SMED30007031

Overview
NameSMED30007031
Smed IDSMED30007031
Length (bp)904
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30007031 (SMED30007031) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30007031 (SMED30007031) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007031

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30007031SMESG000064303.1 SMESG000064314.1 Contig19558newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007031SMESG000064303.1 SMESG000064314.1 Contig19558uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30007031SMESG000064314.1 dd_Smed_v4_13603_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007031SMESG000064314.1 dd_Smed_v4_13603_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30007031SMESG000064314.1 dd_Smed_v4_13603_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007031SMESG000064314.1 Contig53784newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007031SMESG000064314.1 Contig53784uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30007031SMESG000064314.1 Contig53784newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30007031SMESG000064314.1 Contig53784uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30007031 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000055:316596..317499 -4520
v31.000055:316829..317864 -2144
v31.000055:317081..317899 -1784
Homology
BLAST of SMED30007031 vs. Planmine SMEST
Match: SMESG000064314.1 (SMESG000064314.1)

HSP 1 Score: 536.569 bits (1381), Expect = 9.932e-175
Identity = 301/301 (100.00%), Postives = 301/301 (100.00%), Query Frame = 1
Query:    1 ESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLDVSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNXXXXXXXXXXXXXXXTNESELCEPNVIEIDEVEKNISE 903
            ESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLDVSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNSDEVSKVDVKDKSVDTNESELCEPNVIEIDEVEKNISE
Sbjct: 1782 ESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLDVSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNSDEVSKVDVKDKSVDTNESELCEPNVIEIDEVEKNISE 2082          

HSP 2 Score: 220.705 bits (561), Expect = 1.198e-64
Identity = 183/349 (52.44%), Postives = 219/349 (62.75%), Query Frame = 1
Query:    1 ESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETT-QEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINL-DVSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVD-----------------------------------------KTYHSVDQNESELANQNIIKIDKGEKNILDQVNV--LYKT---DHSVDPNKIKLAEFNINEVDNGEPKQQEQVNXXXXXXXXXXXXXXXTNESELCEPNVIEIDEVEKNISE 903
            ESE AESNI+EVD+ E KQ ++++ EEVSNVD TDHS + NE +LAEQNIIEVDV +RNISE+ NL+EVS V E D  VD NE+E  ESNIN VDE ET  QEQ+  EEVS V E + SV  NE+   E   K+VD  E  Q+   N  + SK+DETDHS+  N+S+P ESNI +VD+ E  QQEQVNS+EV NVD                                         +T HSVDQNE EL  QNII+IDK EKNI DQVNV  L K    DHS DPN+ + A  NINEV+  E KQQE VNS E+S+V  KD S + N+ E  EPN+  +DEVEKNI E
Sbjct: 2180 ESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVFELENSVILNENTLTEPIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQEQVNSDEVINVDVKDKSVNPDESELGEPNCIEIVEVDKNISEESNVKELLKVTETNHSVDQNEGELDEQNIIEIDKSEKNISDQVNVDELSKVDEIDHSADPNESESANSNINEVNKKETKQQELVNSKELSEVYEKDNSYNPNKKEFVEPNIKNVDEVEKNIIE 2528          

HSP 3 Score: 211.075 bits (536), Expect = 2.021e-61
Identity = 157/308 (50.97%), Postives = 204/308 (66.23%), Query Frame = 1
Query:    1 ESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETT-QEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLD-VSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNV-----LYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNXXXXXXXXXXXXXXXTNESELCEPNVIEIDEVEKNISE 903
            E E  + NI  +D+ E    ++ ++ E+S +D+ D S   NESKLAE  IIE+D  + NI++  NL E+S V E   S DLNENEP+E NIN+VDE E   QEQ+  E VSKV EKD S DPNE +  +HNI ++D+ E      +N+D VSK+DE  HS D+ ES+P E NI EVD+GE  QQEQ N EEV  V+K  +S D N+SEL   +II+ID+GE NI D VNV     + +TDH+ + N+ +  E NI EVD GEPKQQEQVN +EVSKV+ K  S DTNESE+ EPN+  + E E +ISE
Sbjct: 2912 EREIVQPNIKCLDEGETNISEESNVNELSKIDEIDRSVYPNESKLAEHYIIEIDQSKNNITDPVNLNEISKVDEKGHSADLNENEPSEYNINEVDEGEPKQQEQVNPEGVSKVNEKDNSYDPNECELAQHNITEIDQGENNIADSVNVDEVSKVDEKYHSADSKESEPSEDNINEVDEGEPKQQEQFNPEEVLKVNKKDNSDDPNQSELVESHIIEIDQGENNIADHVNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETDISE 3219          

