYEYLGNSGRLVITPLTDRCYRTLFGALQLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQMGIKSGGD-TLLFEGTEIKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPNYAMIAEISLYSYGFVNARSLAVKIVTTYTLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPDENEDILMLRSINDVNLPKFLAHDLPLFAGITSDLFPGVQLPKPDYTVLTAAAAEVCKSMNLQMVDEFLTKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAKALSDVAEKGLMEENKVQIVVINPKSITMGQLYGQFDPVSHEWSDGVLAVNYRAFASSTTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLNSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWKPLLTSWL-HTLPKTLNEENKELIKDLFDRMEEALLQFIRKGGFKELSPTNDTNLVNSHMNMMDTLMD-EFHDEQRFKELNEREVAAWLECIYLFSCVWSLGATLDGEGRKSFDKLLREIVEGPLSLESKSKYHILEIVDPPPRPFLCPFPSKATVYDYRFIKEGMGKWELWTEEIKDAPPIPKDMAFNEIIIPTVDTVRYTYLMEQLVTHGKPSLFVGPTGTGKSVYITNFLLKKLEETYKPLLINFSAQTTAKQTQDIIMSKLDKRRKGVYGPPLGKKTVVFVDDLNMPAREVYGAQPPIELLRQWLDHWQWYDLKDTSPIHLVDIQILAAMGPPGGGRNPITPRFLRHFNTISITKFDDGTMVKIFSRIMNWHLTTNASCRGFSKDFGPIGDMLVNGTLEIYRNAIVNLLPTPAKSHYLFNLRDFAR 2106          

HSP 2 Score: 948.347 bits (2450), Expect = 0.000e+0
Identity = 526/1271 (41.38%), Postives = 765/1271 (60.19%), Query Frame = 3
Query: 8151 FERYKQRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFV----ELLSEKLGSLFDQTFHNICPNKQSPI------------FGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSD-EAKRDGIEDTTQS---IFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALA-------DLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPT---------------WAEAKKHLGEQDFIKQLINFDKDNISDRTLKKI-GTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            F R  Q  L +  D     + + RLW HE FRVF DR+V   D+        E+    L   FD  F  +  +    +            F D  +    Y ++ D++KL+  ++  LDE+NN      M LVLFR AIEH+S+I RVI+QPRG+ LLVG+GGSGRQSLTRLAA+M ++  FQ+E+ K Y   E+R+D+K +  +        +FLF DTQ+ +ESFLEDINN+L++GE+PNL+  DE  ++  ++   + +RD  + T  S   +F Y I+RVR  +H+VL MSP+G+ FRNR+R FP+ VNC TIDWF  WP DAL  VA+R+L++ ++     E  +K     +    H S  D+S R   E+KRHNYVTPT+YLEL+S +K LL +K++++  +  + + GL K++  +++V  M  ELE  + +L    KE DD +V+I +   E       V +T++ +K DEA   +    A A       DL +A+P LE+A+ AL +L   DIT +K+   PPA V+ VMEA+ IL+G +P                WA +K+ LG+  F++ L  +DKDNI    +K+I   Y +  +F PD +   S AA+ LC WV AM+ Y +   +    +       SVL + Q       A  + V +++ RLQ++Y   +++K +L K+ +   K LDRA KL+ GL GEK RW +    L  +   L GD L++S  ++Y+G F + +R+     ++ + +  +         +  ++ P +IRDW I GLP D FS+ENG+I+   +RWPLM+DPQ QA KWIK ME K  L VI L   D++R LE  IQFG PVLL+NV E+LDP L+P+L K   K GG+  +K+GD  IEY+ DFRFYITTKL NPHY PE + K  ++NF +  +GLE QLLGIVV +ERPELEE+K+ L++  A  KR+L E+ED+IL +L+ ++G++L+DE  +N L +SK+ + E++E+  IAE+TE  ID  R GY   A  ++ILFF + DL  I+PMYQ++L  +I+LF MSI+ S KS + D+R+ NL ++ TY++YC  CR LFEK KLLFSF +C  IL   G++  DE+ F L GGV LD  N   NP   WL  ++WD I  LD ++ F G    F +    W   Y S+ P+T  LPGEW+   + FQ+M+++R LRPD+++ C  +F+   LG K++EPP  D+ +   DS++   LIFVLSPG
Sbjct: 2104 FARVIQGTLLSAPDRITEHDMLKRLWSHEVFRVFYDRLVDGGDRDWLYNNLREVCKSHLNVEFDTLFQRLDFDGDGKVKEDDLRSLVFCDFTDAKADPKPYVEVEDLDKLRGVVENYLDEFNNM-SKKPMTLVLFRFAIEHVSRISRVIKQPRGHCLLVGVGGSGRQSLTRLAAHMADFDLFQVEIGKGYTSTEWREDIKAILRKTAEGETNGVFLFTDTQIKEESFLEDINNLLNAGEVPNLFPLDEKQEICEKMRQFDRQRDKSKQTDGSPVALFNYFIERVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPADALQVVAQRFLEECEI-----EADVKEGCVEMCKSFHTSTRDLSLRYQSELKRHNYVTPTSYLELISTFKALLNKKQQEVVKAKRRYEVGLEKLNSAQSQVASMQEELEALQPQLIQAGKEVDDIMVIIERDSIE-------VAKTEKIVKADEAVANEQAMAAKAIKDECDKDLGEAIPILESALAALNTLTPADITVVKTMKSPPAGVKLVMEAICILKGVKPDRIPDPSGSGKKIEDFWAPSKRILGDMKFLQGLQTYDKDNIPAPAIKQIRQKYTSNPEFDPDKIKVASTAAEGLCRWVIAMDSYEKYDHLTTTFKSIDLLLMSVLCDFQGLNKKRAALKE-VQDKLARLQEKYEANVKKKSDLEKQVDLCSKKLDRAEKLIGGLGGEKTRWTEVANALGVRYTNLIGDVLVSSGVVAYLGAFTAAFRQGTCRAYSSSGRLVEY----GRVLVALIAQPVKIRDWTIFGLPTDSFSIENGIIINNANRWPLMIDPQGQANKWIKNMEKKNNLHVIKLTDADYVRTLENCIQFGTPVLLENVGEELDPLLEPLLLKQTFKQGGSICIKVGDSVIEYSKDFRFYITTKLRNPHYLPETAVKVTLLNFMITPEGLEDQLLGIVVARERPELEEEKNALILQSAENKRQLKEIEDKILEVLSSSEGNILEDETAINVLSSSKVLANEISEKQAIAEETEEKIDKTRMGYTPIAVHSAILFFSIADLANIEPMYQYSLTWFINLFIMSIDNSEKSEELDKRLENLRNHFTYSLYCNVCRSLFEKDKLLFSFLLCVNILMHDGEVCRDEWRFLLTGGVGLD--NPHSNPA-SWLPSRSWDEICRLDDMSKFKGFRQKFPRTLEGWKKIYDSNEPQTMPLPGEWEEKFDFFQKMVLLRCLRPDKITPCVQNFVTVKLGKKYIEPPPFDLGKAFADSNSCAPLIFVLSPG 3353          

HSP 3 Score: 80.8777 bits (198), Expect = 0.000e+0
Identity = 112/567 (19.75%), Postives = 253/567 (44.62%), Query Frame = 3
Query: 2904 PLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQK--VKLKKSIWEFIS---TDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYS-IDADISRYTEVTNKA-LDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYM----KNMSEKVSKIPQNLEELGESMRLLDKL-NEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQ-EFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQV---SALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQP---------PSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNW--EIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDD 4523
            P F + L L+   + F P   +   ++ ++    I+ V  +PR+   L       KK++   IS    ++   K+   I H M    +  +E L ++D+++++     E  + Q+  L  H ++    ++ ++ ++ ++   ++  ++ V   +L    L  ++A      + KL    L   +K    L+  +    + ++EK    P N E L E    ++++ NE    ++++          L  Y      D+RL   N   +W     +   E ++++  ++ +++  L ++ + F +++   S  + +FQT G           ++++  +    ++L  + +     +  F +E+          P ++   L   L+    +++  +E++  + +W  G +  +   ++E+   + +R   K  + L +      I    + +V++F+  +PL+  + N  +RDRHW Q+ +EI     +   D  L K+ ++N + +      +S AA+KE ++E A++ M   W++VE  +IP+  +E    +LS IDD+   LDD
Sbjct:  321 PGFIMRLVLEGDTVKFEPDFKDFEVVLLNVYDVMIKAVMVVPRVETKLYSEWSGTKKTLKPIISEEIVNEAKAKVHAVIEHEM----AGPKEHLKFYDKYKDLITRKAEADVDQFL-LEGHKFNRFSKEVEKFAKLVDEIQYNSRKVIRVGMFELHCDELIRALAKRGDGLRTKL----LQRMSKDHQVLNKMLCEEYEKIAEKALTSPANTEHLMELKNYIEQVENETIFDLEKRLVETKSRLGFLVDYASFSPADMRL--NNSVFQWHFRMPEVFEEHKKIVNANRVQYENSLKMRRERFVEELESYSKQLEEFQTFG----------DMSEVPRYLKKAQALHQRLETAAEKIVTFNVEEEAFGWDTTSYPQRQ--QLINTLNPYLKLYETTVEFQNKYKEWMEGPWGTIDPDKVESETGNYWRSLYKLEKQLTEVPLAQRIAGRMKTKVEEFKEYLPLVQVVFNPGLRDRHWEQM-SEILGFPLKPDEDMNLAKMAEMNLEPYLAQFETISEAASKEFSLEKAMEKMVGEWDAVEFVMIPY--RETGTHILSSIDDIQTLLDD 861          
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Match: EDO37961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE81])

HSP 1 Score: 1001.5 bits (2588), Expect = 0.000e+0
Identity = 528/1263 (41.81%), Postives = 784/1263 (62.07%), Query Frame = 3
Query: 8151 FERYKQRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDK-VAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDY-----MSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDE----IDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPT---------------WAEAKKHLGEQDFIKQLINFDKDNISDRTLKKI-GTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGK-KLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPIL---------NKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            F R    +L   KD    K +ITRLW+HE +RVF DR+V DKD+         + L +LF Q   +   + +S +F D+     M+    Y+++T+I++L K ++  LDEYN T     M+LV+FR  +EH+ +I RV++QP GN LLVG+GGSGRQSL+RLAA +  +  FQ E+SK Y   E+R+D+K L   AG   KPT+FL  DTQ+ +ESFLED++++L++GE+PNL+  DE    I+ +R     +A+    E +  ++F + ++  +  +H++LCMSP+G+ FRNR+R FPA +NC TIDWF  WP DAL  VA ++L+D  L      D  +  + T+    H S  ++S++ L+ + RHNYVTPT+YLEL+S +K LL  K+ ++  S  + + GL K+    ++V  M +ELEE + +L +   E D  +++I ++ +E +  ++ V + +    +  A+   +++   ADLA+A+PALEAAM AL +L   DIT +KS   PPA V+ VM AV +++  +P                W  +KK LG+  F+  L  +D+DNIS   + KI   Y+   DF P  V   S AA+ LC WV AME+Y RV +VV PK++ L  AE+ L E  + L A + +L  V  ++  L+ ++ E  E+KE L  + +   K L RA KL+ GL GEKDRW      L++    L GD LI+S  ++Y+G F + +R+    +WT+  + + IP +  F   + L    +IR WNI GLP D FS++NGVIV    RWPLM+DPQ QA KWIK  E + +L VI L   D+IR LE +IQFG PVLL+NV+E+LDPSL P+L         +  I  +GG   ++LG+  IEY+ DFRFYITTKL NPHY PE+STK  ++NF +  +GL+ QLLGIVV KERP+LEE++  L++  AA K++L E+ED+IL  L+ ++G++L+DE  +  L +SK+ S E++++ +IA++TE  I+ +R+GY   A  AS+LFF + DL  IDPMYQ++L  +++LF  SI+ S KS   + R+  L+D+ TY +YC  CR LFEK KLLFSF +CA IL++  +++M E+ FFL GG+ L  EN+++NP P WLSD++WD I  +  L+ F     SF     +W   Y S  P  + LP  W     +FQ+M+++R LRPD+V    T+F+ + LG KF++PP  D+ +   DS+A   L+F+LSPG
Sbjct:  802 FSRVVLGVLLIKKDALADKKTITRLWVHEVYRVFYDRLVDDKDRDWLHTTCNCDFLCTLFSQASED---DMRSLMFCDFLNPDAMAEDRLYQEVTEIDELYKIVEACLDEYNQTHKT-GMNLVVFRYVLEHLVRISRVLKQPGGNALLVGVGGSGRQSLSRLAADIAGFAVFQPEISKSYGMTEWREDVKTLLKSAGCQMKPTIFLLTDTQIKEESFLEDVDSLLNTGEVPNLFPTDEKAEIIEAVRPHAQAQAEDKNAEFSPLALFNFFVNSCKEKLHIMLCMSPIGDAFRNRLRQFPALINCCTIDWFQPWPEDALEMVANKFLEDAVL-----TDNERKEIVTLCKYFHTSSRNLSEKYLEVLGRHNYVTPTSYLELISSFKTLLGRKQDEVLRSKRRYEVGLEKLAFAASQVAKMQVELEELQPQLVVAAAENDKMMIIIEKESKEVEATSELVRKDEAAANIQAAEAQALKDECEADLAEAIPALEAAMSALNTLKPADITIVKSMANPPAGVKLVMSAVCVMKDIKPEKVNDPGGTGKKILDFWGPSKKLLGDMTFLTSLKEYDRDNISPHIMAKIRKEYIPNPDFDPSKVKTASSAAEGLCKWVIAMEIYDRVAKVVAPKKESLAKAEASLAETMSLLNAKRRELAEVEAKLAALKSQFQEMTEKKENLEFQVDLCSKKLVRAEKLIGGLGGEKDRWSLAAKTLQDTFDNLTGDVLISSGVIAYLGAFTAGFRKECTHEWTKICQSKNIPCSDDFLLSKTLGEAIKIRAWNIAGLPTDSFSIDNGVIVDCARRWPLMIDPQGQANKWIKNSEKENQLSVIKLTDGDYIRTLENSIQFGNPVLLENVEEELDPSLQPMLLGRDSKKPYHVKITLVGGVVCIRLGESVIEYSSDFRFYITTKLRNPHYLPELSTKVTLLNFMITPEGLQDQLLGIVVAKERPDLEEERQALILQSAANKKQLKEIEDKILETLSSSEGNILEDETAIQILDSSKVLSDEISKKQKIADETEAKINESRRGYNPIAAHASVLFFSITDLPNIDPMYQYSLTWFVNLFLNSIHDSNKSKILERRLRYLSDHFTYNLYCNVCRSLFEKDKLLFSFVLCANILKSKSELDMTEFMFFLTGGIGL--ENKLENPDPSWLSDRSWDEICRMCDLSGFKDFRKSFSNTTHEWRKIYDSKEPHRAPLPSPWSEQLTDFQKMIVIRCLRPDKVVPLVTNFVEDKLGKKFIQPPPFDLAKSYVDSNACAPLLFILSPG 2053          

HSP 2 Score: 613.609 bits (1581), Expect = 1.684e-178
Identity = 343/899 (38.15%), Postives = 494/899 (54.95%), Query Frame = 1
Query: 5563 VIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEE---LSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCL--ATVENGCDPSDTDNYSRVIELW----FQFCMIWSICCSVDEDGRKKIDNYIREM-----------------EGTFPNKDTIYEYFVDNKNK-SWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTL-NQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQ--DFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            +++  N S +YG EYLGNSGRLVITPLTDRCY TL +A HL+ GG+P+GPAGTGKTET KDL K+L    +V NCS+GLDY  MG+ F GLA  GAW CFDEFNRI +EVLSVVAQQIL I  A+A++   +F+F+G  ++L P+  + ITMNPGYAGR+ELPDNLK +FR +AM+ PD A+I EI L++ GF   + L+ K+ T Y+L  +QLS Q HYD+G+RA+ +VL  AG  K   P   +  +LL S+ D+NL K  S D+PLF+GI+SDLFPGI  P  DY    + +++ C    +Q  +F   K++Q YE    RH       +L+   + W    S LA L + R                                WTDG++++  R+  AD   +  W                                                    PATVSRCGM+Y + + LGW P ++SWL  ++  VL E    +  +F   +     F++ +C E +  S +N   SL  L + +     E G D        + +++W    F F ++WS+   VD + R K D + +++                 E   P +  +Y+Y  + KN+ +W  W + +K+            IIVPT+DT RY+YL+  ++ N  P++ VGP GTGK++   + L N L  D++    +N SAQTS+N  QDII ++++KR K  F P  GKR + F+DD NMPA + +G+QPP+EL+RQ++D+  WYDR   T+  + D+    AMGPPGGGR  +S R    FN++++    +  ++RIF S++    +  DF  +    G+ +  AT+E+Y   +I  LPTP K HY FNLRD S+
Sbjct:    1 MVRIINASVKYGCEYLGNSGRLVITPLTDRCYRTLMSAFHLNLGGAPEGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYLQMGKFFKGLASCGAWACFDEFNRIELEVLSVVAQQILCIQRAIAAHQ-DRFIFEGTDLNLNPNCYVAITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIGEIMLYSYGFVDARNLSVKIVTTYTLCSEQLSSQFHYDYGMRAVKAVLAAAGNLKLKYPNNDENVLLLRSIMDVNLPKFLSHDIPLFEGIISDLFPGIKLPKADYDTFLDTVQEVCAKKNIQFVDFFREKIIQTYEMMVVRHGCGT--GSLTPSPSQW---YSFLASLIQFR-----------------------------IRYWTDGIVANTFREYAADHDGNPMW----------------------------------------------------PATVSRCGMIYLEPSSLGWDPVLQSWLG-ELPEVLKEHDKLIDALFKWALPACLTFVRKSCKEAVHCSDSNLARSLMNLVEIMLKEASEEGAD-------IKHLKIWVVSSFLFSVVWSVGACVDTESRAKFDVFFKDLMGGKLDDHPIPTLVGKIESPIPPEGMVYDYLFERKNRGNWLQWTKLIKSTSLGGKGTRINDIIVPTMDTARYSYLMDLMIHNNKPLLFVGPTGTGKSAYVKDKLMNGLPKDLYLPAFVNFSAQTSANQTQDIIMSKLDKRRKGVFGPPVGKRFVIFVDDVNMPALEKYGAQPPIELLRQYLDHRNWYDRKDTTKISLIDLQFICAMGPPGGGRNPVSPRFLRHFNVVSVATFNDETMQRIFSSIVQFYFRNNDFPTDALCAGNQVVSATMEIYKEAMINLLPTPAKSHYTFNLRDFSR 804          
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Match: EDO31800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW2])

HSP 1 Score: 942.954 bits (2436), Expect = 0.000e+0
Identity = 527/1242 (42.43%), Postives = 764/1242 (61.51%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNK--QSPI-FGDYMS-----STDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGI-EDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECD-DYLVVIVQQKREADDQAKSVMQTQERI---KVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGF-SVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKK-LKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISEL-DKLANFHGLITSFEQYPRDWNLWYTSDSP----ETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +L+ +      K  I RL+ HE  RVF DR++  +DK  F  ++SE     F Q      P K   +PI FGD+M      +   YE++TD++K+K  + + LD+YN      +M LV F DAIEHIS+I R++RQPRGN LLVG+GG+G+QSLTRLA +M  Y  FQIE+++ Y    FR+DLK+LY  AGV  + T+FLF DTQ+V E FLEDINNIL+SGE+PNL++ +E + + N     AK  GI E     +F Y I RVR N+H+VLCMSPVG+ FR R RMFP+ VNC TIDWF+EWP +ALL V+  + +++ L   G +D+    +A +   +H SVS M+ R   E++R  Y TPT+YLEL++ Y  +L EKRKQL  + +++KNGL K+ ET   V+ M +EL     +L   QK  D + L+  +Q  +E  D+ ++V+Q +E +   K DE   +  +  A  DL +A+PALEAA +AL+SL+K DI+E++ + KPP LV  VME++ IL G +P W  AK  LG+  F+K+L+++DKD I D TL+K+  Y+    F  ++V KVS A +S+ MWV AM++Y RVYR VEPKR +L AA++ L    + L   QA L  V  ++  LQ  Y+  + +KE L K    T   L RASKL + L  E+ RW + VA  E +IG + G+  +A+A ++Y G F S YR  L+  W E  K+  +P +  FS I  L++P +IR WN  GLPRD   ++E+ ++     R  L +    +A +WI+  E K  LK+I L   +F+R LE  I+ G PVLL+ V E LDP+L+PIL K     GG  +++LGD +I+Y+ +FRFY+TTKL NPHY PE+  K  I+NF V + GLE QLL  VVR ERP+LE+Q++ L++ I + K +L  +ED IL+LL  ++G++LDDE L+NTL  SK+TS  ++ +L+ AE+TE  I IAR+ Y   A R S+++FV+  L ++DPMYQ++L  +  LFN  I  S K+   D R+  L +  T +VY    RGLFEK KL+FSF +C  I++    +  +E+NFFL+G   LD+E       P WL+D  W+   +L D L +F G    F + P   ++     S     + +  P  W +    F+R++ +++ + ++V F A  F+  NLG  FVE P +D+  + ++ S    LIF+LS G
Sbjct: 2061 QGVLQADPGVIRDKGQIFRLFCHEASRVFQDRLINKEDKTFFNTIMSEMAHKHFQQAR---SPEKFESNPILFGDFMKMGADPADKLYEELTDLKKVKNLLTDYLDDYNMNSSK-EMKLVFFMDAIEHISRIARMVRQPRGNALLVGVGGTGKQSLTRLACHMSAYKCFQIELTRGYDYSAFREDLKKLYDVAGVKGENTVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEPEEYEAVLNGTRPLAKEAGIPEGDRDGVFDYFISRVRNNLHIVLCMSPVGDAFRTRCRMFPSLVNCCTIDWFTEWPREALLSVSSNFFEEVDLGAEGVKDK----VAEMCVEIHTSVSTMADRFYAELRRRYYTTPTSYLELITLYLSMLDEKRKQLIGARDRVKNGLKKLLETNDLVDTMQVELVALEPQLK--QKSLDVEKLMEKLQVDQEEADKVRNVVQAEEAVAKEKADETSAIAAE--AQKDLDEALPALEAAQKALDSLDKSDISELRVFTKPPELVMTVMESICILLGVKPDWPSAKTMLGDAGFLKKLMDYDKDKIPDSTLRKLKKYIDNPKFVVEVVEKVSKACRSMVMWVRAMDLYARVYRTVEPKRAKLAAAQAELEVVMSTLREKQASLAEVESKIAELQAAYDHSIAEKETLTKNIAQTAARLKRASKLTTALGDEQGRWTENVAAFELEIGNVVGNVFVAAACVAYFGAFTSLYRHELINSWIEQCKELGVPVSDDFSLINVLADPYEIRQWNSDGLPRDSLKAIEDRILKLLNMRSTLFL----KANRWIRTKEAKNGLKIIKLTDNNFLRTLENCIRIGMPVLLEEVGESLDPALEPILLKQTFVQGGRLLIRLGDSDIDYDKNFRFYMTTKLANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLERPDLEDQRNQLIVRINSDKNQLKAIEDRILKLLFHSEGNILDDEVLINTLNESKVTSGVISTRLKEAERTEEKITIAREKYRPVATRGSVMYFVVASLAEVDPMYQYSLKYFKQLFNACIESSEKTDDLDRRLEILLNNCTESVYVNVARGLFEKDKLVFSFMLCGDIMRQQEIITDEEWNFFLRGTGGLDKERPAKPDVP-WLTDFMWNTCCDLEDVLHSFKGFKGDFVKAPITISMGNLQQSEVGDDDQAEKPRSWQDRLTSFERLIFIKAFKEEKVVFAAVDFVCENLGKTFVESPSIDLPVLFENVSNMIPLIFILSTG 3285          

HSP 2 Score: 867.455 bits (2240), Expect = 0.000e+0
Identity = 432/947 (45.62%), Postives = 607/947 (64.10%), Query Frame = 1
Query: 5368 LEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQ--FEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSV---LVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTD--NYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM-----EGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDI-WTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L   +  +R  L K+ R  + +L+ I+VH RDI+  +  +     N FEW+ QLR+YW+ ++D+CV++ +N+ + YGYEYLG S RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCSEGLD+K MGR FSGLAQ+GAW CFDEFNRI+IEVLSV+AQQ+L+I +A  + A  +FMF+GR I LVPS   FITMNPGYAGRTELPDNLK++FRP+AM+ P+ A+IAE+ L++EGF   K LA+K+  +Y L  +QLS+QDHYDFG+RA+ SVL  AG  KR+NP + ++ +L+ ++ D NL K  + D  LF+ I++DLFPG + P  DY  ++  IE C     LQ     + KV+QLYET   RH VM+VG T SGK+T + +LQ  L  L ++ E    +       LNPKSV++GELYGE +  T EW DG+++  +R+   +T PD KWI+ DGPVD LWIE+MN+V+DDNK+L L N ERI +   + +LFEV++L+VASPATVSRCGMVY D N+LGWRP+V SW+++  D +     E L  +FD Y++    F    C + ++    + V ++C LFD       G    + D      +I   F F  +WSI  ++ E   +  D + R++     +   P    +Y Y+VD   +    W EK+   +KY++ VP++ ++VPTVDTVR+ +L+  L+     V+  G  G GK+ +A   L+ ++    +  + +N SAQTSS   Q++IE ++EK+ K+      GKRM+ F+DD NMP  DT+GSQPP+EL+RQ+ D+  +YDR K   K I DM +  A  PPGGGR  ++ R    F++  +    E  L  IF S+++  L DF  E++   D I  A++E+Y  +    LPTP K HY+FNLRD+SK
Sbjct: 1114 LNNLAALVRGVLPKLTRNILGALITIDVHARDIVTGMVNAKVDSENNFEWIKQLRYYWDPDLDNCVVRMSNSMYIYGYEYLGASARLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCSEGLDFKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLLTIRNAKVAKA-SRFMFEGREIKLVPSCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKNLARKMTQMYRLCSEQLSQQDHYDFGMRAVKSVLVMAGALKRSNPDLEEDVVLIRALRDSNLPKFLAADAILFRAILTDLFPGKEIPDHDYGKLQSTIEDCMVAKGLQAIPALVKKVIQLYETMIVRHGVMLVGPTGSGKTTNYMMLQDTLTSLHEQAEDSPYYLPVQTHILNPKSVTMGELYGEVNKLTMEWRDGLMALKVRQCVQETTPDHKWIVCDGPVDALWIENMNTVLDDNKMLCLANSERIKLNNTIHMLFEVQDLAVASPATVSRCGMVYMDPNELGWRPFVRSWMQKHSDKMKEETREYLWNLFDHYVDAGLKFASKKCTQAMQQVDISKVTTMCCLFDSFFFPAKGGPDFNLDPTKLHPLICTAFLFVFLWSIGGNLVETCNESFDTFTRDLFADTHDVRIPGSGDLYSYYVDFDTRRMEPW-EKIIPAFKYSSEVPYFDLLVPTVDTVRFGFLMDKLLSVNKSVLYTGTTGVGKSVIAKAILDDISQKSNYMAIMMNFSAQTSSQRTQEMIETKLEKKRKNILGAPAGKRMVIFVDDLNMPKLDTYGSQPPIELLRQYQDFRGFYDREKLFWKEIHDMTICSACAPPGGGRNPVTPRFLRHFSMFCIPSSAEHTLGHIFKSIVSGFLLDFPAEVRECADAIVGASVEIYARMSTDLLPTPAKSHYVFNLRDLSK 2058          

HSP 3 Score: 162.925 bits (411), Expect = 7.767e-66
Identity = 78/156 (50.00%), Postives = 105/156 (67.31%), Query Frame = 1
Query: 4552 SRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKI 5019
            SR V P    V++W+R L    ET++  +T QR WLYLE+IF   DI++QLP E+  F  ++K W+ IM ++N++ NA     + GLLETF   N  L+ IQK L+ YLE+K  IFPRFYF+SND+LLEIL Q++NP  V PHL+KCFD I  L+ 
Sbjct:  839 SRHVGPIRPRVEEWQRQLYLFSETMDEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMTVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKCVIFPRFYFLSNDELLEILSQTRNPHAVQPHLQKCFDAIAKLEF 994          

HSP 4 Score: 109.768 bits (273), Expect = 7.767e-66
Identity = 113/563 (20.07%), Postives = 236/563 (41.92%), Query Frame = 3
Query: 2904 PLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRI---------------GEVLQKVKLK-KSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            PLF   L ++ + L+F P L +    +  + K F + V  +  +               G+V +K   +  S+      D  +  +  +IR  + +      +    ++ +R+ ++ N+   +    +    V      + +Y     +A+   A   +  +  D   LK  +        + + ++L  +A K    L  + ++   ++  +P +  +  +S+  LD++ E+ + I+ +   + E + ++D Y+V    +     Q L          + ++      + DKF T +        K V  +    Q      +S   +  +A +   +  ++ L       +     FK+E    +E+  +  +L   +++W   +EW+ +   W    F EL    + N      +   +  + L   +  ++   + +++  R  +P+IT+LRN A++ RHW QI+      F +E    TL  +  +   +H E I EVSG A+ E ++E  LK +E  W+S E  ++PH+D  K+ F+L G+DD+   LDD+   +S 
Sbjct:  277 PLFTTELLMEPQALLFYPGLEDFDEGLGEVTKRFQDAVLSVSNLVPDSYFDAFTRPIINGKVEEKTAGEGPSLATMFEDDRHLQGVIQSIRDAISNAFDMAWKYANTFEPYRKFYQENESLDLEAIREGEHDVEFFATSLEKYNSEHEQAVGIMAKKPIGMILADLRKLKEVLIPSPLKCLEVINDILPKLAKKRTDDLMKFCQDAQFELEVVPSSTNDYVKSLTFLDEIQEKIDDIEAESMTIKELYDLIDNYKVPTPPEDLAVYQTLRPTVTAVRNVIDKSLAERDSNIDKFCTCMDKDIVQLGKDVKEVKQKAQDPKILDSSSKSESIIAYLKELQGKMDRLHDTAFTYKSYQKNFKVEVTKFEELEEVHAELRLKQSLWNSLVEWDQSQQDWTETLFEELNPETLSNNVMKYAKTVMQLEKGLPPNS--VVPILKEKLENMRHKLPVITNLRNPALKQRHWDQIQQIFNYHFKDEEP-LTLGLLDKIEAFEHTESIEEVSGQASSEASLEGILKKVEDAWKSTEFIVLPHRDS-KDVFILGGVDDIQAVLDDSMINVST 835          
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 883.634 bits (2282), Expect = 0.000e+0
Identity = 515/1268 (40.62%), Postives = 771/1268 (60.80%), Query Frame = 3
Query: 8151 FERYKQRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLS----EKLGSLFDQTFHNIC-------PNKQSPIFGDYMSS-----TDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQ-AGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSD--EAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQER--IKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNK-KDITEIKSYGKPPALVQKVMEAVMILRGAEPT---------------WAEAKKHLGEQDFIKQLINFDKDNISDRTLKKI-GTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQME-GKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVT--EQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            F R  Q  L   K   + K ++ RL++HE +RV+ DR+V D+D+    +L++    +     FDQ F  +         + Q+ +FGDYM+         Y ++  IE   + +K  L+EYN      +M+LV+F   +EH+S+I RV++QP GN LLVG+GGSGRQS+TRLA  M   T FQ E+SK+Y   E+RDDLK++  + AGV  + T+FL  DTQ+ DE+FLEDI+++L++GE+PNL+  DE  ++   +    +A +  +E +  ++F + + R + N+HVV+  SP+G+ FR R+R FP+ +NC TIDWF  WP +AL  VA  +L+ L++    E +R +  + TI    H S + +S     E+ R+NY+TPT+YLEL++ ++ L+ +KR+ + ++  +  NGL ++    ++V  M  EL + + KL   + +    + VI  +  E + +++ V   +E   +K +EA+ LK +     DLA+A+PALEAA+ AL++L +  DI+ +K+   PP+ V+ VM AV +++  +P                W  +KK LG+ +F++ L  +DKDNI    ++ I   ++   DF P  V   S AA+ LC W+ AMEVY +V +VV PK+ +L  A+  L   +A L   +A+L  V + +  LQ+ + EK E+K  L  + E   + L+RA KL+ GL+GEK  W K   DL+N    L GD LI++  ++Y+GPF S +R+     WT   + + IP++  FS  + L NP +IR WNI GLP D FS++NGVIV R SR PLM+DPQ QA KW+K +E    L VI L   D++R LE  IQFG P+LL+NV E+LDPSL+P+L K   K G  ++ KLG++ IEY+ DFRFY+TT+L NPHY PE++TK  ++NF +  +GLE QLLGIVV KE PELEE++  L++  A  KR+L E+ED IL  L  ++G++L+DE  +  L ++KI S E+T  +Q+QIAEKTE  I  +R+GY   A+ +SILFF + DL  IDPMYQ++L  +++L+  SI +  KS    +R+  L D+ TY +YC  CR LFEK KLLFSF +C  +L    ++   +  F L GG+ L  +N + NP P WL D++WD I    +L  F GL  +F + P D+ L Y S  P +  LP  W     + Q+M+I R LRPD V    T F+  NLG KFV+PP  D+ +   DS++   L+FVLSPG
Sbjct: 1848 FSRVIQGCLLLKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHFNVPFDQVFGQLKQGDKLEEKDMQNLLFGDYMNPDLEGDERLYTEVPSIETFAEVVKSCLEEYNQMHKN-RMNLVIFY-LLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIAQAGKKSVELSPLTLFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFLESLEM---SENERQE--VITICKTFHTSANQLSD-FQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEAKSRVVHVDEEAAAMKANEAQALKSE--CENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPDRIPDPAGTGKKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVPVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGEK-IWSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTKLWTTLCQSKNIPSSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVIV-RNSRRPLMIDPQGQANKWVKNLEKDNNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTFKQGVESI-KLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVAKE-PELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINSI-QDIKSKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLL-ARKEIEHSDLMFLLTGGIGL--QNTVANPDPSWLQDKSWDEICRASELPGFQGL-EAFIKNPEDFKLIYDSREPCSIDLPAPWCEKLTDLQKMIIFRCLRPDMVP-AVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPG 3095          