HSP 4 Score: 200.675 bits (509), Expect = 9.684e-58
Identity = 157/297 (52.86%), Postives = 207/297 (69.70%), Query Frame = 1
Query:    1 ESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLD-VSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNXXXXXXXXXXXXXXXTNESELCEPNVIEIDEVE 888
            ES+  E NI +VD+ E+KQ K+I+L+ VS +D+TDHS D+NESK  E NIIEVD GE    EQ N EEVSNV +T  SVD NE+E    NI K+D+ E      I ++V+ + + D SVDPN+    E NI +VD  E KQ +Q+N D VSK+D  D SVDTNES+  E N+IE+D+ E    E+ N +E+ NV++T HS DQN+ ELA Q II+ID+ EKNILDQVNV+ +TDHS + NK + +E  INEVD  + KQQ++V+ D VSKVD KD+S++ NESEL E N+ E+DE E
Sbjct: 1904 ESDFVEHNIKKVDEDEKKQHKQINLD-VSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKN----ILDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNSDEVSKVDVKDKSVDTNESELCEPNVIEIDEVEKNISEKSNVKELLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNVVDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERE 2195          

HSP 5 Score: 186.422 bits (472), Expect = 8.074e-53
Identity = 158/318 (49.69%), Postives = 207/318 (65.09%), Query Frame = 1
Query:    1 ESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETT-QEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLD-VSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNV----------DKTYHSVDQNESELANQNIIKIDKGEKNI------LDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNXXXXXXXXXXXXXXXTNESELCEPNVIEIDEVEKNIS 900
            ESEP+E NINEVD+ E KQQ++ + EEV  V+K D+S D N+S+L E +IIE+D GE NI++  N++EVS V ETD + +LNE+EP ESNI +VDE E   QEQ+  EEVSKV EK  S D NES+ VE NIK V E E    ++ N++ +SK+DE D SV TNESK  E  IIE+D GE    + V  +E SN           ++T HS DQ E E A  NI   + GE+ I      L+ ++ +Y+ D S D N+ + +E  INEVD GEPKQQEQVN +EVSKV+ KD S D NES L E  ++EID+ + NI+
Sbjct: 3076 ESEPSEDNINEVDEGEPKQQEQFNPEEVLKVNKKDNSDDPNQSELVESHIIEIDQGENNIADHVNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETDISEEPNVNELSKIDEIDRSVYTNESKLAEHYIIEIDQGENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNI--NEAGEEEITQEKFNLEDLSKVYEKDDSGDSNESEPSESYINEVDEGEPKQQEQVNPEEVSKVNEKDNSYDPNESGLAEYYIVEIDQGKNNIT 3391          

HSP 6 Score: 185.652 bits (470), Expect = 1.758e-52
Identity = 131/262 (50.00%), Postives = 178/262 (67.94%), Query Frame = 1
Query:    1 ESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETT-QEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLD-VSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNV-----LYKTDHSVDPNKIKLAEFNINEVDNGE 765
            E+EP+E NINEVD+ E KQQ++++ E VS V++ D+S D NE +LA+ NI E+D GE NI++  N++EVS V E   S D  E+EP+E NIN+VDE E   QEQ   EEV KV +KD S DPN+S+ VE +I ++D+ E      +N+D VSK++ETDH+ + NES+P ESNI EVD+GE  QQEQVN EEVS V++   S D NESE+   NI  + +GE +I ++ NV     + + D SV  N+ KLAE  I E+D GE
Sbjct: 2994 ENEPSEYNINEVDEGEPKQQEQVNPEGVSKVNEKDNSYDPNECELAQHNITEIDQGENNIADSVNVDEVSKVDEKYHSADSKESEPSEDNINEVDEGEPKQQEQFNPEEVLKVNKKDNSDDPNQSELVESHIIEIDQGENNIADHVNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETDISEEPNVNELSKIDEIDRSVYTNESKLAEHYIIEIDQGE 3255          