HSP 2 Score: 860.522 bits (2222), Expect = 0.000e+0
Identity = 501/1272 (39.39%), Postives = 723/1272 (56.84%), Query Frame = 1
Query: 4498 MTSIKLLMTTEIL--YQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVL-----PHLKKCFDNINSLKIEKLMSQGFEAS--------SMFSSDGEEVLFKQKL---RLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEE----LSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELW----FQFCMIWSICCSVDEDGRKKIDNYIREM------EGTFP-----------NKDTIYEYFVDNKNKS-WGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKT-SVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQK-RIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMI--NQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            +  I++++  +I+    M  S FVKPF+ E+ +WE  L HIQE+++       +WL                       K+  QW                      LE   +    ++ I +   ++    RN              EI+G      KVL     P L +   + N+L +EK+M +G  A          M+SS+GE V   Q +      G VE WL  LE  M  ++RD++   R   K A   R++W+KEW GQ+ + +SQI WT +V KAL           L+   ++ +  L +  E +R  L K  R  + +LV I+VH RD+++ L +   SD   FEWL+QLR+YW    D+  +   N   +Y YEYLGNS RLVITPLTDRCY TL  A HL+ GG+P+GPAGTGKTET KDL K+L    +V NCS+GLDY +MG+ F GLA +GAW CFDEFNRI +EVLSVVAQQ+L I  A+       F F+G M+ L P+  + ITMNPGYAGR+ELPDNLK +FR +AM+ P+ A+IAEI+L++ GF   K L+ K+   Y L  +QLS Q HYD+G+RA+ +VL  AG  K   P   ++ +LL S+ D+N  K  S D+PLF GI SDLFPG+  PV DY    EA E+CC    +QPT     K++Q YE    RH  M+VG++ +GK+    +L   L+ +++    + EK +   LNPKS+++G+L+G+FDL ++EWTDGV+++  R+      PD KW++FDGP+DTLWIESMN+V+DDNK L L++GE I M  Q+SL+FE  +LS ASPATVSRCGM+Y + + LGW+P V SW+    D +   +    +  +F   I      ++ +C E++ T+ +++V++LC+LF  +       +P  T      I  W    F   ++WS+    D D R+K +++IR+       E   P            K  +Y+YF + K K  W HW++ ++       +    +IIVPT+DTVRY YL+ +L  +  P++ VGP GTGK+  V    LN L+ D +    IN SA TS+N  Q+II ++++KR K  F P  GKR + F+DD NMPA++ FG+QPP+EL+RQ++D+G  YD LK T K  + D+    AMGPPGGGR  +++R     N+I++   ++  +  IF S++  + K   F  E   +G+ I  A +E+Y   +   LPTP K HY FNLRD S+
Sbjct:  669 LDDIQMMLDDQIVKTQTMMGSPFVKPFQSEMKQWEERLLHIQESID-------EWL-----------------------KLQAQWLY--------------------LEPIFSSQDIMQQIPEEGRLFQTVDRN------------WREIMGHCVKDSKVLQATSLPGLLERLQDSNAL-LEKIM-KGLNAYLEKKRLFFPMYSSEGERVELIQNISTSEANGAVEKWLLQLEDGMISSVRDIIDRSRAYEKTA---RNQWVKEWPGQVVLCTSQIFWTLEVHKALG----------LKKYYQQLQNQLNEIVELVRGELPKQTRTTLGALVTIDVHARDVVKDLIEK-VSDETDFEWLAQLRYYWMN--DNVRVHIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLE-YFDFEGTMLKLNPNCFVSITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADYKLFLEAAEECCKIHNVQPTKVFTDKLIQTYEMMIVRH-FMLVGESFAGKTKVLHVLADTLSLMNERGHGEEEKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREFALAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWINTLPDPLQSPDNRSLILDLFHWLIPPSLQMLRRHCREVVPTTNSHTVVALCRLFKMILD-----EPVKTGPDDESIRTWIMAAFASSLVWSVGGCCDTDSREKFNDFIRQTVSGKNKEHPIPETIERWECPINEKGLVYDYFYEFKEKGRWIHWNDTIENINLGEINTKGQEIIVPTIDTVRYTYLM-DLCISQGPLLFVGPTGTGKSVYVKDKLLNNLDKDCYLPFFINFSAHTSANQTQNIIMSKMDKRRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLDHGH-YD-LKDTSKISLVDVQFIAAMGPPGGGRNAVTSRFLRHLNIISINPFSDDTMVHIFSSIVAFSMKKNLFSPEFVIVGNQIVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSR 1850          

HSP 3 Score: 78.9518 bits (193), Expect = 1.476e-13
Identity = 91/402 (22.64%), Postives = 181/402 (45.02%), Query Frame = 3
Query: 3471 MSEKVSKIPQNLEELGESMRLLD-----KLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEW-QEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLN----LFKIEQPPSKEIAALEKDLDNIENIWKLALEWE----------TNWTQWKSGRFIELKTIEMENLANSSFR---KATKFSRDLKDKNWEIIEYTRNR---------------------------VDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFD-EESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDD 4523
            + +KV  IP+N EE+ +  + +D      + E  N ++E     + H I L +  V  S+DI+L   +    W    L A  ++E++++ S+ K +  L+ + +    Q+  L  + +T   ++     QE    IA+ +++ + L+  E+ I  G+N     +K E     E+ A+++ ++  + +++  L+W+          T   +W  G F++L    ME   +  +R   K  KF +  + K  + +  T  +                           + +F+  +P+++ L N  +R RHW ++       FD   +   +L K++ L  +   E    +S AA+KE ++E A++ M ++W+ V     PHKD   + F  + +DD+   LDD
Sbjct:  291 IKQKVLDIPKNTEEIAQMEKYIDFTKKNIVPELNNEVKEA----NSHIIYLLETHVAKSEDIKL--NSTVYLWPHNILLAFEQSEEVLQSSRQKEEKELIARRERLTVQLEKLEHNIKTFPLYSELGLIQEY---IADVRTTGKRLQEAEENIV-GINKEEAFYKWEITCYPEVKAMKEQMEPYQKVFECILKWQHTESINLTFHTLLKRWMDGSFLDLNGETMETQVDEFYREIYKMLKFFQQKQSKAAQEVAKTYGKAEGQPDEKNSSKQECPTVNLCSIVIEQIQKFKDYIPVVSILCNPGLRGRHWEKMSQ--IAGFDLTPNFGTSLRKLLQLKLEPFLEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDTGVSIF--TALDDIQMMLDD 678          
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 849.351 bits (2193), Expect = 0.000e+0
Identity = 489/1264 (38.69%), Postives = 743/1264 (58.78%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTI-----TKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSA--LAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREME--------------GTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQ-KRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK-EC*EQIKTTMIQKIQ*PDFGFMKISEFLPIVW 8265
            M  SRF  PF   + +WE++L+   ET+E+ L VQ +W+ LENIF GEDI  QLP+E+    KI K++  IM       N + C    G L +   +   LE IQK+L  +L++KRN FPRF+ IS+D+LL +LG S +P  +  H+ K +DNI SL++    S      +M S++GE + F++ + LE  VE W+          L+++ R  R+  K+A      WI+ +   + + ++++ WT +V  A++NV  + DK  L+   ++    +++    +     +  RLKI++++V +VH RDI++        +++ FEW SQLRFYW KE D   ++Q NTS  YGYEY+G +GRL ITPLT R Y+TLT AL ++ GG+  GPAG GKTETVKDL K+LG + +V +C+E +D  ++G++ SGLA+ G WGCFDEFNRI   VLSVV+ QI +I +AL S+    F F+G+ I L   +GI+ITMNP Y  R ELP+++K  FRP+ +VTPD   I EI LF++GF   K LAKK+  LY  +  QLSKQ HYDFGL +  SVL+ AG+ KR +  + ++ +L+ ++ D+NL KL S D+P+F G++SD+FPG+DS  + + + +E +E+      LQ +N+TI      KVVQ+YE   ++ + MIVG+T  GKS     L  A  L   +K           +PLNPK+ S+ ELYG FD  T +WTDG+ S + R+    T   E++I+FDG VD+ W+E+MNSV+DDNK+LTL NG+RI +    +LLFEV +L  ASPATVSRC +V+ D   L + PY + W+K +        L+R+F+KY+    + + +N   ++  +  N V  LC + D L   +N          + V+E +F   +  S+  ++ E GR K D  ++ +               G  P   T+Y++  D   + W  W   L   + +N ++ F  I+ PTVDT R +++++ +V    PV+LVG  GT KT++  N L   + D    LTIN S++T+S ++Q  +EA +EKRTKDT+ P  GK++L F DD NMP  D FG+Q P+ L+R  +D G  YDR ++   K IKD+    AM   GGGR  +  R  S F++ N+  P   +L  I+ S+I    + F+  ++ +   IT+ T++++  ++    PTP+K HY F+ R++S+  C      T+ +    PDF  + + +F+  VW
Sbjct: 1272 MAGSRFGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRNDLERIQKNLANHLDSKRNEFPRFFLISDDELLNVLG-SVDPACIQEHVIKMYDNIESLRLGVDSSGQTVVGAMVSNEGEVMEFRKPVPLEARVEDWIM-------AVLQEMKRTSRLITKEAVYHYVDWIRSYQCMMVLAANRVWWTWEVENAIKNV-NKGDKYALKKYAEQIHRQIDELVTCLGRPTKESDRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWVKEHDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHF-KMFQFEGQQISLDDHMGIYITMNPSYERRPELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAGKMKRDSLELSEDVVLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVEEI-----LQKSNYTILPDQVDKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQAQTLGLCTK----------LYPLNPKATSVDELYGSFDPETRDWTDGIFSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWMKNR--------LNRLFEKYVPSCID-VTLNSETIVPRTDVNMVSQLCLMLDVLLESKNSS--------AEVLECYFLEALYCSLGATLVESGRLKFDKLVKSLSCLSTVDDEKAAAGPGEIPYLPTLYDFHFDETQEKWVPWS-SLVPEYIHNPAMKFADIL-PTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTAIIQNLLKNTSTDSSISLTINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGHTRPFKAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRIYC----GLTLTK----PDFSCLTVEQFVR-VW 2482          

HSP 2 Score: 121.324 bits (303), Expect = 0.000e+0
Identity = 164/803 (20.42%), Postives = 339/803 (42.22%), Query Frame = 3
Query: 2190 IISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAE-LRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKI---DSNRIYENTEFNDSQEAHR----AVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPR------IGEVLQKVKLKKSIWEFISTDD-----EITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMV-TVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEK---DLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPH-KDKEKNHFLLSGIDDLYQTLDDN 4526
            +++Q   ++NF+  L ++  E  Y   L + VP  A  + ++    L +S  + L  V  YN I++ L+     +   QIK   K+I  G  +I       I  F++  +   +  +  +++      DI    + I +  ++K    D +      EF D  E  R    A++      +   II       +  S  +S ++ Y+  +  +V    E+     +  S+   N  + GD     + LF+++  L    +   P   E++ ++    KN IE  K+ PR      I    QKV  +  +  F    D     +I++    +   ++++  S+ +   +W +++ + ++     I ++   NP     D  + +Y E  N+ +  E +  T   + ++   L +S+          L + L   A + L  L +    + EK+ + P   E+L   +  +  + +    ++ +   + E + ++  Y     D++ L   N+ + W        + +Q +K  ++ F    + + + FK+ +S     F T+GP        E L  I  F+  L  +  +++ + +   L  ++     EI +++K    L  I NI+K   E +T W+Q     ++      +++  +       + S+D++     +  +  + + +FR ++ L+ DL+N A+RD HW ++     K FD     FTLE +  L   ++A  I+E+  +A KEL+IE         W+  +  + P  K  ++  FLL  +D++   LD++
Sbjct:  502 VLTQYCKEVNFAPQLKEIMSETRYLVLLGYSVPELAQSVALQEEHFLYVSDLNHL--VSSYNSIMEGLSQTHAIMVAPQIKAAQKEIDFGCKRI------NIADFISRGQKAVSNFETVLNQILKNERDIESKLQSIQTANLLKCPVPDKSNELPIREFCDHLERERVKTVALLSRNYKDIGLTIIMTEHMIMDTNSGKASLMETYYTYWEKRVFNSLEK-----MVLSIQTFNLLLMGD-----TALFQINAILSAPKIELQPKSSEISMLLLQCVKNCIESTKQFPRWMRGTCIECPPQKVVGEDELVTFTFFTDVWQSSQISENAFTVSQNIKNLLFSVDQFFTHWKRYKLLLKMKVATEIERFAKKNPSCAMYDNKL-QYFENLNQEVKQEVLCKTEHIIHVNMMPLVSSLRNIAESRISTLCSFLNKPAKEELFILRDKFMQLQEKMHQRPDTFEDLKSILGTISDIRDMSLDVEIRVADIKERYRMMAMY-----DELELVA-NIGQIWSNLFAESRQVDQSLKDVRETFSKIKMEEMEAFKQDLSIFAESFNTHGPGTVG-NDLEKLNIIGKFEKELSKIMAKQEHLTKTAKLLDLQLAEYPEIISIQKYLSGLSQIYNIYKAHKEAKTKWSQ---TLWVNFDIKLLQDGIDGFIESLMQLSKDVQ--TLPVAFFLDSHLKEFRVSLSLLLDLKNTALRD-HWNKLMERTGKSFDMNLQRFTLETLFSLELHKYANDIDEIVTSALKELSIEMT-------WKRTKFNMQPQLKVNQERVFLLGAVDNILVNLDND 1265          

HSP 3 Score: 612.453 bits (1578), Expect = 3.305e-175
Identity = 389/1225 (31.76%), Postives = 645/1225 (52.65%), Query Frame = 3
Query: 8202 TKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPI-FGDYMSSTD-----TYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIF---SLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGA-EPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVI-KWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQME-GKKLK-VIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKL--ANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            T     R+W +E  R F DR+  + DK      + + +   F+     +  +   PI FGDY ++ +      YEDI D              Y+ +  + Q    LF DA+EH++++ R++R  RG+ LL+G  GS  Q+LT+LAA+  +   F+I + + Y +  FR+DLK LY + G++N+ T+FLF D  +V+E FLE INN+L S  +P L+  DE + +  Q++ EA ++G   + +S++ Y + +   N+H+VLC+S  G+  + R R FP   N T IDW+  W   AL  VA+  L++  +         K H   +     ++H S+ D S+++L + +R NY T  ++L+ +S Y  LL EK +                                      + Q +C   L   + + REA +Q            +DE        L LAD    +    A   A   L + D  +  S+ KPP  VQ V E +++LRG  E  W  AKK + E  F+  L+  D D+IS+  +  I  ++       + +  +S A   +  +V +   Y  + + V+PK+ +++  E    + +A+L   +  L+ + +E   L+++Y +   +KE    +A+  E+ L  A KLV GL  E++ W K + +L+ Q   L GDCLIA+AFLSY G F  D+R  +V  KWT+ +K++ IP +  F    FL+N  +I  W  +GLP D  SV+NG++ T+GSR+PL +DPQ QA  WIK  E    LK V  L+ PDF++ LE++I++G P LLQ+V E +DP +  +L +++V   G TV+ LGDKE+ Y+ +F+ ++ T L NP Y+P +  K  ++N++   +GLE QLL +         ++Q   LV  I+  K  L  L D +L  L  + G++LD+ +L+ TL+ +K  ++E  ++L +A+         R+GY   A+R ++LFF L+D+  ++ MYQ++L +Y+ LF +S+ +S   P   +R+ N+ +  TY V+ Y    LF KHKLLFS  +  KI QT G +   E +F +K    L  +         W+ DQAW +I++L +L    F  L +  EQ   +W  W+   +PE +  P ++  + + FQ++L++R LR DR+      ++   +GN  V PP+++   + + S+A + ++F++S G
Sbjct: 2474 TVEQFVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYFETDSEAVLAD---PILFGDYRAAREECEQRVYEDIGD--------------YDVSKAIFQ----LFEDAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNMLISM-VPTLFADDEKESIIKQINSEALQEGAGSSKESVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFPLMSN-TVIDWYLPWSAQALHAVAQCVLENPTI--------PKAHFGAVIDHICMVHASLCDFSKQLLLKHQRCNYATSKSFLDFISSYSTLLEEKNEH-------------------------------------VLQCKC---LEGSLNRLREAREQ------------IDELN------LKLADQKVVLAKKTATCTAF--LEEIDKNQTISFAKPPKQVQVVCECILVLRGKKELNWLTAKKMMSEAGFLHSLMQMDCDSISNSHISTI-KFLKNLQTSVEEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYEDANLEKELQLDEAKLMERRLTAADKLVLGLTSERE-WTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIPLSQPFKIENFLTNQLEI-SWGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYSTL-RGLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKLSVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLENIINTLTYNVHNY----LFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLIKN---LSGDGTKVQKPHEWIPDQAWQDITKLAELFPEQFSSLPSDIEQNSTNWKSWWDLRAPEQAPFPLQYSESLSAFQKLLLLRCLRADRLHRAMADYVTVTMGN-CVHPPLINFTTIYERSTAFSPIVFIMSSG 3595          

HSP 4 Score: 85.8853 bits (211), Expect = 1.141e-15
Identity = 84/382 (21.99%), Postives = 163/382 (42.67%), Query Frame = 3
Query:  732 LYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKP-----EDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICY------VHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARG-----AEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETI 1829
            L+IP       V+      D +  +E  ++ W  QI  VL  Q + +  E  GPL E+  W+ R   L  +++QL +  V+ I K+L  A +     F     E+     ++ SN ++L T++    +L          E IP+    L+ R++ +W++S HYNS + M  +  +++ ++ +     + +  +F+ Q     K++++ ++  +Q  + + K+ Y      + K   S  W  D+  +F   D     C+D+  +      F   E+      P  +G +G     + V+ ++L  + V  N  R + ++K         +W      F   VKD+E    + I   F    +     +IL  F   ++R+ I
Sbjct:  137 LHIPDLDLEPEVDALITSPDMVENLEQCVMIWQTQITIVLQEQQS-KQPEGPGPLPELTLWERRATVLGALTEQLKQPAVEKILKVLGMANAGIAQTFEGTIIELTNYHLESNSNSRYLKTMERHFLNLQRGAHFSLHLETIPT----LMERLQTMWLSSRHYNSNERMVPLMERIAWQLCENVAQEIHVQTLFEKQ-----KEVKSQVFLAKQVLEKW-KLSYFENRAEIEKLGRSSRWEFDREKLFKMSDYMASVCQDIHNV------FQVLEELYNIFSPELKGMKGINEVISRVDGLVLPFQRVSFNPFR-ISNKK---------TWKTIMEDFSVTVKDIEEEAAHIIDMFFTNTLSSAHAFDILMRFKQNRSRDAI 491          
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 457/1237 (36.94%), Postives = 701/1237 (56.67%), Query Frame = 1
Query: 4531 ILYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNA-RACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAI---RSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNF------IKMNCIELIRTSPTNSVISLC-KLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIRE---MEGTFPN-----KDTIYEYFVDNKNKSWGHWDEKLKAG-WKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQ-KRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKL---QDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            +L  + ++R+  PF+ ++ KW + LS+  + +E  + VQ  W+YLE +F+G DI KQLPKE+  F  I+K W  IMT  +++ N  ++C     + +    +   L+  QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +   +  HL   FDNI S++  + +     A S  S + E +   + +  EG VE WL  L K  + +L  ++R   +A++    +   ++  +S Q+ +   Q+ WT D  +AL N           IM K  +  L   +  I     +L  ++R K  +L+ I VHQRDI + L +    + + FEWL Q RFY+ ++ D   I  T+ SF Y  E+LG + RLVITPLTDRCYITL  AL +  GG+P GPAGTGKTET+KD+G+ LG YV+V NCS+ +D++ +GR+F GLAQ+G+WGCFDEFNRI + VLSV AQQI  +L+             G  +D+ P  GIF+TMNPGYAGR ELP+NLK  FR ++M+ PD  +I  + L + GF     LA K FTLY L  +QLSKQ HYDFGLR ++SVLR  G  KRANP   +  I+   + DMNL+KL   D  LF  ++ DLFPGI+     Y  ++ AI+K      L        KV+Q+YET+  RH +M +G + SGK+T  ++L  A+ E  +          E  +NPK+++  +++G  D+ TN+WTDG+ S++ RKT    + +  WI+ DGPVD +WIE++NSV+DDN+ LTL NG+RI M     ++FE  N+  ASPATVSR GMV+   + LGW P +E WLK++  +   E L ++F     ++  F       KM+ +E         VI  C  +   L  ++  C     ++  R+    + F ++WS    ++ + RKK++ + R    +  + P      ++T+++Y+V  +   W HW  +++   +  + +  +  I+VP VD VR ++L+  +      V+L+G  GT KT +  + +++ + +I     +N S+ T+    Q  +E+ V+KR   T+ P  GK+M   +DD NMP  + +G Q   E++RQ ++   +Y+  K  +   I D+    AM  PGGGR  I  RL+ +F++ N T P+ +++ +IFG +        + F EE++     +   T  ++    IK LPTP K HY+FNLRD+S+
Sbjct: 1088 VLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKIYDRILAVS--SREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRG-----IMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHR-------EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNE-AEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAF-------VIMQCINMLQGLIPLKEQCGELPREHLERL----YIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAEGH-WVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSR 2297          

HSP 2 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 441/1261 (34.97%), Postives = 694/1261 (55.04%), Query Frame = 3
Query: 8151 FERYKQRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSST----------------DTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIE--DTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAK-SVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMIL--RGAEP------------TWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGK-KLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
              R  Q ML TN +  ++ + +  LW HE  RV ADR  +  D   F + L++ +     +    +        F D++                     YE I   E LK  +   L +YN++     MD+V F+DA+ H+ K+ R+IR P GN LLVG+GGSG+QSLTRLA+++  Y  FQI +++ Y      +DLK LY  AG   K   F++ D ++ +ESFLE +NN+LSSGE+ NL+ ++E+D++ + L    KR+      T ++++ Y + RVR N+HVVLC SPVGE FRNR   FPA ++  T+DWFS WP DAL+EV+  +L    +    +   +K  +          V++         +R  +VTP +YL  + GYK + VEKR ++      +  GL K+ E    V  +S ELE   K+L I   E  D ++  V  K EA +  K  V + +++ +         + +A   L  A PALE A  AL+++   DI  +++  +PP L+ + M+ V++L  R   P            +W E+   +    F+ +L  F KD I++ T++ +  Y    ++  +     S     L  W  AM  +  + + V P +  L   E+ L      L  AQA+LDA   E+  ++ EY E M +K  L + A+   + +  AS L+SGLAGEK+RW +   +   Q   L GD L+A+AFLSY GPF  ++R  L+ +W   +K+  IP   +    E L + + + +WN+QGLP D  S+ NG+IVT+ +R+PL++DPQ Q + WIK  E K +L++  L+   F   LE ++  G+P+L+++V E+LDP LD +L K+ +K G    +K+GDKE++    F+ Y+TTKLPNP YTPEIS +T I++F V  +GLE QLLG V+  E+ E+E+++ +L+  +   KRK+ ELED +L  L   QGSL+DDE L+  L  +K T+ EV ++LQIA  T+  I+ AR+ Y   A R SIL+F++ ++  ++ MYQ +L  ++ LF++S+ +S+KS    ERI ++ +Y T+ VY YA RGL+E+HK LF+  +  KI      +   E+   +KGG  LD +     P   W+ D +W N+ EL KL  F  ++     + + W  W+  ++PE   LP  +  + + F+R+L++R   PDR    A  +I + +G K+ E  +LD++   ++S+ +T LI  LS G
Sbjct: 2295 LSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQ---VKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEV------MNTGLQKLKEASESVAALSKELEVKEKELQI-ANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAE-WILDMSWLNLVELSKLWQFSEILDQISHHEKLWKSWFDKEAPEEEVLPNSY-QSLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMG 3543          

HSP 3 Score: 103.219 bits (256), Expect = 7.094e-21
Identity = 115/493 (23.33%), Postives = 219/493 (44.42%), Query Frame = 3
Query:  843 EVLSAQNAFED-TESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKP-EDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSL---DLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRF-RSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHP-SIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAA 2300
            ++LS  N     T+  GP  E+ YWK R    S + +QL    V+ I ++L  AKS  + +++++   I   + +A++N+K++ +L+     L    P   IPS    LIN IR I   S +YN  + +T +F  ++N+++  C   +     D I+D      ++K++  I+  +  K        + +    + ++  +  IF + DAF  R + ++++    + ++  +D             G E       I T F+  + +++++  + LD  AT++  D+ +F +   + LE    + I    E +   Q+ +++L  F  L   +     TD   Q I  K  Q+   V  ++     +  P    +P  AG  +WAR L +RI   M    Q   +  +    +  + + +++  L E  +  H  +M+ +  D    L+ TLL R +   G L +NF   LL    E +   R+   +P +AA
Sbjct:  103 QILSESNQLRKVTDDLGPRAELNYWKKRMSRFSYLLEQLKSPHVRTILRVLGLAKSKLIESWIEIDRRITVASNEAKNNVKYVYSLETFYEPLYKCDPVRKIPS----LINAIRTIHNVSRYYNDSEKITTLFLLVTNQMVSSCKAYITNNGCDSIWDQPRQEIIRKIKAAIHLNQVLKPR-----ELEQAPLERQFDFSEAYIFWKFDAFQSRMEKILKMFNIISTYSVLQDSK---------IEGLET------IATRFKPILMSMKNKSYSFLDHSATNFETDFEQFCKRTSEQLEKFMNDTI----ENIQDTQRALDVLHQFERLGIPDL---GTDTKYQDILLKYGQDIEWV-SDIFEKEKLDPPFERDLPPMAGRIMWARILSRRITDPMNFFQQQPGVLSTQEAKNIIKNFNRMTEILLEYEKLHHHNWMTKVT-DARLGLEATLLVR-LGETGELFVNFDPELLIQIMETNCMARMNLKIPPFAA 561          

HSP 4 Score: 92.0485 bits (227), Expect = 1.487e-17
Identity = 91/439 (20.73%), Postives = 190/439 (43.28%), Query Frame = 3
Query: 3243 NPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKT-IEMENLANSSFRKATKFSRDLKD--KNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSG--IDDLYQTLDDNRNTLSN 4544
            NP +   ++ I  Y ++  K       + V  L L  + LK S+      W             + L  +   +    +K+++  ++L+++  +M  +DK+ +++  I+ +  P++E + +L+KY+     +   K + L   W + +    E +  ++  + KFK  L       +++      D+  +GP    + PQ+   ++  F++  ++L ++      G  LF I      ++  +  +L  ++ ++ L      N  +  +G +  L T I +E + N      T+  R L    K W+     +  +D+F    PL+  + ++AM  RHW +I        D ES +F L  I++ +  ++ E I ++  +A KE  IE  LK +   W++        K+  +   LL G    +L  +L+D+   L +
Sbjct:  660 NPLLSKFESQIVYYQDLETKINSEPDYINVGALALFTASLKTSLTVETMQWMNDYQMCCNKKYQQELEQILAIIDEAGKKLNRPIKDLDDIRIAMAAIDKIRKDQISIELQIGPIEESYAMLNKYKFPVQKEEGEKVETLRLYWDKLMFRSTEVQSELETLQPKFKKELESNMIVLQEECQNFYQDYDKDGPMGVGLAPQDVSDRLIMFQNQFDNLFLKYTTYCDGAKLFGITVTQHPQLMKIRTELTLLQKLYGLY----NNVIETVNGYYDILWTNINIEKINNELLDFQTR-CRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKN--RGELLLRGDSTSELIASLEDSLMVLGS 1091          
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 444/1265 (35.10%), Postives = 696/1265 (55.02%), Query Frame = 3
Query: 8151 FERYKQRMLRTNKDYHDTKNSITR----LWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSST----------------DTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIE--DTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAK-SVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMIL--RGAEP------------TWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGK-KLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
              R  Q ML TN   H ++N I +    LW HE  RV ADR  +  D   F + L++ +     +    +        F D++                     YE I   E LK  +   L +YN++     MD+V F+DA+ H+ K+ R+IR P GN LLVG+GGSG+QSLTRLA+++  Y  FQI +++    +     LK LY  AG   K   F++ D ++ +ESFLE +NN+LSSGE+ NL+ ++E+D++ + L    KR+      T ++++ Y + RVR N+HVVLC SPVGE FRNR   FPA ++  T+DWFS WP DAL+EV+  +L    +    +   +K  +          V++         +R  +VTP +YL  + GYK + VEKR ++   AN++  GL K+ E    V  +S ELE   K+L I   E  D ++  V  K EA +  K  V + +++ +         + +A   L  A PALE A  AL+++   DI  +++  +PP L+ + M+ V++L  R   P            +W E+   +    F+ +L  F KD I++ T++ +  Y    ++  +     S     L  W  AM  +  + + V P +  L   E+ L      L  AQA+LDA   E+  ++ EY E M +K  L + A+   + +  AS L+SGLAGEK+RW +   +   Q   L GD L+A+AFLSY GPF  ++R  L+ +W   +K+  IP   +    E L + + + +WN+QGLP D  S+ NG+IVT+ +R+PL++DPQ Q + WIK  E K +L++  L+   F   LE ++  G+P+L+++V E+LDP LD +L K+ +K G    +K+GDKE++    F+ Y+TTKLPNP YTPEIS +T I++F V  +GLE QLLG V+  E+ E+E+++ +L+  +   KRK+ ELED +L  L   QGSL+DDE L+  L  +K T+ EV ++LQIA  T+  I+ AR+ Y   A R SIL+F++ ++  ++ MYQ +L  ++ LF++S+ +S+KS    ERI ++ +Y T+ VY YA RGL+E+HK LF+  +  KI      +   E+   +KGG  LD +     P   W+ D +W N+ EL KL  F  ++     + + W  W+  ++PE   LP  +  + + F+R+L++R   PDR    A  +I + +G K+ E  +LD++   ++S+ +T LI  LS G
Sbjct:  853 LSRIWQGMLCTN---HSSRNIIFQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQ---VKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQI-ANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAE-WILDMSWLNLVELSKLWQFSEILDQVHHHEKLWKSWFDKEAPEEEVLPNSY-QSLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMG 2108          