HSP 7 Score: 185.267 bits (469), Expect = 1.844e-52
Identity = 172/390 (44.10%), Postives = 217/390 (55.64%), Query Frame = 1
Query:    1 ESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQ-EQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLDV-SKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEV-----------------------------------------SNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNV-----LYKTDHSV-----------------------------------------DPNKIKLAEFNINEVDNGEPKQQEQVNXXXXXXXXXXXXXXXTNESELCEPNVIEIDEVEKNISE 903
            ESE AESNI+EVD+ E KQ ++++ EEVSNVD TDHS + NE +LAEQNII VDV +RNISE+ NL+EVS V E D  VD NE+E  ESNIN VDE ET Q EQ+  EEVS V E + SV  NE+   E   K+VD  E  Q+   N +  SK+DETDHS+  N+S+P ESNI +VD+ E  QQ+QVNSE+V                                         SNVD+  HS DQ +SELA  NI  +D+ E+NI    N+     + K DHSV                                         DPN+ + AE NINEVD  E KQQ++++ +EVS VD  D S D+NES+L E N+IE+D  E+NISE
Sbjct: 1454 ESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISE 1843          

HSP 8 Score: 176.022 bits (445), Expect = 3.627e-49
Identity = 146/307 (47.56%), Postives = 199/307 (64.82%), Query Frame = 1
Query:    1 ESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQ-EQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINL-DVSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNV--LYKTD---HSVDPNKIKLAEFNINEVDNGEPKQQEQVNXXXXXXXXXXXXXXXTNESELCEPNVIEIDEVEKNIS 900
            E E  ESNI  V++ +    ++ ++ E S +D+ D S D N+S+L+E  IIE+D  E+NIS+  N++EVS V ETD + +LNE+EP ESNI +VD  E  Q EQ+  EEVSKV E D S DPN S+  + NI ++    K  H++ NL +VSK  E D SVD NE + V+ NI  +D+GE    E+ N  E+S +D+   SV  NES+LA   II+ID+ + NI D VN+  + K D   HS D N+ + +E+NINEVD GEPKQQEQVN + VSKV+ KD S D NE EL + N+ EID+ E NI+
Sbjct: 2750 EIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKSELSEHYIIEIDQVEKNISDPVNVDEVSKVEETDRTANLNESEPYESNIKEVDVGEPKQKEQVNLEEVSKVNENDYSRDPNGSEPDDSNINEL--GGKMTHEKFNLEEVSKARENDDSVDPNEREIVQPNIKCLDEGETNISEESNVNELSKIDEIDRSVYPNESKLAEHYIIEIDQSKNNITDPVNLNEISKVDEKGHSADLNENEPSEYNINEVDEGEPKQQEQVNPEGVSKVNEKDNSYDPNECELAQHNITEIDQGENNIA 3054          

HSP 9 Score: 164.851 bits (416), Expect = 2.557e-45
Identity = 151/311 (48.55%), Postives = 199/311 (63.99%), Query Frame = 1
Query:    4 SEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQ-EQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLD-VSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNV---------LYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNXXXXXXXXXXXXXXXTNESELCEPNVIEIDEVEKNISE 903
            SE A+ NI +V++ E K+Q++I+LEEV+NVD+ D+S D NE  L E  + EV   E    ++ N EE S + ETD SVDLNE+E  ESNI++VDE ET Q EQ+ SEEVS V   D S +PNE +  E NI  VD D++   +++NLD VSK+DE D  VD NES+  ESNI +VD+GE  QQEQVN EEVSNV +  +SV  NE+ L       I K   N+ +  NV         + +TDHS+ PN+ + AE NIN+VD  E KQQ+QVNS++V +V  K  S D N  E  +PN+  +DE EKNI E
Sbjct: 1374 SELADHNIIKVEE-ETKKQEQINLEEVTNVDERDYSVDQNEITLTEPIMKEVYNVENIQIQRVNSEENSKLDETDHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTES----IKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIE 1679          

HSP 10 Score: 164.081 bits (414), Expect = 4.415e-45
Identity = 132/280 (47.14%), Postives = 176/280 (62.86%), Query Frame = 1
Query:    1 ESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDE-EETTQEQLISEEVSKVGEKDVSVDPNE----------SDFVEHNIKKVDEDEKKQHKQINL-DVSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNV-----LYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVN 789
            ESEP ESNI EVD+ E KQQ++++ EEVS V++   S D+NES++ E NI  V  GE +ISE+ N+ E+S + E D SV  NE++  E  I ++D+ E    + +  +E S    KD S D NE           +  E NI +  E+E  Q K  NL D+SK+ E D S D+NES+P ES I EVD+GE  QQEQVN EEVS V++  +S D NES LA   I++ID+G+ NI D VN+     + + DHS D N+ + +E NINEVD GEPKQQEQVN
Sbjct: 3158 ESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETDISEEPNVNELSKIDEIDRSVYTNESKLAEHYIIEIDQGENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQEK-FNLEDLSKVYEKDDSGDSNESEPSESYINEVDEGEPKQQEQVNPEEVSKVNEKDNSYDPNESGLAEYYIVEIDQGKNNITDPVNLNEISKVDEEDHSADLNENEPSESNINEVDEGEPKQQEQVN 3436          

HSP 11 Score: 160.999 bits (406), Expect = 4.936e-44
Identity = 146/305 (47.87%), Postives = 202/305 (66.23%), Query Frame = 1
Query:    1 ESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEE--TTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQ-INLDVSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNI-----LDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNXXXXXXXXXXXXXXXTNESELCEPNVIEIDEVEK 891
            +SEPAESNIN+VD+ E KQQ +++ E+V  V +  +S D N  +  + N+  VD  E+NI E+ N++ +SNV E + S D  ++E  E NI  VDEEE   T +  + EE SKV + D SV+ NE    E   K++D++E+ Q    I+ + SKLDE  +S D NES+P ESNI EVD  E  QQ++++ EEVSNVDKT HS D NES+LA QNII++D GE+NI     L++V+ +++TD SVD N+ +  E NIN+VD  E   QEQ+ S+EVSKV  KD SVD NES+  E N+ ++DE EK
Sbjct: 1618 QSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEE-SKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEE-TTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEK 1920          

HSP 12 Score: 150.599 bits (379), Expect = 1.819e-40
Identity = 119/245 (48.57%), Postives = 159/245 (64.90%), Query Frame = 1
Query:    1 ESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETT-QEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINL-DVSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQ-VNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNV-----LYKTDHSVD 711
            ESEP+ES INEVD+ E KQQ++++ EEVS V++ D+S D NES LAE  I+E+D G+ NI++  NL E+S V E D S DLNENEP+ESNIN+VDE E   QEQ+  E VSKV EKD S DP+E +  E NI +   +    +++ NL + SK+ E D S D N+S+  E NI  VD+ E  QQ+Q  N EE S V +  +S D NE+EL   +I  I +GEKNI ++ NV     ++   HS D
Sbjct: 3331 ESEPSESYINEVDEGEPKQQEQVNPEEVSKVNEKDNSYDPNESGLAEYYIVEIDQGKNNITDPVNLNEISKVDEEDHSADLNENEPSESNINEVDEGEPKQQEQVNPEGVSKVNEKDNSNDPSEIEPAESNINEFGGE--MTNEKFNLVEASKIFEKDDSFDPNKSELAELNINGVDEEEPKQQQQNFNFEEASKVHEKDNSDDPNENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFD 3573          