HSP 2 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 323/864 (37.38%), Postives = 494/864 (57.18%), Query Frame = 1
Query: 5635 TPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNF------IKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIRE---MEGTFPN-----KDTIYEYFVDNKNKSWGHWDEKLKAG-WKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQ-KRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKL---QDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            T L   CYITL  AL +  GG+P GPAGTGKTET+KD+G+ LG YV+V NCS+ +D++ +GR+F GLAQ+G+WGCFDEFNRI + VLSV AQQI  +L+             G  +D+ P  GIF+TMNPGYAGR ELP+NLK  FR ++M+ PD  +I  + L + GF     LA K FTLY L  +QLSKQ HYDFGLR ++SVLR  G  KRANP   +  I+   + DMNL+KL   D  LF  ++ DLFPGI+     Y  ++ AI+K      L        KV+Q+YET+  RH +M +G + SGK+T  ++L  A+ E  +          E  +NPK+++  +++G  D+ TN+WTDG+ S++ RKT    + +  WI+ DGPVD +WIE++NSV+DDN+ LTL NG+RI M     ++FE  N+  ASPATVSR GMV+   + LGW P +E WLK++  +   E L ++F     ++  F       KM+ +E               +  C+  ++           ++ +E  + F ++WS    ++ + RKK++ + R    +  + P      ++T+++Y+V  +   W HW  +++   +  + +  +  I+VP VD VR ++L+  +      V+L+G  GT KT +  + +++ + +I     +N S+ T+    Q  +E+ V+KR   T+ P  GK+M   +DD NMP  + +G Q   E++RQ ++   +Y+  K  +   I D+    AM  PGGGR  I  RL+ +F++ N T P+ +++ +IFG +        + F EE++     +   T  ++    IK LPTP K HY+FNLRD+S+
Sbjct:   13 TYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHR-------EMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNE-AEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAF------------VIMQCINMLQGLIPLKVRLKLNQHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAEGH-WVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSR 855          
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 436/1231 (35.42%), Postives = 674/1231 (54.75%), Query Frame = 1
Query: 4552 SRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNA-RACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAI---RSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNF------IKMNCIELIRTSPTNSVISLC-KLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIRE---MEGTFPN-----KDTIYEYFVDNKNKSWGHWDEKLKAG-WKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQ-KRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIF----GSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            S +  PF+ ++ KW + LS+  + +E  + VQ  W+YLE +F+G DI KQLPKE+  F  I+K W  IMT  +++ N  ++C     + +    +   L+  QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +   +  HL   FDNI S++  +   +    SS    + E +   + +  EG VE WL  L K  + +L  ++R   +A++    +   ++  +S Q+ +   Q+ WT D  +AL N           IM K  +  L   +  I     +L  ++R K  +L+ I VHQRDI + L +    + + FEWL Q RFY+ ++ D   I  T+ SF Y  E+LG + RLVITPLTD                           ET+KD+G+ LG YV+V NCS+ +D++ +GR+F  LAQ+G+WGCFDEFNRI + VLSV AQQI  +L+             G  +D+ P  GIF+TMNPGYAGR ELP+NLK  FR ++M+ PD  +I  + L + GF     LA K FTLY L  +QLSKQ HYDFGLR ++SVLR  G  KRANP   +  I+   + DMNL+KL   D  LF  ++ DLFPGI+     Y  ++ AI+K      L        KV+Q+YET+  RH +M +G + SGK+T  ++L  A+      RE +        +NPK+++  +++G  D+ TN+WTDG+ S++ RKT    + +  WI+ DGPVD +WIE++NSV+DDN+ LTL NG+RI M     ++FE  N+  ASPATVSR GMV+   + LGW P +E WLK++  +   E L ++F     ++  F       KM+ +E         VI  C  +   L  ++  C     ++  R+    + F ++WS    ++ + RKK++ + R    +  + P      ++T+++Y+V  ++  W HW  +++   +  + +  +  I+VP VD VR ++L+  +      V+L+G  GT KT +  + +++ + +I     +N S+ T+    Q  +E+ V+KR   T+ P  GK+M   +DD NMP  + +G Q   E++RQ ++   +Y+  K  +   I D+    AM  PGGGR  I  RL+ +F++ N T P+ +++ +IF    G    Q+   F EE++     +   T  ++    IK LPTP K HY+FNLRD+S+
Sbjct: 1290 SNYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSL-TYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKYDRILAVSS---REKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRG-----IMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTD---------------------------ETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFK-LAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTCGQPHREMR--------MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLK-AKKEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNE-AEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAF-------VIMQCINMLQGLIPLKEQCGELPREHLERL----YIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAEH--WVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFVIGEGHFCAQR--GFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSR 2458          

HSP 2 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 392/1261 (31.09%), Postives = 622/1261 (49.33%), Query Frame = 3
Query: 8151 FERYKQRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSST---------------DTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIE--DTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAK-SVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMIL--RGAEP------------TWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLI-TSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDR-VSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
              R  Q ML TN +  ++ + +  LW HE  RV ADR  +  D   F + L++ +     +    +        F D++                    YE I   E LK  +   L +YN++     MD+V F+DA+ H+ K+ R+IR P GN LLVG+GGSG+QSLTRLA+++  Y  FQI ++  Y      +DLK LY  AG   K   F++ D ++ +ESFLE +NN+LSSGE+ NL+ ++E+D++ + L    KR+      T ++++ Y + RVR N+HVVLC SPVGE FRNR   FPA ++  T+DWFS WP DAL+E                      H  + F +      D S ++  E+           ++ +  ++  + EK          +  GL K+ E    V  +S ELE   K+L I   E  D ++  V  K EA +  K  V + +++ +         + +A   L  A PALE A  AL+++   DI  +++  +PP L+ + M+ V++L  R   P            +W E+   +    F+ +L  F KD I++ T++ +  Y    ++  +     S     L  W  AM  +  + + V P +  L   E+ L      L  AQA+LDA   E+  ++ EY E M +K  L + A+   + +  AS L+SGLAGEK+RW +   +   Q   L  D L+A+AFLSY GPF  ++R  L+ +W   +K+  IP   +    E L + + + +WN+Q                                            +  L+   F   LE ++  G+P+L+++V E+LDP LD +L K+ +K G    +K+GDKE++    F+ Y+TTKLPNP YTPEIS +T I++F V  +GLE QLLG V+  E+                                     SL+DDE L+  L  +K T+ EV ++LQIA  T+  I+ AR+ Y   A R SIL+F++ ++  ++ MYQ +L  ++ LF++S+  S+KS    ERI ++ +Y T+ VY YA RGL+E+HK LF+  +  KI      +   E+   +KG   LD +     P   W+ D +W N+ EL KL  F  ++      + + W  W+  ++PE   LP  +  + + F+R+L++R   PDR ++  A  +I + +G K+ E  +LD++   ++S+ +T LI  LS G
Sbjct: 2456 LSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTL-YNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVE--------------------SHHFLSAFDI------DCSPQVKSEV-----------VQCMGSFQDCVAEKCVDYF-----MNTGLQKLKEASESVAALSKELEVKEKELQI-ANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLV-DVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQ--------------------------------------------ITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEK------------------------------------RSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRP-ATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSL-ASSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGA-SLDLKTCPQKPAE-WILDMSWLNLVELSKLWQFSEILDQQISHHEKLWKSWFDKEAPEEEVLPNSY-QSLDCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMG 3586          

HSP 3 Score: 67.781 bits (164), Expect = 3.729e-10
Identity = 43/148 (29.05%), Postives = 73/148 (49.32%), Query Frame = 3
Query:  795 INRMEMIMIHWTRQIKEVLSAQNAFED-TESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMF 1235
            + ++E  M  W +QI+ +LS  N     T+  GP  E+ YWK R    S + +QL    V+ I ++L  AKS  +    ++   I   + +A++N+K++ +L+     L    P  I   +  LIN IR I   S +YN  + +T + 
Sbjct:  210 VKKLEACMKGWIQQIELILSESNQLRKVTDDLGPRAELNYWKKRMSRFSYLLEQLKSPHVRTILRVLGLAKSKLIE---EIDRRITVASNEAKNNVKYVYSLETFYEPLYKCDPVAIVKAVPSLINAIRTIHNVSRYYNDSEKITTLL 354          
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Match: SMESG000033128.1 (SMESG000033128.1)

HSP 1 Score: 3076.19 bits (7974), Expect = 0.000e+0
Identity = 1493/1498 (99.67%), Postives = 1493/1498 (99.67%), Query Frame = 3
Query:   51 DNEREIENLEKAEISANFFNKSNLETESLNITVTDEAVEINPNKEEQNEIFYEDDGTAELVMSYEEIPKSTPPDEEKSVIDLIRQRIRLSGYVEIENWTADHALQVQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            DNEREIENLEKAEISANFFNKSNLETESLNITVTDEAVEINPNKEEQNEIFYEDDGTAELVMSYEEIPKSTP DEEKSVIDLIRQRIRLSGYVEIENWTADHALQVQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKR GYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKM QIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGL KILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKT EMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN
Sbjct:    2 DNEREIENLEKAEISANFFNKSNLETESLNITVTDEAVEINPNKEEQNEIFYEDDGTAELVMSYEEIPKSTPSDEEKSVIDLIRQRIRLSGYVEIENWTADHALQVQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRRGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMTQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLTKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTTEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 1499          

HSP 2 Score: 2505.71 bits (6493), Expect = 0.000e+0
Identity = 1221/1222 (99.92%), Postives = 1221/1222 (99.92%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q MLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREKQAQLAAAQAKLDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG
Sbjct: 2760 QGMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREKQAQLAAAQAKLDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 3981          

HSP 3 Score: 2504.17 bits (6489), Expect = 0.000e+0
Identity = 1210/1261 (95.96%), Postives = 1210/1261 (95.96%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEK-------------------------------------------------LMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEK                                                 LMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK
Sbjct: 1497 LSNMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKKVAEQPRVYPSKSSKPIKSSKKAPDRLTTESKKFVQTNVEEDERIRAVKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 2757          
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Match: SMESG000033128.1 (SMESG000033128.1)

HSP 1 Score: 3075.42 bits (7972), Expect = 0.000e+0
Identity = 1493/1498 (99.67%), Postives = 1493/1498 (99.67%), Query Frame = 3
Query:   51 DNEREIENLEKAEISANFFNKSNLETESLNITVTDEAVEINPNKEEQNEIFYEDDGTAELVMSYEEIPKSTPPDEEKSVIDLIRQRIRLSGYVEIENWTADHALQVQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRLGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 4544
            DNEREIENLEKAEISANFFNKSNLETESLNITVTDEAVEINPNKEEQNEIFYEDDGTAELVMSYEEIPKSTP DEEKSVIDLIRQRIRLSGYVEIENWTADHALQVQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKR GYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKM QIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGL KILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKT EMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN
Sbjct:    2 DNEREIENLEKAEISANFFNKSNLETESLNITVTDEAVEINPNKEEQNEIFYEDDGTAELVMSYEEIPKSTPSDEEKSVIDLIRQRIRLSGYVEIENWTADHALQVQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRRGYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDSIKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFINRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGISKQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTLKDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMSNEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHKTYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMPIFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRFRSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDKMTQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRIERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDRDPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYAADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKIQPGLTKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELISSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYEIFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNEPSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVLQKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREIWELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTTEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSN 1499          

HSP 2 Score: 2526.12 bits (6546), Expect = 0.000e+0
Identity = 1210/1212 (99.83%), Postives = 1210/1212 (99.83%), Query Frame = 1
Query: 4534 LYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            L  MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK
Sbjct: 1497 LSNMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 2708          

HSP 3 Score: 2508.41 bits (6500), Expect = 0.000e+0
Identity = 1221/1222 (99.92%), Postives = 1221/1222 (99.92%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q MLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREKQAQLAAAQAKLDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG
Sbjct: 2711 QGMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREKQAQLAAAQAKLDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 3932          
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Match: SMESG000007049.1 (SMESG000007049.1)

HSP 1 Score: 1062.75 bits (2747), Expect = 0.000e+0
Identity = 546/1242 (43.96%), Postives = 778/1242 (62.64%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEAS-------------------SMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELS----KERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKR---KVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPS-DTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM-----EGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLN-NDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            + +SR V P +  VD+W ++L    +T+E  L  QR WLYLE+IF   DI++QLP E+  F  ++K ++ IM ++ ++  A       GLL+TF   N  L+ IQK L+ YLE+KR IFPRFYF+SND+LLEIL Q++NP  V PHL+KCFD I+ L      +   E+S                   +M S +GE+V   + L+  G VE WL  +E+ M + LR LLR           +R++W+K  + Q+ +T  Q+ W  ++T  L++V +   +  +    K  +  L K +  +R  L K+ R  + +L+ + VH RD++ ++ K   SDIN FEW  QLR+YW+  +D+CV++ +N+ + YGYEYLG S RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL KSL    +V NCS+GLDYK MGR FSGLAQ+GAW CFDEFNRI+IEVLSV+AQQ+++I +A A+    +FMF+GR I LV +   FITMNPGYAGRTELPDNLK++FRPIAM+ PD  +IAE+ L++EGF   K LA+K+  +Y L  +QLS+QDHYDFG+RAL SVL  AG+ KR NP  P++ +L+ ++ D NL K    D  LF+ I+ DLFPG++ P  DY   K  IE   +N  LQ     + KV+Q YET   RH VM+VG T  GK+T + +L   L+ L+     E    ++    + LNPKS+++GELYGE +  T EW DG++  ++R TC DT  D +W+I DGPVD LWIE+MN+V+DDNK+L L N ERI +   V +LFEV++LSVASPATVSRCGMVY D  +LGW P+V++WL     K+   +++ L  MF+KYI+    F +  CI+ +       + ++C+L + L       + + D    +  I + F FC +W I  ++ E      DN++R       +   P++  ++  + D  ++    W EK+   +K+N  VPF+++IVPTVDT+R+ YL++ L+     V+  G  G GK+ VA  TLN ++ N  +  + IN SAQTSSN  Q++IE ++EK+ K        KR++ F+DD NMP  DT+GSQPP+EL+RQ+ D+G +YDR K     I+DM L  A GPPGGGR  +S RL   F + ++  P+E +L++IF S++     DF ++++   + I  A +E+YN +    LPTP K HY+FNLRD+SK
Sbjct: 1137 IASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTL--EREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQ-DLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKI-SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLW-EKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSK 2373          

HSP 2 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 517/1260 (41.03%), Postives = 755/1260 (59.92%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMS-----STDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGI-EDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEG-KKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLK--GGVVLDRENQMDNPCPGWLSDQAWDNISEL-DKLANFHGLITSFEQYPRDWNLWYTS----------------------------DSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +L+ +      K+ + +L+ HE  RVF DR++  +DK+ F ++++E     F +        K   IFGD+M          YE +TD  K+K  +   LD++N      +M LV F DAI+HI++I R+IRQ RGN LLVG+GG+G+QSLTRLAA+M  Y  FQIE+ + Y    F  DLK++Y   G++N+ T+FLF DTQ+V E FLEDINNIL+SGE+P+L++ DE + +       AK  G+ E     IF + I+RVR N+H+VLCMSPVG  FR+R RMFP+ VNC TIDWF+ WP +ALL VA+   + +   IG  ED +K  LA + + +H SV+  S+R   E+KRH Y TPT+YLEL++ Y  +L EK+KQL    +++KNGL KI ET   +  M +EL   R +L   QK+ +  +  +   + +AD     V + +   KV   +   + + A  DL +AMPALE A++AL++L+K DI EI+ +  PP +VQ VME+V +L G +  WA AK  LG+  F+K+L ++ KDNI +  LKK+  Y+   +F  + V KVS A +SL +WV AM++Y +  + VEPK++RL+ A   L E   +L   QA+L AV  ++  LQ+ Y+  + +K+ L      T   L RA KL + LA EK+RW ++V+    ++G + GD  + +A ++Y G F S YR  L+  W    ++ +IP +   + +  L +  ++R WN +GLPRD  S EN ++VTRG RWPLM+DPQ QA +WI+  E   +LK+I L   +F+R LE  I+ G P LL+++ E LDP+L+PIL K      G T++ LGD +IEY+ DF+ YITTKL NPHY PEI  K  I+NF V  QGLE QLLG V R ERPELEEQ++NL++ I   K +L   E+ IL+LL E++G++LD E L+NTL  SK+TS E T+++  AE TE  I +AR  Y   A R S+++FV+ ++ +IDPMYQF+L  +  LFN +I  S KS   +ERI  L    T A Y    RGLFEK KL+FSF +C +I++ +G ++  E+ FFL+  GG+   R  +  +P   W+S   W+N+ ++ D +  F  LI    Q   +  +   +                            DS    SL G +D     FQ++++V++   +++  C T F+  NLG +FVEPP  D+  +  D S  + L+FVLS G
Sbjct: 2376 QGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSK-EMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVD--IG--EDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRDKVKEDEAVAKVKAKETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDP---WISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTG 3627          