HSP 13 Score: 142.51 bits (358), Expect = 1.242e-37
Identity = 134/351 (38.18%), Postives = 190/351 (54.13%), Query Frame = 1
Query:    1 ESEPAESNINEVDKAERKQQKKIDLEEVSNVD-----------------------------------------KTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQEQLI-SEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEK----------------KQH--------------KQIN------------LDVSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDK----GEKNILDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVN 789
            +SEPAESNIN+VD+ E KQQ++++ +EV NVD                                         +T+HS D NE +L EQNIIE+D  E+NIS+Q N++E+S V E D S D NE+E   SNIN+V+++ET Q++L+ S+E+S+V EKD S +PN+ +FVE NIK VDE EK                 +H              K +N            ++VSK+DE  +S D NE+   E    EVD+ E  Q + V SEE+   D+T +SVDQ E E A  NI ++D+     EK  L +V+ + +TDHSVDPN+ + +  NINE+  GE    ++VN
Sbjct: 2344 QSEPAESNINKVDEEETKQQEQVNSDEVINVDVKDKSVNPDESELGEPNCIEIVEVDKNISEESNVKELLKVTETNHSVDQNEGELDEQNIIEIDKSEKNISDQVNVDELSKVDEIDHSADPNESESANSNINEVNKKETKQQELVNSKELSEVYEKDNSYNPNKKEFVEPNIKNVDEVEKNIIEESYLKALSMIDGTKHSVDENEEELAELNIKNVNEKERSLIYNANLIEVSKVDEIYYSEDPNENTLTEPITKEVDNIENIQTDYVKSEELK-ADETEYSVDQIERESAESNIDEVDEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVN 2693          

HSP 14 Score: 133.265 bits (334), Expect = 1.699e-34
Identity = 144/364 (39.56%), Postives = 191/364 (52.47%), Query Frame = 1
Query:    4 SEPAESNINEVDKAERKQQKK-IDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVF-------------------------------ETDPSVDLNENEPTESNINKVDEEETTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIK-------------------KVDEDE--------KKQHKQI----NL-DVSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNXXXXXXXXXXXXXXXTNESELCEPNVIEIDEVEKNISE 903
            SE AE NIN VD+ E KQQ++  + EE S V + D+S D NE++L E +I  +  GE+NISE+ N++E++ VF                               ETD + D NE+EP ESN N+VDEEE   E+      SKV EKD S DP +++ VE  IK                   KVD+ E        K + + I    NL D+S++DE DHSV++NE      N+IEVD G+  Q E  N EE+S VD+ +HS + NESEL   NI ++D+GE N   QVN          PN+    E N NEVD GE  Q E VN +E S VD  D  VD  ES   +P+V ++ E EKN +E
Sbjct: 3494 SELAELNINGVDEEEPKQQQQNFNFEEASKVHEKDNSDDPNENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFNEVDEEEGNSEE-----ESKVDEKDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSVNQMKCKIEERNITDDANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVN----------PNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEKNKAE 3842          

HSP 15 Score: 132.494 bits (332), Expect = 3.217e-34
Identity = 118/260 (45.38%), Postives = 165/260 (63.46%), Query Frame = 1
Query:   31 EVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDE-EETTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLD-VSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNV-----LYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVN 789
            EVD  E  Q   +  EE+   D+T++S D  E + AE NI EVD  E    E+ NL+EVS V ETD SVD NE+EP+ SNIN++ + E+   +++  ++VSK  E D SVDPN+S+  +  I +++ +    HK+INLD V K+DE + SVD NE + VESNI  V++G+    E+ N  E S +D+   SVD N+SEL+   II+ID+ EKNI D VNV     + +TD + + N+ +  E NI EVD GEPKQ+EQVN
Sbjct: 2600 EVDNIENIQTDYVKSEELK-ADETEYSVDQIERESAESNIDEVD-EEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIEGE--ITHKKINLDEVPKVDENNDSVDPNEIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKSELSEHYIIEIDQVEKNISDPVNVDEVSKVEETDRTANLNESEPYESNIKEVDVGEPKQKEQVN 2855          

HSP 16 Score: 131.724 bits (330), Expect = 7.229e-34
Identity = 143/346 (41.33%), Postives = 190/346 (54.91%), Query Frame = 1
Query:    1 ESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQD-----------------------------------------NLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINL-DVSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGE---KNI-LDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNXXXXXXXXXXXXXXXTNESELCEPNVIEIDEVEKNIS 900
            ESE A SNINEV+K E KQQ+ ++ +E+S V + D+S + N+ +  E NI  VD  E+NI E+                                          NL EVS V E   S D NEN  TE    +VD  E  Q   +  E  K  E + SVD  E +  E NI +VDE+E  Q K  NL +VSK+DETDHSVD NES+P  SNI E+  GE    ++VN ++VS  D++ HSVD N+SE     I +I+ GE   K I LD+V  + + + SVDPN+I++ E NI  V+ G+    E+ N +E S +D  D SVD N+SEL E  +IEID+VEKNIS
Sbjct: 2467 ESESANSNINEVNKKETKQQELVNSKELSEVYEKDNSYNPNKKEFVEPNIKNVDEVEKNIIEESYLKALSMIDGTKHSVDENEEELAELNIKNVNEKERSLIYNANLIEVSKVDEIYYSEDPNENTLTEPITKEVDNIENIQTDYVKSEELKADETEYSVDQIERESAESNIDEVDEEEITQEK-FNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIE-GEITHKKINLDEVPKVDENNDSVDPNEIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKSELSEHYIIEIDQVEKNIS 2810          

HSP 17 Score: 126.716 bits (317), Expect = 2.904e-32
Identity = 126/291 (43.30%), Postives = 179/291 (61.51%), Query Frame = 1
Query:   25 INEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLD-VSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNV-----LYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNXXXXXXXXXXXXXXXTNESELCEPNVIEID 879
            I  V++ ER      +L EVS VD+  +S D NE+ L E    EVD  E   ++    EE+    ET+ SVD  E E  ESNI++VDEEE TQE+   +EVSKV E D SVDPNES+    NI ++ + EK    ++N+D VSK DE+DHSVD N+S+P +S I E++ GE T + ++N +EV  VD+   SVD NE E+   NI  +++G+ N+ ++ N+     + + D SVDPNK +L+E  I E+D  E    + VN DEVSKV+  D++ + NESE  E N+ E+D
Sbjct: 2557 IKNVNEKERSLIYNANLIEVSKVDEIYYSEDPNENTLTEPITKEVDNIENIQTDYVKSEELK-ADETEYSVDQIERESAESNIDEVDEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIE-GEITHK-KINLDEVPKVDENNDSVDPNEIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKSELSEHYIIEIDQVEKNISDPVNVDEVSKVEETDRTANLNESEPYESNIKEVD 2844          

HSP 18 Score: 124.405 bits (311), Expect = 2.374e-31
Identity = 115/243 (47.33%), Postives = 158/243 (65.02%), Query Frame = 1
Query:  178 ISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLD-VSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNV-----LYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNXXXXXXXXXXXXXXXTNESELCEPNVIEIDEVE 888
            ++E  NL  ++ + + D SVD  E+   E+ INK+DEE   Q+Q+  EEV KV E +  ++PN S+  +HNI KV+E+ KKQ +QINL+ V+ +DE D+SVD NE    E  + EV + E  Q ++VNSEE S +D+T HSVD NESELA  NI ++D+GE   L+QVN      +  TDHS +PN+ +LAE NI  VD  +    E+VN DEVSKVD  D+ VD NESE  E N+ ++DE E
Sbjct: 1310 VNETFNLYVMTKMDQKDNSVDPYESAHIEAKINKIDEETIKQKQVNLEEVPKVDETEEFINPNRSELADHNIIKVEEETKKQ-EQINLEEVTNVDERDYSVDQNEITLTEPIMKEVYNVENIQIQRVNSEENSKLDETDHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGE 1551          

HSP 19 Score: 67.0106 bits (162), Expect = 4.744e-12
Identity = 75/215 (34.88%), Postives = 111/215 (51.63%), Query Frame = 1
Query:   22 NINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQEQLIS-EEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEK-KQHKQI--NLDVSKLDETDHSVDTNESKPVES-------NIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQN 633
            N+ EVDK ++ Q +  +LEE+S VD+  HSA+ NES+L E NI EVD GE N  +Q               V+ NE+ P E N N+VD  E  Q + ++ EE S V + D  VDP ES F + ++ KV E EK K   QI  + DV  +    + V  N    +E+       N+I ++D +   +   +S+E    D+ +  VD+  +E  N N
Sbjct: 3721 NVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQ---------------VNPNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEKNKAETQIVKSTDVDTI-FVQNDVKENSKMYIENAQILASPNVISINDNKVDVKTNESSKEEIASDEDWIKVDEESTEKTNSN 3919          