HSP 3 Score: 101.679 bits (252), Expect = 1.437e-20
Identity = 57/201 (28.36%), Postives = 110/201 (54.73%), Query Frame = 3
Query: 3924 NLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            N+  +EQ   +++  +  +L   + +W    EW++ + +W    F++L   ++        +   +  + L     +++   +++V+Q R  M +IT+L N  +++RHW QI++ I  +F E     TL K+I+LN   + E + E+SG A+ E ++E  LK +E+ W+  E  ++PHKD  K+ F+L G D++ Q  DD+
Sbjct:  933 NILLVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPN--QVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDS-KDVFILGGTDEIQQLWDDS 1130          
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Match: SMESG000007049.1 (SMESG000007049.1)

HSP 1 Score: 1062.37 bits (2746), Expect = 0.000e+0
Identity = 546/1242 (43.96%), Postives = 778/1242 (62.64%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEAS-------------------SMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELS----KERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKR---KVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPS-DTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM-----EGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLN-NDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            + +SR V P +  VD+W ++L    +T+E  L  QR WLYLE+IF   DI++QLP E+  F  ++K ++ IM ++ ++  A       GLL+TF   N  L+ IQK L+ YLE+KR IFPRFYF+SND+LLEIL Q++NP  V PHL+KCFD I+ L      +   E+S                   +M S +GE+V   + L+  G VE WL  +E+ M + LR LLR           +R++W+K  + Q+ +T  Q+ W  ++T  L++V +   +  +    K  +  L K +  +R  L K+ R  + +L+ + VH RD++ ++ K   SDIN FEW  QLR+YW+  +D+CV++ +N+ + YGYEYLG S RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL KSL    +V NCS+GLDYK MGR FSGLAQ+GAW CFDEFNRI+IEVLSV+AQQ+++I +A A+    +FMF+GR I LV +   FITMNPGYAGRTELPDNLK++FRPIAM+ PD  +IAE+ L++EGF   K LA+K+  +Y L  +QLS+QDHYDFG+RAL SVL  AG+ KR NP  P++ +L+ ++ D NL K    D  LF+ I+ DLFPG++ P  DY   K  IE   +N  LQ     + KV+Q YET   RH VM+VG T  GK+T + +L   L+ L+     E    ++    + LNPKS+++GELYGE +  T EW DG++  ++R TC DT  D +W+I DGPVD LWIE+MN+V+DDNK+L L N ERI +   V +LFEV++LSVASPATVSRCGMVY D  +LGW P+V++WL     K+   +++ L  MF+KYI+    F +  CI+ +       + ++C+L + L       + + D    +  I + F FC +W I  ++ E      DN++R       +   P++  ++  + D  ++    W EK+   +K+N  VPF+++IVPTVDT+R+ YL++ L+     V+  G  G GK+ VA  TLN ++ N  +  + IN SAQTSSN  Q++IE ++EK+ K        KR++ F+DD NMP  DT+GSQPP+EL+RQ+ D+G +YDR K     I+DM L  A GPPGGGR  +S RL   F + ++  P+E +L++IF S++     DF ++++   + I  A +E+YN +    LPTP K HY+FNLRD+SK
Sbjct: 1144 IASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTL--EREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQ-DLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKI-SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLW-EKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSK 2380          

HSP 2 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 517/1260 (41.03%), Postives = 755/1260 (59.92%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMS-----STDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGI-EDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEG-KKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLK--GGVVLDRENQMDNPCPGWLSDQAWDNISEL-DKLANFHGLITSFEQYPRDWNLWYTS----------------------------DSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +L+ +      K+ + +L+ HE  RVF DR++  +DK+ F ++++E     F +        K   IFGD+M          YE +TD  K+K  +   LD++N      +M LV F DAI+HI++I R+IRQ RGN LLVG+GG+G+QSLTRLAA+M  Y  FQIE+ + Y    F  DLK++Y   G++N+ T+FLF DTQ+V E FLEDINNIL+SGE+P+L++ DE + +       AK  G+ E     IF + I+RVR N+H+VLCMSPVG  FR+R RMFP+ VNC TIDWF+ WP +ALL VA+   + +   IG  ED +K  LA + + +H SV+  S+R   E+KRH Y TPT+YLEL++ Y  +L EK+KQL    +++KNGL KI ET   +  M +EL   R +L   QK+ +  +  +   + +AD     V + +   KV   +   + + A  DL +AMPALE A++AL++L+K DI EI+ +  PP +VQ VME+V +L G +  WA AK  LG+  F+K+L ++ KDNI +  LKK+  Y+   +F  + V KVS A +SL +WV AM++Y +  + VEPK++RL+ A   L E   +L   QA+L AV  ++  LQ+ Y+  + +K+ L      T   L RA KL + LA EK+RW ++V+    ++G + GD  + +A ++Y G F S YR  L+  W    ++ +IP +   + +  L +  ++R WN +GLPRD  S EN ++VTRG RWPLM+DPQ QA +WI+  E   +LK+I L   +F+R LE  I+ G P LL+++ E LDP+L+PIL K      G T++ LGD +IEY+ DF+ YITTKL NPHY PEI  K  I+NF V  QGLE QLLG V R ERPELEEQ++NL++ I   K +L   E+ IL+LL E++G++LD E L+NTL  SK+TS E T+++  AE TE  I +AR  Y   A R S+++FV+ ++ +IDPMYQF+L  +  LFN +I  S KS   +ERI  L    T A Y    RGLFEK KL+FSF +C +I++ +G ++  E+ FFL+  GG+   R  +  +P   W+S   W+N+ ++ D +  F  LI    Q   +  +   +                            DS    SL G +D     FQ++++V++   +++  C T F+  NLG +FVEPP  D+  +  D S  + L+FVLS G
Sbjct: 2383 QGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSK-EMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVD--IG--EDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRDKVKEDEAVAKVKAKETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDP---WISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTG 3634          

HSP 3 Score: 101.679 bits (252), Expect = 1.462e-20
Identity = 57/201 (28.36%), Postives = 110/201 (54.73%), Query Frame = 3
Query: 3924 NLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            N+  +EQ   +++  +  +L   + +W    EW++ + +W    F++L   ++        +   +  + L     +++   +++V+Q R  M +IT+L N  +++RHW QI++ I  +F E     TL K+I+LN   + E + E+SG A+ E ++E  LK +E+ W+  E  ++PHKD  K+ F+L G D++ Q  DD+
Sbjct:  940 NILLVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPN--QVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDS-KDVFILGGTDEIQQLWDDS 1137          
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Match: SMESG000007049.1 (SMESG000007049.1)

HSP 1 Score: 1061.98 bits (2745), Expect = 0.000e+0
Identity = 546/1242 (43.96%), Postives = 778/1242 (62.64%), Query Frame = 1
Query: 4543 MKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEAS-------------------SMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMPDEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELS----KERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKR---KVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPS-DTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM-----EGTFPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVRYNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLN-NDIWTILTINMSAQTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISK 8169
            + +SR V P +  VD+W ++L    +T+E  L  QR WLYLE+IF   DI++QLP E+  F  ++K ++ IM ++ ++  A       GLL+TF   N  L+ IQK L+ YLE+KR IFPRFYF+SND+LLEIL Q++NP  V PHL+KCFD I+ L      +   E+S                   +M S +GE+V   + L+  G VE WL  +E+ M + LR LLR           +R++W+K  + Q+ +T  Q+ W  ++T  L++V +   +  +    K  +  L K +  +R  L K+ R  + +L+ + VH RD++ ++ K   SDIN FEW  QLR+YW+  +D+CV++ +N+ + YGYEYLG S RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL KSL    +V NCS+GLDYK MGR FSGLAQ+GAW CFDEFNRI+IEVLSV+AQQ+++I +A A+    +FMF+GR I LV +   FITMNPGYAGRTELPDNLK++FRPIAM+ PD  +IAE+ L++EGF   K LA+K+  +Y L  +QLS+QDHYDFG+RAL SVL  AG+ KR NP  P++ +L+ ++ D NL K    D  LF+ I+ DLFPG++ P  DY   K  IE   +N  LQ     + KV+Q YET   RH VM+VG T  GK+T + +L   L+ L+     E    ++    + LNPKS+++GELYGE +  T EW DG++  ++R TC DT  D +W+I DGPVD LWIE+MN+V+DDNK+L L N ERI +   V +LFEV++LSVASPATVSRCGMVY D  +LGW P+V++WL     K+   +++ L  MF+KYI+    F +  CI+ +       + ++C+L + L       + + D    +  I + F FC +W I  ++ E      DN++R       +   P++  ++  + D  ++    W EK+   +K+N  VPF+++IVPTVDT+R+ YL++ L+     V+  G  G GK+ VA  TLN ++ N  +  + IN SAQTSSN  Q++IE ++EK+ K        KR++ F+DD NMP  DT+GSQPP+EL+RQ+ D+G +YDR K     I+DM L  A GPPGGGR  +S RL   F + ++  P+E +L++IF S++     DF ++++   + I  A +E+YN +    LPTP K HY+FNLRD+SK
Sbjct: 1193 IASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTL--EREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQ-DLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKI-SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLW-EKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSK 2429          

HSP 2 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 517/1260 (41.03%), Postives = 755/1260 (59.92%), Query Frame = 3
Query: 8166 QRMLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMS-----STDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGI-EDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREXXXXXXXXXXXXDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEG-KKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLK--GGVVLDRENQMDNPCPGWLSDQAWDNISEL-DKLANFHGLITSFEQYPRDWNLWYTS----------------------------DSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSSAKTCLIFVLSPG 11831
            Q +L+ +      K+ + +L+ HE  RVF DR++  +DK+ F ++++E     F +        K   IFGD+M          YE +TD  K+K  +   LD++N      +M LV F DAI+HI++I R+IRQ RGN LLVG+GG+G+QSLTRLAA+M  Y  FQIE+ + Y    F  DLK++Y   G++N+ T+FLF DTQ+V E FLEDINNIL+SGE+P+L++ DE + +       AK  G+ E     IF + I+RVR N+H+VLCMSPVG  FR+R RMFP+ VNC TIDWF+ WP +ALL VA+   + +   IG  ED +K  LA + + +H SV+  S+R   E+KRH Y TPT+YLEL++ Y  +L EK+KQL    +++KNGL KI ET   +  M +EL   R +L   QK+ +  +  +   + +AD     V + +   KV   +   + + A  DL +AMPALE A++AL++L+K DI EI+ +  PP +VQ VME+V +L G +  WA AK  LG+  F+K+L ++ KDNI +  LKK+  Y+   +F  + V KVS A +SL +WV AM++Y +  + VEPK++RL+ A   L E   +L   QA+L AV  ++  LQ+ Y+  + +K+ L      T   L RA KL + LA EK+RW ++V+    ++G + GD  + +A ++Y G F S YR  L+  W    ++ +IP +   + +  L +  ++R WN +GLPRD  S EN ++VTRG RWPLM+DPQ QA +WI+  E   +LK+I L   +F+R LE  I+ G P LL+++ E LDP+L+PIL K      G T++ LGD +IEY+ DF+ YITTKL NPHY PEI  K  I+NF V  QGLE QLLG V R ERPELEEQ++NL++ I   K +L   E+ IL+LL E++G++LD E L+NTL  SK+TS E T+++  AE TE  I +AR  Y   A R S+++FV+ ++ +IDPMYQF+L  +  LFN +I  S KS   +ERI  L    T A Y    RGLFEK KL+FSF +C +I++ +G ++  E+ FFL+  GG+   R  +  +P   W+S   W+N+ ++ D +  F  LI    Q   +  +   +                            DS    SL G +D     FQ++++V++   +++  C T F+  NLG +FVEPP  D+  +  D S  + L+FVLS G
Sbjct: 2432 QGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSK-EMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVD--IG--EDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRDKVKEDEAVAKVKAKETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDP---WISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTG 3683          