HSP 20 Score: 64.3142 bits (155), Expect = 3.680e-11
Identity = 108/336 (32.14%), Postives = 161/336 (47.92%), Query Frame = 1
Query:  133 LAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNEN-------------EPTESNINKVDEEE--------------------TTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLDV-SKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEK-----NILDQVNV----------------------------------------LYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNXXXXXXXXXXXXXXXTNESELCEPNVIEIDEVEKNISE 903
            L EQ+I E+ V ++     DN   +S +     + ++ EN              P E+ I  +DE+E                    T +   ISE   K+  +    +    +  E  I K+ E+  + ++  NL V +K+D+ D+SVD  ES  +E+ I ++D+ E  +Q+QVN EEV  VD+T   ++ N SELA+ NIIK+++  K     N+ +  NV                                        L +TDHSVD N+ +LAE NI+EVD GE KQ EQVNS+EVS VD+ D S + NE EL E N+I +D  ++NISE
Sbjct: 1184 LYEQDI-EIQVSDKETLTSDNTSPLSELNIESEAQEVIENNAQTNDKDKALLKRPIENII--LDEQEDLNNLHLEIIKDSSPGNNEDTEKSADISESNDKIHVRVEKHEKRADNLNETQINKLGENVDQVNETFNLYVMTKMDQKDNSVDPYESAHIEAKINKIDE-ETIKQKQVNLEEVPKVDETEEFINPNRSELADHNIIKVEEETKKQEQINLEEVTNVDERDYSVDQNEITLTEPIMKEVYNVENIQIQRVNSEENSKLDETDHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISE 1515          
The following BLAST results are available for this feature:
BLAST of SMED30007031 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007031 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007031 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007031 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007031 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007031 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007031 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007031 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007031 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007031 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007031 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007031 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007031 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007031 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000064314.19.932e-175100.00SMESG000064314.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007031 ID=SMED30007031|Name=SMED30007031|organism=Schmidtea mediterranea sexual|type=transcript|length=904bp
GAAAGTGAACCTGCTGAGTCTAATATTAATGAGGTCGATAAGGCAGAAAG
GAAACAACAGAAGAAAATTGATTTGGAAGAAGTTTCAAATGTTGATAAAA
CAGATCATTCTGCTGATTCAAATGAGAGTAAACTTGCTGAGCAGAATATC
ATTGAAGTCGATGTTGGTGAAAGAAATATATCCGAACAAGATAATTTGGA
AGAGGTGTCAAATGTATTTGAAACAGATCCTTCCGTCGATTTAAATGAAA
ATGAACCTACTGAATCTAATATCAACAAAGTCGATGAAGAAGAAACGACA
CAAGAGCAATTAATTTCGGAAGAGGTATCAAAGGTTGGTGAAAAAGATGT
TTCTGTTGATCCTAATGAAAGTGACTTTGTTGAGCATAATATCAAAAAGG
TCGACGAAGATGAAAAGAAACAACACAAACAAATTAATTTGGATGTGTCA
AAGCTGGATGAAACAGATCATTCTGTTGATACAAATGAAAGTAAACCTGT
GGAGTCTAATATCATTGAAGTCGATGACGGAGAATGGACACAGCAAGAGC
AAGTTAATTCTGAAGAAGTGTCAAATGTGGATAAAACATATCATTCCGTC
GATCAAAATGAAAGTGAACTTGCTAACCAAAATATAATCAAAATCGATAA
AGGTGAAAAGAATATATTAGATCAAGTTAATGTGCTGTATAAAACAGATC
ATTCCGTTGATCCAAATAAAATTAAACTAGCTGAGTTTAATATCAATGAA
GTTGATAATGGAGAACCGAAACAACAAGAGCAAGTTAATTCCGACGAAGT
ATCAAAGGTTGATGTAAAAGATAAGTCTGTTGATACTAATGAAAGTGAAC
TTTGTGAGCCTAATGTCATTGAAATAGATGAAGTTGAAAAGAATATATCC
GAGA
back to top

protein sequence of SMED30007031-orf-1

>SMED30007031-orf-1 ID=SMED30007031-orf-1|Name=SMED30007031-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=301bp
ESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNI
IEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETT
QEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLDVS
KLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSV
DQNESELANQNIIKIDKGEKNILDQVNVLYKTDHSVDPNKIKLAEFNINE
VDNGEPKQQEQVNSDEVSKVDVKDKSVDTNESELCEPNVIEIDEVEKNIS
E
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002089reproductive organ
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 81..103
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 7..42
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 252..282
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 262..281
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..50