HSP 3 Score: 101.679 bits (252), Expect = 1.270e-20
Identity = 57/201 (28.36%), Postives = 110/201 (54.73%), Query Frame = 3
Query: 3924 NLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDN 4526
            N+  +EQ   +++  +  +L   + +W    EW++ + +W    F++L   ++        +   +  + L     +++   +++V+Q R  M +IT+L N  +++RHW QI++ I  +F E     TL K+I+LN   + E + E+SG A+ E ++E  LK +E+ W+  E  ++PHKD  K+ F+L G D++ Q  DD+
Sbjct:  989 NILLVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPN--QVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDS-KDVFILGGTDEIQQLWDDS 1186          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH21.119e-8069.69dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
DNAH21.119e-8069.69dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
DNAH20.000e+068.39dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
DNAH64.957e-1643.79dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
DNAH15.966e-1843.71dynein axonemal heavy chain 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhc-13.143e-16138.72Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-13.143e-16138.72Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-13.119e-16138.72Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-32.286e-16432.76Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-38.122e-3927.86Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kl-20.000e+057.41gene:FBgn0001313 transcript:FBtr0346722[more]
Dhc93AB0.000e+041.14gene:FBgn0013812 transcript:FBtr0273236[more]
Dhc93AB0.000e+041.14gene:FBgn0013812 transcript:FBtr0336774[more]
Dhc98D0.000e+041.16gene:FBgn0013813 transcript:FBtr0301303[more]
Dhc98D0.000e+041.16gene:FBgn0013813 transcript:FBtr0301302[more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah20.000e+069.50dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
dnah22.735e-7369.50dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
AL807739.18.674e-1843.02dynein, axonemal, heavy chain 6 [Source:NCBI gene;... [more]
dnah68.821e-1842.94dynein, axonemal, heavy chain 6 [Source:ZFIN;Acc:Z... [more]
dnah68.556e-1842.53dynein, axonemal, heavy chain 6 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH21.791e-8067.77dynein, axonemal, heavy chain 2 [Source:NCBI gene;... [more]
asxl23.210e-2244.04ASXL transcriptional regulator 2 [Source:Xenbase;A... [more]
plekhg36.937e-1743.86pleckstrin homology and RhoGEF domain containing G... [more]
plekhg36.486e-1743.78pleckstrin homology and RhoGEF domain containing G... [more]
ttc21a0.000e+042.12tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah21.295e-7870.18dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
Dnah21.263e-7870.59dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
Dnah62.091e-1743.63dynein, axonemal, heavy chain 6 [Source:MGI Symbol... [more]
Dnah62.091e-1743.63dynein, axonemal, heavy chain 6 [Source:MGI Symbol... [more]
Dnah12.620e-2143.79dynein, axonemal, heavy chain 1 [Source:MGI Symbol... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0C6F1|DYH2_MOUSE9.056e-7870.18Dynein heavy chain 2, axonemal OS=Mus musculus OX=... [more]
sp|Q9P225|DYH2_HUMAN5.373e-8069.69Dynein heavy chain 2, axonemal OS=Homo sapiens OX=... [more]
sp|Q9MBF8|DYH1B_CHLRE0.000e+051.46Dynein-1-beta heavy chain, flagellar inner arm I1 ... [more]
sp|Q9C0G6|DYH6_HUMAN2.380e-1543.79Dynein heavy chain 6, axonemal OS=Homo sapiens OX=... [more]
sp|E9Q8T7|DYH1_MOUSE1.832e-2043.79Dynein heavy chain 1, axonemal OS=Mus musculus OX=... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8WJ220.000e+074.47ATPase family protein OS=Opisthorchis viverrini OX... [more]
A0A074ZWJ97.007e-5874.47Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A4Z2CU400.000e+074.65Dynein heavy chain 2, axonemal OS=Schistosoma japo... [more]
A0A4S2LRP62.728e-5773.98Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LRQ00.000e+073.98Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah21.109e-7870.05dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
dnah126.417e-1342.62dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
si:dkeyp-86b9.12.941e-1742.05dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
ENSAMXT00000016172.21.821e-2839.25pep primary_assembly:Astyanax_mexicanus-2.0:4:1379... [more]
dnah9l0.000e+039.90dynein, axonemal, heavy polypeptide 9 like [Source... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH61.359e-1742.80dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
ENSPMAT00000003955.17.627e-1242.02pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 g... [more]
ENSPMAT00000003959.18.402e-1141.89pep scaffold:Pmarinus_7.0:GL495754:4357:49943:-1 g... [more]
ENSPMAT00000001140.17.741e-1340.54pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 ge... [more]
ENSPMAT00000006497.19.561e-3237.50pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 ge... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN10.000e+029.70Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO340775.603e-7571.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358520.000e+043.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458060.000e+042.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379611.684e-17841.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318007.767e-6642.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah121.476e-1340.62dynein axonemal heavy chain 12 [Source:NCBI gene;A... [more]
si:dkeyp-86b9.13.305e-17538.69dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
dnah57.094e-2136.94dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah50.000e+035.10dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah53.729e-1035.42dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033128.10.000e+099.67SMESG000033128.1[more]
SMESG000033128.10.000e+099.67SMESG000033128.1[more]
SMESG000007049.11.437e-2043.96SMESG000007049.1[more]
SMESG000007049.11.462e-2043.96SMESG000007049.1[more]
SMESG000007049.11.270e-2043.96SMESG000007049.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007055 ID=SMED30007055|Name=Dynein heavy chain axonemal|organism=Schmidtea mediterranea sexual|type=transcript|length=11831bp
GTTTATTCTGACTGTTAATGCTATTCATAATTTTAGAATAATTTTTAATG
GACAACGAACGTGAAATAGAGAATTTAGAAAAGGCTGAAATAAGTGCGAA
TTTCTTTAACAAATCAAATTTAGAAACTGAATCATTAAATATAACAGTTA
CTGATGAAGCAGTAGAAATTAACCCAAACAAAGAAGAACAAAATGAAATA
TTTTATGAAGATGATGGAACTGCTGAGTTAGTCATGTCATATGAAGAAAT
TCCAAAATCCACTCCACCAGACGAAGAGAAATCTGTTATAGACCTTATTC
GTCAAAGAATAAGACTAAGTGGTTATGTAGAAATTGAAAACTGGACAGCA
GATCATGCTTTACAAGTCCAGGATGAATTTGTGACATCTAATAATGAGTT
ATTAGTGGCTTACATGCACTCAAAAAATGGATTGCAGTTAGATACCATTT
TTCCTACAGGTCGAGTTAATGAATTAGTATATTTTATCAAACGCCTGGGT
TATGATTTTGAAATTATTAATGCAGAAAATTTTCATGACTTTATCCAGCA
CGGCACAGTTTGTGGACGAGGAATCGACAGTTTATTACGAATTATGATGG
GTATATATGCGCCTTCTTATTTTTCCAATACAATGTGGCCAGATAGTATT
AAAAATGATTTTTCATTACAACTGCAACGTTTTATGTCAGCTCTTACGGA
TGCAAGGTGGAAATTAGAAGGGAAAACTGTTCTTTATATTCCAGCAGAAG
CCGCATTGTATTCAGTTGAAAATGGAGCAAAAGAAAAAGATTTTATTAAT
CGAATGGAAATGATAATGATCCATTGGACCAGACAAATTAAAGAAGTGTT
AAGTGCACAAAATGCATTTGAAGATACAGAAAGCTCAGGTCCTTTAGATG
AAATTGAATATTGGAAAAATAGATGCGATGATCTTTCTGGCATAAGCAAA
CAACTTGATAAAACTGGAGTGAAACATATCACTAAAATTCTAGAAACTGC
GAAATCTTCATATGTCGGAGCTTTTCTTAAATTAGCTTCAGAAATAAAAT
TTAACACCCAACAAGCTCAGAGTAATTTAAAATTTCTTAATACATTGAAG
GATATGTGTCATGATTTATCGGATTCAAAACCGGAAGACATTCCATCAAT
GTTGTCGAAGTTAATTAATCGAATTCGAATGATATGGGTGAATTCCGAGC
ACTATAATAGTCGGGATGCTATGACAGGGATGTTCAGAAAGATGTCGAAT
GAAATTATTAAACGATGCTGTCTGTCATTGGACCTTGATGAGATCTTTGA
TGGACAGATTGTTTCGAGTATGAAAAAACTTCAGAATTGTATCTATTGTT
GCGAGCAATACAAAGACATCTATGACAAGATTTGTTACGTTCATAAAACA
TATTCAAGTAAACCGTGGAATCTTGATAAAACTAACATATTTGCTCAAAT
TGATGCTTTCATTCAACGATGTAAAGATTTAATTGAAATTTGCGAATGTC
AAGCTCATTTTGCGAGATTTGAAGATGGAAATAAAAAAGAAATGCCAATT
TTCCAAGGAGCTCGTGGAGCCGAAGTAGAAATGATAATTTTGCAAATTGA
GACTGTTTTTGAAAACAATATTCGTGCATTACGAGATCGAAAATCAACAA
TTCTCGACGTGAAAGCCACGTCATGGCATGATGACTACAATCGATTTAGA
AGCGGTGTTAAGGATTTAGAGGTTATGACTCAAAATGCGATAACAACAGC
ATTTGAGACAGTAACAACTATTCAACAAGGAATTGAGATACTTGATGTCT
TCGCGCATCTTCAAAATAGAGAGACAATCCGAAGAACAACTGATAAAATG
ATTCAAATAATTTGCAATAAGTTAATGCAAGAATTTAATCTTGTTAAAAA
AGAACTGGCATTATCCACAAGTATTGGTCTTCCTCATCCTTCAATCCCAA
AATATGCAGGCATTGCCATTTGGGCAAGAACTTTGCGAAAGCGAATTGAA
CGTCAAATGCTAAATTTAGATCAAGCTTTTTTTTTACCAATTTCTTCTTC
AAATGCTGATTTTCGGCAGCAATACACCCAATTATCAGTAGCTTTAGAAG
AAGTAGTTCGCAAGACACATATCGAATTTATGAGTGGATTAGACAGAGAT
CCATTAAAGTCATTAGATGTTACTCTCTTGTCTCGAAGCATTATAAGTCA
AGGAATGCTTGATATTAATTTTTCAAGAGCTTTGTTAAAACTTTTTCAAG
AATTGCATTATTGGGAAAGGTTACAATTCGATGTACCACATTATGCTGCT
GATATTTATATTCGTCGTGCCGAATTAAGAATATCAAGAGAAAGTGTTTT
GTTAGTTGTTCGAGATTACAATAGAATTTTACAAACTTTAAATGCTGAAG
AACGATCGTTATTCAAAGAGCAAATTAAAACTCTTGATAAAAAAATTCAA
CCTGGGCTCATAAAAATTTTATGGTCTTCGAAAGGAGCAATTGAGTATTT
TGTTAATGATTGCCGAATAAATGCAGCAAGATTACAAAAAAAAGTCGATG
AATACAAAACAGCAAATGACGATATAAGAAAATATTGTGAATTAATTTCC
TCCATGTTGATGATAAAAATAGATTCGAACCGTATTTATGAAAACACGGA
ATTCAATGATTCACAAGAGGCTCATCGAGCAGTAGTGAAGGAAAAATTAG
TTGGTCTTCATGGTGAAATCATTAACCAAATGCGTGAAACATATGAAATA
TTTTCCAAGGATAGTTCAGATATTCAACAATATTGGAATTTATATATGAA
TAAAGTTGACAAATTCTGCGAAGAAGCATTTAGACTTAATGTTAAATACT
CATTAAATGAATTAAATAAAGCAATCAACGGAGATGGCCGAAATGAGCCA
AGTCCTCTTTTTAAAGTATCACTTAATCTTCAAATGAGAGATCTTGTATT
TATTCCAACTTTACCTGAATTAACGAATATTGTAACATCCCTGGGTAAAA
ATTTTATTGAAGTCGTCAAAGAAATTCCCAGAATCGGTGAAGTTTTACAA
AAAGTTAAATTAAAAAAGTCAATATGGGAATTCATATCAACAGATGATGA
GATTACAAAAATACAAACAAATATTAGACATGGAATGCAGGATATCAGTT
CATCTATTCAAGAGCCATTAGGTTATTGGGATCAGTTTAGAGAAATTTGG
GAATTGAACAAAGAGGAATTTATAAGTCAATATTGTGATTTAAATCCACA
TGTTTACTCAATTGATGCTGATATCAGTCGATATACCGAAGTTACAAATA
AAGCTCTGGATGCTGAAGCTATGGTGACGGTTAAATTTCTTCAATTAGAT
TTTTCAATGTTAAAAAATAGCATTGCTGCTCACTGTCGGGATTGGCAGCA
AAAGCTGACCAATCTACTTCTAGCAATGGCAACAAAATCTCTAATGTATT
TGCATAACTATATGAAGAATATGTCGGAAAAAGTTTCCAAAATACCTCAA
AATTTAGAAGAACTAGGAGAATCTATGAGATTATTAGATAAATTGAATGA
AGAAAGGAATCATATTCAAGAAAAGTTTCATCCACTAGATGAACATTTTA
TTATTCTTGATAAATATGAAGTTCAGTACAGTGACGATATTCGTCTTAAG
AAACAAAATCTTGAAAAGGAATGGCAGGAATTTCTGCAAGCATTAGTGGA
GGCTGAACAAATGATCAAGAAGTCTAAAGACAAGTTTAAAACTGGTTTGT
TGGTTCAATCAGATGATTTCAAGAAGCAAGTTTCTGCTCTCATTATGGAT
TTCCAGACAAATGGCCCATTTGCTGCAAGTATCCCTCCACAAGAAGCTTT
AGCTAAAATTGCGAATTTTAAGTCTTCTTTGGAATCATTAAAAATTCAAG
AACAAGAAATTAGACGTGGACTAAATTTATTTAAAATTGAACAACCACCA
TCAAAGGAAATCGCAGCTTTAGAAAAAGACTTAGACAATATTGAAAATAT
TTGGAAATTAGCTCTTGAATGGGAAACAAATTGGACTCAGTGGAAATCGG
GTCGATTTATTGAATTAAAGACAATAGAAATGGAAAATCTTGCGAATAGT
TCATTCAGAAAAGCAACAAAATTTTCTCGGGATCTCAAAGATAAAAATTG
GGAAATTATCGAATATACAAGAAATAGGGTCGATCAATTCAGACGAACAA
TGCCTTTGATAACTGACTTACGAAATGAAGCTATGCGAGACAGACACTGG
TTTCAAATTAAAAACGAAATCCGCAAACAATTCGATGAGGAATCTTCTGA
TTTTACATTAGAGAAAATTATTGATTTGAATTTCGATCAACATGCAGAAA
TGATAAATGAAGTAAGCGGAGCAGCTACAAAAGAGTTGGCTATAGAAAAT
GCCTTGAAAGGAATGGAAAAATTATGGGAAAGTGTAGAACTCGAAATAAT
ACCCCATAAAGATAAAGAAAAGAATCACTTTCTTCTTTCTGGAATAGATG
ACCTCTATCAAACTCTTGATGACAACCGAAATACTTTATCAAATGAAGAC
ATCTCGATTTGTCAAACCGTTTGAGCATGAAGTAGATAAATGGGAAAGAG
ATTTGTCACATATCCAAGAAACAGTTGAAATGCTATTGACTGTTCAAAGA
CAATGGTTGTATCTGGAAAACATATTTCTAGGAGAAGATATTCGGAAACA
ACTTCCAAAAGAATCAGCAGATTTTGATAAAATCAATAAACAATGGAGAG
TAATTATGACAGAATTAAATCAAATTAGAAATGCCCGTGCATGTGGAAAA
AAAGAAGGCCTATTAGAAACGTTTAATGCTATGAATACTTGTCTAGAAGA
TATTCAGAAATCTCTTGACATGTATTTAGAAACAAAGAGAAATATTTTCC
CTAGATTTTATTTTATTTCCAACGATGATTTACTAGAAATATTGGGCCAA
AGCAAAAATCCAGATAAAGTTTTACCGCATTTGAAAAAATGTTTCGACAA
TATCAATTCATTGAAAATTGAAAAGCTAATGTCACAGGGTTTCGAGGCCA
GTTCCATGTTTTCCAGTGACGGTGAAGAAGTCTTGTTTAAACAAAAATTA
CGACTTGAAGGACCTGTTGAAGCTTGGTTATGTGATTTAGAAAAATGTAT
GCGAGTTACTTTACGAGATTTACTTCGTGACTGTCGAATCGCACTTAAAA
AAGCAGCTTCTAAACGTGACAAGTGGATCAAAGAATGGTCAGGACAATTG
TGCATCACTTCAAGTCAAATACAATGGACAGCAGATGTCACAAAAGCTCT
TCAAAACGTGGCTCAACGAAACGATAAAAAGCCGTTACGTATAATGAAAA
AAAAGCAAAAATTAGTATTAGAGAAATTTTCAGAAGCTATTCGTAGTAAT
CTCACAAAAATTCAAAGATTGAAAATTAATTCATTGGTTGTAATTGAAGT
TCATCAAAGAGATATTATTGAAAAACTTTATAAGAGTGGATGTAGCGATA
TAAATGCATTTGAATGGTTGAGCCAGTTAAGATTTTATTGGGAAAAGGAA
ATCGACGATTGTGTAATAAAACAAACAAACACAAGTTTCCAATATGGCTA
TGAATATTTAGGAAACTCCGGACGTTTAGTTATTACGCCACTAACAGATA
GATGCTACATAACCTTAACAACAGCACTTCATCTTCATCGCGGTGGTTCA
CCTAAAGGTCCTGCCGGAACGGGAAAGACTGAAACAGTCAAAGATTTGGG
AAAATCTCTTGGTGCGTACGTTATAGTTGTTAATTGTTCTGAAGGCCTTG
ATTATAAGTCCATGGGAAGAATGTTTTCAGGACTTGCTCAAACTGGAGCT
TGGGGATGTTTTGATGAATTCAATAGAATAAATATAGAAGTTTTGTCAGT
TGTTGCTCAACAAATTTTAAGTATTTTATCTGCTTTGGCCAGCAACGCAC
CACCTAAATTCATGTTTCAAGGCAGAATGATTGATTTGGTACCAAGTGTT
GGAATTTTCATTACTATGAATCCGGGTTATGCAGGAAGAACAGAATTGCC
CGATAATTTAAAGTCAATGTTTAGACCAATAGCTATGGTGACACCAGATT
CAGCTATGATTGCTGAAATAACACTATTTGCTGAAGGTTTTAGTGGCTGC
AAAGTATTAGCAAAAAAAGTATTTACTCTCTATAGTTTGAGTATTCAACA
ACTGAGCAAACAAGACCATTATGATTTTGGACTACGAGCTTTGGTGTCTG
TTTTACGTTATGCCGGCCGTAAAAAACGAGCAAACCCTCTAATGCCTGAT
GAAGAAATTCTTCTTTTATCAATGAACGATATGAACTTGGCCAAATTGAC
GTCAGTTGATTTGCCATTGTTCAAAGGAATCGTTTCTGATTTATTTCCTG
GAATCGATTCTCCTGTTATGGATTATACAAATATGAAAGAAGCAATTGAG
AAATGTTGTGACAATTTCCAGTTACAACCGACTAACTTCACAATTACCAA
GGTCGTACAGCTTTATGAAACAAAGACATCCAGGCATTCGGTGATGATCG
TTGGAAAAACATTATCTGGCAAATCTACTACTTGGCGATTATTACAAAGT
GCGTTAGCAGAATTATCAAAGGAAAGAGAATCACAATTCGAAAAAGCTCT
AGAGTTCCCATTAAATCCAAAATCTGTTTCTCTTGGTGAATTATATGGTG
AATTTGACTTGAATACAAATGAATGGACAGATGGAGTTTTGTCGTCAGTA
ATGAGAAAAACATGTGCAGATACAAGACCCGATGAAAAGTGGATAATATT
TGATGGACCAGTAGATACGCTATGGATTGAAAGCATGAACAGTGTCATGG
ATGATAACAAAATTCTCACTTTGATTAATGGAGAACGGATATCCATGCCT
GAACAAGTTTCTCTACTTTTTGAAGTCGAAAACTTGTCAGTAGCATCTCC
TGCAACAGTTTCTCGGTGTGGAATGGTTTATAATGATGTTAATGATTTAG
GATGGAGACCTTATGTAGAATCGTGGCTTAAACGAAAAGTTGATAGTGTT
TTAGTGGAAGAACTGAGTCGAATGTTTGATAAATATATTGAAAAAATTCA
GAATTTTATCAAAATGAATTGCATTGAATTGATTCGTACTTCCCCAACAA
ATAGCGTTATATCGCTGTGTAAATTATTCGATTGTCTTGCCACAGTTGAA
AATGGGTGCGATCCATCTGATACTGACAATTATTCACGAGTCATTGAGTT
ATGGTTTCAATTTTGTATGATATGGTCTATTTGTTGTTCTGTCGATGAAG
ATGGTAGGAAAAAGATTGACAATTACATCAGAGAAATGGAAGGGACTTTT
CCTAATAAGGACACGATTTATGAATATTTTGTTGATAATAAAAACAAAAG
TTGGGGTCATTGGGATGAAAAGTTGAAGGCTGGGTGGAAATACAATGCGA
GTGTTCCATTTTACAAGATTATAGTACCAACTGTGGATACAGTTAGATAT
AATTATCTGGTGCAAAATTTGGTTTGCAATTTTCATCCAGTTATGCTCGT
TGGTCCAGTTGGAACTGGTAAAACATCAGTTGCTGTAAATACATTAAACC
AATTGAATAACGACATTTGGACTATTCTCACAATAAATATGTCAGCGCAG
ACATCGTCAAATAACGTTCAAGATATCATCGAGGCGAGAGTAGAAAAACG
AACAAAAGACACATTTGTACCAGTTGGAGGCAAAAGAATGCTGACTTTCA
TGGATGATTTTAACATGCCAGCTAAAGATACATTCGGTTCCCAGCCACCT
CTGGAATTGATTAGGCAATGGATCGATTATGGGTTTTGGTATGATCGTTT
AAAGCAAACACAAAAACGAATTAAAGATATGTATTTGTTTGTTGCCATGG
GCCCACCTGGAGGAGGTAGAATGATGATTTCGAATCGTTTGCAATCTCGA
TTTAATTTGATCAATATGACTTTCCCAACTGAATCTAATTTGAAACGAAT
ATTTGGTAGTATGATCAATCAGAAACTTCAAGATTTTGAAGAAGAATTAA
AACCAATTGGGGACATTATTACTCAAGCCACGATTGAAATGTATAATGGA
GTTGTAATAAAATTTTTGCCGACGCCAACGAAAATACATTATTTGTTTAA
TTTGAGAGATATAAGCAAAGAATGTTAAGAACAAATAAAGACTACCATGA
TACAAAAAATTCAATAACCAGACTTTGGATTCATGAAAATTTCCGAGTTT
TTGCCGATCGTATGGTAATAGACAAAGATAAAGTTGCATTTGTTGAATTG
TTAAGTGAGAAACTAGGATCATTATTTGATCAAACGTTTCATAATATTTG
TCCTAATAAACAAAGTCCCATTTTTGGTGATTACATGAGCTCAACAGACA
CATATGAAGACATTACAGATATTGAAAAGCTTAAAAAATTCATGAAAGAA
ATGCTTGATGAATATAATAATACTCCTGGAGTTGTTCAAATGGATTTGGT
TCTTTTTCGAGATGCAATTGAACATATTAGTAAAATAATTCGAGTAATCC
GTCAACCCCGAGGAAATATGCTTTTAGTTGGTATAGGAGGAAGTGGACGT
CAGAGCCTTACCAGGCTTGCAGCTTATATGTGTGAATATACATCCTTTCA
AATTGAAGTATCTAAACATTATCGGAAGCAAGAGTTTCGAGACGATTTAA
AACGACTTTATTGGCAAGCCGGAGTGGATAATAAACCAACTCTTTTCTTG
TTTAATGATACGCAAGTTGTTGACGAAAGTTTCTTAGAAGATATTAATAA
TATACTAAGTTCTGGTGAAATTCCAAATCTTTATAAACAAGATGAAATTG
ATGATCTACGAAATCAGTTATCTGATGAAGCGAAACGTGACGGAATAGAA
GACACGACTCAATCAATATTTACTTATCTAATTGATCGAGTTCGAGGCAA
TATGCATGTAGTTTTGTGTATGAGTCCAGTCGGTGAACCTTTCAGAAATA
GAATTCGAATGTTTCCAGCGTTTGTAAATTGTACAACAATCGATTGGTTT
AGTGAATGGCCACTCGATGCTCTTCTGGAAGTTGCTGAAAGATATTTAAA
AGATTTACAATTATTTATTGGAGGAGAAGAAGATCGAATGAAACCCCACC
TGGCAACGATATTTTCTCTAATGCATCGATCGGTTTCAGATATGTCACAA
AGAATGTTAGATGAAATGAAAAGACATAACTATGTTACTCCGACAAATTA
TCTGGAATTGGTATCAGGATACAAAATACTTTTGGTGGAAAAAAGGAAGC
AGCTCAGTGATTCGGCAAATAAATTAAAAAATGGTCTTGGTAAAATTGAT
GAAACTCGCGCTAAAGTTGAAGTAATGTCCATTGAATTAGAAGAAGCTCG
AAAGAAGCTGGCAATTTTTCAGAAAGAATGTGATGATTATCTTGTGGTAA
TTGTTCAACAGAAAAGAGAAGCTGATGATCAGGCCAAATCTGTCATGCAA
ACTCAAGAACGTATTAAGGTTGATGAGGCTAAATGTTTGAAAATGCAAGA
ATTAGCTCTTGCAGATTTGGCTCAAGCTATGCCTGCATTAGAAGCTGCTA
TGCAAGCTCTGGAATCTTTGAATAAAAAGGATATAACAGAAATAAAGTCA
TACGGTAAACCACCAGCATTAGTTCAAAAAGTAATGGAAGCAGTCATGAT
TCTCAGAGGAGCTGAACCGACATGGGCTGAAGCTAAAAAGCATCTTGGTG
AACAGGATTTTATTAAGCAGCTTATCAATTTTGATAAGGATAATATTTCT
GATCGAACTCTAAAAAAAATAGGAACTTATGTTGCTCAGGATGATTTTCA
ACCCGACATGGTTGGTAAAGTTTCTTTAGCTGCTAAATCTTTGTGTATGT
GGGTCGGAGCTATGGAAGTTTATGGTAGAGTTTACAGAGTAGTAGAGCCT
AAAAGGCAGCGTTTACAAGCAGCTGAATCAGTTTTAAGAGAAAAGCAAGC
TCAACTAGCAGCGGCACAAGCTAAATTGGATGCAGTAATGGAAGAGATGA
AACGACTTCAACAGGAATATAATGAAAAGATGGAACAAAAAGAAGAATTA
CGAAAAAAAGCAGAGCATACAGAAAAAATGTTAGATCGGGCTAGTAAATT
AGTTAGTGGACTTGCTGGTGAAAAAGATAGATGGGAGAAAACCGTTGCTG
ATTTAGAAAACCAAATTGGTCTTCTACCTGGTGATTGTTTGATAGCCTCA
GCTTTCTTATCATATATGGGCCCATTTTTAAGTGATTACAGAGAAGCTTT
GGTAATAAAGTGGACAGAAGCAATTAAAAAAGAACAAATTCCAGCAAACC
CATCATTTTCATTTATTGAATTTCTTTCTAATCCAACTCAAATAAGAGAT
TGGAATATTCAAGGATTGCCTAGAGATGGGTTTTCAGTAGAAAACGGTGT
CATTGTAACAAGAGGAAGTCGATGGCCTTTAATGGTTGATCCACAATGCC
AAGCTCAAAAATGGATAAAACAAATGGAAGGAAAAAAACTGAAAGTCATT
GATCTTCACATGCCTGATTTTATTCGTGTTCTTGAAATCGCTATTCAATT
TGGTCAACCCGTATTGCTTCAAAATGTACAAGAAAAACTGGACCCTAGTT
TAGATCCAATTTTGAATAAATCCATCGTTAAGATTGGTGGTGCAACTGTT
ATGAAATTAGGAGACAAAGAAATTGAATACAATTACGATTTCAGATTTTA
TATCACCACAAAACTCCCAAATCCGCATTATACTCCAGAAATAAGTACAA
AAACATGCATAGTAAATTTTGCAGTGAAAGAACAAGGTTTGGAAGCTCAA
TTATTGGGAATTGTGGTTAGGAAAGAAAGACCAGAACTGGAAGAACAAAA
GGACAATTTAGTTATGAGTATTGCTGCAGGCAAGAGGAAATTAGCAGAAT
TAGAAGATGAAATACTGCGACTATTGAATGAAGCTCAAGGTTCATTGTTG
GACGATGAACAGCTAGTCAACACTTTACAGACTTCTAAAATAACGTCTAC
GGAAGTTACAGAACAATTGCAAATTGCAGAAAAAACCGAAACAGCTATCG
ATATTGCTCGCCAAGGTTATGCGTCATGTGCTCAGCGTGCATCAATTCTT
TTCTTTGTTCTTAATGATCTAGGAAAAATCGATCCTATGTATCAATTTGC
TCTTGACGCTTATATTGATCTTTTTAACATGAGCATAAATAAGAGTACAA
AAAGTCCTAAAAGAGATGAGAGAATTTCCAATCTTAATGATTATCATACA
TACGCTGTTTACTGCTATGCGTGTCGAGGTTTATTTGAAAAGCATAAACT
ATTATTTTCATTTCAAATATGTGCAAAGATTCTTCAAACATCAGGTAAAA
TGAATATGGATGAATACAACTTTTTCTTAAAAGGAGGGGTTGTACTTGAT
CGTGAAAATCAAATGGATAATCCGTGTCCAGGATGGCTATCTGATCAAGC
ATGGGACAATATATCTGAATTAGATAAATTGGCAAATTTCCATGGTTTAA
TAACTTCATTCGAGCAATATCCTAGGGATTGGAATTTATGGTATACATCT
GATTCACCTGAAACGAGCTCGTTACCAGGGGAATGGGATAATGCAACAAA
TGAATTTCAGCGAATGCTTATTGTTAGATCACTACGACCTGATCGAGTTA
GTTTTTGCGCTACAAGTTTTATTATAAATAATCTGGGCAACAAATTTGTT
GAGCCTCCAGTTCTTGACATGAAACAAGTAGTTGATGACAGTAGTGCAAA
GACTTGCTTAATTTTTGTTTTATCTCCTGGA
back to top

protein sequence of SMED30007055-orf-1

>SMED30007055-orf-1 ID=SMED30007055-orf-1|Name=SMED30007055-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1220bp
MLRTNKDYHDTKNSITRLWIHENFRVFADRMVIDKDKVAFVELLSEKLGS
LFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNN
TPGVVQMDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLA
AYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVV
DESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIF
TYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDA
LLEVAERYLKDLQLFIGGEEDRMKPHLATIFSLMHRSVSDMSQRMLDEMK
RHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVE
VMSIELEEARKKLAIFQKECDDYLVVIVQQKREADDQAKSVMQTQERIKV
DEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPAL
VQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKI
GTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQA
AESVLREKQAQLAAAQAKLDAVMEEMKRLQQEYNEKMEQKEELRKKAEHT
EKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMG
PFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLP
RDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIKQMEGKKLKVIDLHMPDF
IRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKE
IEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVR
KERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVN
TLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDL
GKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYA
CRGLFEKHKLLFSFQICAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDN
PCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLWYTSDSPETSS
LPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDM
KQVVDDSSAKTCLIFVLSPG
back to top

protein sequence of SMED30007055-orf-2

>SMED30007055-orf-2 ID=SMED30007055-orf-2|Name=SMED30007055-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1227bp
MTSIKLLMTTEILYQMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQ
RQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACG
KKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILG
QSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQK
LRLEGPVEAWLCDLEKCMRVTLRDLLRDCRIALKKAASKRDKWIKEWSGQ
LCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRS
NLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEK
EIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGG
SPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTG
AWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPS
VGIFITMNPGYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSG
CKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGRKKRANPLMP
DEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAI
EKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQ
SALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSS
VMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISM
PEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDS
VLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATV
ENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREMEGT
FPNKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDTVR
YNYLVQNLVCNFHPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSA
QTSSNNVQDIIEARVEKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQP
PLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQS
RFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGDIITQATIEMYN
GVVIKFLPTPTKIHYLFNLRDISKEC*
back to top

protein sequence of SMED30007055-orf-3

>SMED30007055-orf-3 ID=SMED30007055-orf-3|Name=SMED30007055-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1509bp
MDNEREIENLEKAEISANFFNKSNLETESLNITVTDEAVEINPNKEEQNE
IFYEDDGTAELVMSYEEIPKSTPPDEEKSVIDLIRQRIRLSGYVEIENWT
ADHALQVQDEFVTSNNELLVAYMHSKNGLQLDTIFPTGRVNELVYFIKRL
GYDFEIINAENFHDFIQHGTVCGRGIDSLLRIMMGIYAPSYFSNTMWPDS
IKNDFSLQLQRFMSALTDARWKLEGKTVLYIPAEAALYSVENGAKEKDFI
NRMEMIMIHWTRQIKEVLSAQNAFEDTESSGPLDEIEYWKNRCDDLSGIS
KQLDKTGVKHITKILETAKSSYVGAFLKLASEIKFNTQQAQSNLKFLNTL
KDMCHDLSDSKPEDIPSMLSKLINRIRMIWVNSEHYNSRDAMTGMFRKMS
NEIIKRCCLSLDLDEIFDGQIVSSMKKLQNCIYCCEQYKDIYDKICYVHK
TYSSKPWNLDKTNIFAQIDAFIQRCKDLIEICECQAHFARFEDGNKKEMP
IFQGARGAEVEMIILQIETVFENNIRALRDRKSTILDVKATSWHDDYNRF
RSGVKDLEVMTQNAITTAFETVTTIQQGIEILDVFAHLQNRETIRRTTDK
MIQIICNKLMQEFNLVKKELALSTSIGLPHPSIPKYAGIAIWARTLRKRI
ERQMLNLDQAFFLPISSSNADFRQQYTQLSVALEEVVRKTHIEFMSGLDR
DPLKSLDVTLLSRSIISQGMLDINFSRALLKLFQELHYWERLQFDVPHYA
ADIYIRRAELRISRESVLLVVRDYNRILQTLNAEERSLFKEQIKTLDKKI
QPGLIKILWSSKGAIEYFVNDCRINAARLQKKVDEYKTANDDIRKYCELI
SSMLMIKIDSNRIYENTEFNDSQEAHRAVVKEKLVGLHGEIINQMRETYE
IFSKDSSDIQQYWNLYMNKVDKFCEEAFRLNVKYSLNELNKAINGDGRNE
PSPLFKVSLNLQMRDLVFIPTLPELTNIVTSLGKNFIEVVKEIPRIGEVL
QKVKLKKSIWEFISTDDEITKIQTNIRHGMQDISSSIQEPLGYWDQFREI
WELNKEEFISQYCDLNPHVYSIDADISRYTEVTNKALDAEAMVTVKFLQL
DFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIP
QNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRL
KKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIM
DFQTNGPFAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQP
PSKEIAALEKDLDNIENIWKLALEWETNWTQWKSGRFIELKTIEMENLAN
SSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRH
WFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAATKELAIE
NALKGMEKLWESVELEIIPHKDKEKNHFLLSGIDDLYQTLDDNRNTLSNE
DISICQTV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000464GABAergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR013594Dynein_heavy_dom-1
IPR013602Dynein_heavy_dom-2
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR011704ATPase_dyneun-rel_AAA
IPR024317Dynein_heavy_chain_D4_dom
IPR024743Dynein_HC_stalk
IPR004273Dynein_heavy_D6_P-loop
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0016887ATPase activity
GO:0003777microtubule motor activity
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex