G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30007024
Length (bp)1295
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30007024) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30007024) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30007024) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30007024) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007024

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30007024SMESG000078415.1 dd_Smed_v4_24316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30007024SMESG000078415.1 dd_Smed_v4_24316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007024SMESG000078415.1 dd_Smed_v4_24316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007024SMESG000078415.1 dd_Smed_v4_24316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007024SMESG000078415.1 dd_Smed_v4_24316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007024SMESG000078415.1 dd_Smed_v4_24316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007024SMESG000078415.1 dd_Smed_v4_24316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30007024SMESG000078415.1 dd_Smed_v4_24316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30007024SMESG000078415.1 OX_Smed_1.0.22626ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: tacr1a (tachykinin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060526-185])

HSP 1 Score: 51.6026 bits (122), Expect = 1.078e-6
Identity = 36/122 (29.51%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  143 IISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDXXXXXXXXXXXXXXEFH-EWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLG 505
            ++SVVG I  +++IL + R   +  +N F+  LA ++     F          H EW  G  + C+ + FF  + +  S   ++ IA+DRY  I HP  Q M+ +++K+ I +  +L+ LL 
Sbjct:   44 VVSVVGNITVIWIILAHKRM--RTVTNYFLVNLAFAEASMSAFNTVINFVYSVHNEWYFGL-YYCRFHNFFPIAAVFASIYSMTAIALDRYMAIIHPLQQRMSATQTKVVIGVIWILALLLA 162          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: tacr1a (tachykinin receptor 1a [Source:NCBI gene;Acc:100003539])

HSP 1 Score: 51.6026 bits (122), Expect = 1.090e-6
Identity = 36/122 (29.51%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  143 IISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDXXXXXXXXXXXXXXEFH-EWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLG 505
            ++SVVG I  +++IL + R   +  +N F+  LA ++     F          H EW  G  + C+ + FF  + +  S   ++ IA+DRY  I HP  Q M+ +++K+ I +  +L+ LL 
Sbjct:   50 VVSVVGNITVIWIILAHKRM--RTVTNYFLVNLAFAEASMSAFNTVINFVYSVHNEWYFGL-YYCRFHNFFPIAAVFASIYSMTAIALDRYMAIIHPLQQRMSATQTKVVIGVIWILALLLA 168          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: tacr1a (tachykinin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060526-185])

HSP 1 Score: 51.6026 bits (122), Expect = 1.090e-6
Identity = 36/122 (29.51%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  143 IISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDXXXXXXXXXXXXXXEFH-EWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLG 505
            ++SVVG I  +++IL + R   +  +N F+  LA ++     F          H EW  G  + C+ + FF  + +  S   ++ IA+DRY  I HP  Q M+ +++K+ I +  +L+ LL 
Sbjct:   50 VVSVVGNITVIWIILAHKRM--RTVTNYFLVNLAFAEASMSAFNTVINFVYSVHNEWYFGL-YYCRFHNFFPIAAVFASIYSMTAIALDRYMAIIHPLQQRMSATQTKVVIGVIWILALLLA 168          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: tacr1b (tachykinin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-091117-17])

HSP 1 Score: 51.6026 bits (122), Expect = 1.222e-6
Identity = 35/122 (28.69%), Postives = 62/122 (50.82%), Query Frame = 2
Query:  143 IISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDXXXXXXXXXXXXXXEFH-EWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLG 505
            ++SVVG I  +++IL + R   +  +N F+  LA ++     F          H EW  G  + C+ + FF  + +  S   ++ IA+DRY  I HP  Q ++ + +KL +C+   L+ +L 
Sbjct:   51 LVSVVGNITVIWIILAHKRM--RTVTNYFLVNLAFAEASMSAFNTVINFIYAVHNEWYFGLVY-CRFHNFFPIAAVFASIYSMTAIALDRYMAIIHPLQQRLSSAETKLVVCVIWALALMLA 169          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUC3 (GCR110 OS=Schmidtea mediterranea OX=79327 GN=gcr110 PE=2 SV=1)

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 394/394 (100.00%), Postives = 394/394 (100.00%), Query Frame = 2
Query:   98 MQSTQQIPPTLALLSIISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDXXXXXXXXXXXXXXEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQVHIEKKLTNLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKVRRKKDQLKGMNKMKRFKPKKLECKSHIKPKSQYRLENSDNSPIYSRFVVSNYPGCNRNVKPLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVIKTLKNVRDTTLLQNLKLAAMLFVVGITYIVTFLPANLMANGIIKLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLKSFRFLRPVIRK 1279
            MQSTQQIPPTLALLSIISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDIFTCIFIIPTTIFIEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQVHIEKKLTNLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKVRRKKDQLKGMNKMKRFKPKKLECKSHIKPKSQYRLENSDNSPIYSRFVVSNYPGCNRNVKPLGNPSTNHHHSNSPTNSSMNSLNNSVNNSSSIVIKTLKNVRDTTLLQNLKLAAMLFVVGITYIVTFLPANLMANGIIKLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLKSFRFLRPVIRK
Sbjct:    1 MQSTQQIPPTLALLSIISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDIFTCIFIIPTTIFIEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQVHIEKKLTNLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKVRRKKDQLKGMNKMKRFKPKKLECKSHIKPKSQYRLENSDNSPIYSRFVVSNYPGCNRNVKPLGNPSTNHHHSNSPTNSSMNSLNNSVNNSSSIVIKTLKNVRDTTLLQNLKLAAMLFVVGITYIVTFLPANLMANGIIKLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLKSFRFLRPVIRK 394          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUN5 (GCR056 OS=Schmidtea mediterranea OX=79327 GN=gcr056 PE=2 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 2.832e-80
Identity = 176/403 (43.67%), Postives = 240/403 (59.55%), Query Frame = 2
Query:  107 TQQIPPTLALLSIISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDXXXXXXXXXXXXXXEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQV---HIEKKLTNLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKVRRKKDQLKGMNKM--------KRFKPKKLECKSHIKPKSQYRLENSDNS-PIYSRFVVSNYPGCNRNVKPLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVIKTLKNVRDTTLLQNLKLAAMLFVVGITYIVTFLPANLMANGIIKLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLKSFRFLRPVIRK 1279
            T QIP T+ +L IISV+G IGNL V++IY ++ DK T+N F+  LA SD   C+ IIP TI+IEF++W +    +CKSY F NNS IPF ALLI+LIA+DR+FC+C+PFL +M + RSK+ + I  M+S +LG L+ FQV    + K  TN++    +  S C++ S +AN +  + LF+ I Q+SQL+SY+ICI +VI LY  IY  V+   RKK +LKG+N          K FK + ++    I   S     N D S P  +   +   PG + N K +                                    +  ++T L+QN K A MLFVV ITYIVTFLPA LM N  + LNLPVFY+YY+NNAANPIIYCFMN+NFR  + +F F + +I+K
Sbjct:    9 TNQIPTTIGILIIISVIGSIGNLLVLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFMMSVVLGVLSVFQVKTFKLSKNSTNMN--STLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAICICVVICLYILIYRFVLAAARKKARLKGLNSSSTTSFLWNKFFKSRSIK---RINSDSN----NDDTSVPCQTTEELMTKPGPSNNDKAIK-----------------------------------RKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKNFREDVVNF-FHQHLIKK 366          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUG2 (GCR036 OS=Schmidtea mediterranea OX=79327 GN=gcr036 PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 4.643e-80
Identity = 164/396 (41.41%), Postives = 233/396 (58.84%), Query Frame = 2
Query:  101 QSTQQIPPTLALLSIISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDXXXXXXXXXXXXXXEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQVHIEKKLTNLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKVRRKKDQLKGMNKMKRFKPKKL-ECKSHIK------------PKSQYRLENSDNSPIYSRFVVSNYPGCNRNVKPLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVIKTLKNVRDTTLLQNLKLAAMLFVVGITYIVTFLPANLMANGIIKLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLKS 1249
            Q   Q+  TL +LS+I V+G +GN  VI++Y R+ D++T+ LF+ +LA +D FTCI IIP TI+IE+ EWGI S+F+CK Y FFNN  IPFSA LISLIA+DRY CICHPF + M L +SK+ + + L +S LLG  ++FQV + K + + +D+   N   C + S+  N + ++KLF+ I QK QL+SY+ CI++VI LY  IY  V++ RRKK  LKG+  +K  KP  L E +S++             P     L ++ ++P    F+    P   R                                       +L+++ DT + QN + AAML VV + YI++FLPA LM N    L +P+FY+YY+NNAANPIIYCFMN  FR  +K+
Sbjct:   17 QDGSQVAATLIMLSVICVIGSLGNGLVIIVYTRKHDQLTTTLFINILAITDCFTCITIIPMTIYIEYWEWGISSAFLCKLYYFFNNCTIPFSAFLISLIAIDRYICICHPFNKFMTLFKSKVSVGLVLTVSVLLGIASTFQVKMIKGI-HPNDLT--NSYECADISKLTNTTTTEKLFFSIVQKIQLLSYTTCIILVICLYVAIYCKVLQTRRKKSILKGIKNVK--KPSYLWESRSNLTNVPDLDENPIKLPDGDTMLSSAKSTPNSKSFLTVPKPEHRR--------------------------------------VSLRSICDTQIFQNFRTAAMLSVVALMYIISFLPAFLMINYPQILYIPLFYMYYINNAANPIIYCFMNARFREDIKA 369          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KU98 (GCR075 OS=Schmidtea mediterranea OX=79327 GN=gcr075 PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.287e-49
Identity = 152/387 (39.28%), Postives = 210/387 (54.26%), Query Frame = 2
Query:  110 QQIPPTLALLSIISVVGGIGNLFVILIY-IRQCDKVTSNLFMTVLAGSDXXXXXXXXXXXXXXEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQVHIEKKLTNLSDIGPMNMSF--CVEASEW---ANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKVRRKKDQLKGMNKMKRFKPKKLECKSHIKPKSQYRLENSDNSPIYSRFVVSNYPGCNRNVKPLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVIKTLKN--VRDTTLLQNLKLAAMLFVVGITYIVTFLPANLMANGIIKLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLK 1246
             QIP  +  + + S +G +GN  VILIY +++ +  T +LF+ VLA  D  TC+ +IP T+  EF  W IGS  +C  Y   N   +PFS+LL S +A+DRY  ICHPF QI  + R+K+ I I+L L +L   + + Q          S+I   N S   C + S+      +S   K+FY I  K     Y  CI++VI LY  IY  +I +R +K QL+G          +++ KSH    S   +  S+ +      V     G N N   L  P          + SS  S N SVN++    I+++    ++D+ LLQN++ A MLFVV I YI +F+PA LMAN +I LNL VFYLYYVNNAANPIIYCFMN+ FR   K
Sbjct:    7 HQIPIAMITMCVNSFIGCVGNGIVILIYCVQRNENCTVSLFIFVLAVIDFSTCLCVIPFTVVNEFLLWYIGSPALCFIYYVLNTFNVPFSSLLTSCVAIDRYCSICHPFHQIFTVHRAKILI-ISLGLFSLFLAITTTQFAFLSMAELASNISQGNKSEYKCTDPSQLTFHTVKSAHLKMFY-ILLKINHSCYVFCIIVVILLYILIYRAIILLRYRKRQLQG----------RIDAKSHEMMSSFMAIRKSEVAIPNISLV-----GLNPNENYLKIPQIKSGSFACYSRSSCCSRNFSVNDNFQTQIRSISKSLIKDSDLLQNIRSAIMLFVVAIVYITSFIPALLMANKMISLNLAVFYLYYVNNAANPIIYCFMNQQFRADFK 376          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A5J4NU14 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0011673 PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 2.277e-44
Identity = 97/209 (46.41%), Postives = 139/209 (66.51%), Query Frame = 2
Query:  107 TQQIPPTLALLSIISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDXXXXXXXXXXXXXXEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQVHIEKKLTNLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKV 733
            + QIP  +A+L +IS+VG +GN+ VI++Y+ + DK+T+NLF+ VLA SD+ +C  ++P TI IE+ EW + S   CK Y   NN+ IPFS+LLIS IA DRYFC+CHPFL+IM LSR++  I + + +S  +G  + F V +EK  T  S      +  C E ++  N +  + + YQI QKSQLVS+ +CI+ VI LY  IY +V KV
Sbjct:    9 SNQIPTVMAMLMVISIVGIVGNVLVIIVYMLKHDKLTANLFILVLAVSDLLSCSTLVPATICIEYIEWRMQSVVFCKVYYLLNNTFIPFSSLLISCIAFDRYFCLCHPFLRIMTLSRARRVIFVLISVSFTIGCSSMFLVRLEKNDT--SGNTTEKIYECTETTK-VNHTTLENMVYQIVQKSQLVSHILCIISVIVLYVLIYRSVSKV 214          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: galr2a (galanin receptor type 2 [Source:NCBI gene;Acc:101155603])

HSP 1 Score: 48.9062 bits (115), Expect = 5.810e-6
Identity = 69/241 (28.63%), Postives = 110/241 (45.64%), Query Frame = 2
Query:   89 IKKMQSTQQIPPTLALLSI----ISVVGGIGNLFVILIYIR--QCDKVTSNLFMTVLAGSDXXXXXXXXXXXXXXEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQVHIEKKLTNLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYS-TIYYTVIKVRRKKDQLKGMNKMKRFKPK 790
            +  +  + QI PT  ++S+    I ++G IGN  V+ + +R  Q    T+NLF+  L+ +D F  IF +P    I   E  +  SF+CK   FF N  +  S+  ++ +++DRY  I +P       SR     C A++   ++  L+   V     L+    I   N + C+   E  +R +     +       L  Y I +LIV   Y+ TI Y    V    D L GM++ KR K K
Sbjct:   13 LSNVSESYQINPTSVIVSVVFSLIFLLGTIGNSLVLAVLLRSGQVGYNTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPL-----RSRELRTPCNAVVAMVVIWGLS--LVFAGPYLSYYDLIDYANSTVCIPGWEEQDRKVLDTCTF-------LFGYVIPVLIVSLSYTRTIKYLWTAV----DPLDGMSESKRAKRK 235          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: DRD5 (dopamine receptor D5 [Source:HGNC Symbol;Acc:HGNC:3026])

HSP 1 Score: 48.9062 bits (115), Expect = 6.425e-6
Identity = 57/230 (24.78%), Postives = 108/230 (46.96%), Query Frame = 2
Query:  167 GNLFV--ILIYIRQCDKVTSNLFMTVLAGSDXXXXXXXXXXXXXXEFHE-WGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASF-QVHIEKKLTNLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTV-IKVRRKKDQLKGMNKMKRFKPKKLECKSHIKPKSQYRLE 841
            GN+ V   ++  R      +N+F+  LA SD+F  + ++P     E    W  G+   C  ++ F+      S L + +I++DRY+ I  PF     +++   F+ I++  +  L  L SF  V +     +  D    + S+  E +   + S+S++  Y I+  S L+S+ I + I+I  Y+ IY    I++RR     +     +  +  ++EC+ H   K+  + E
Sbjct:   34 GNILVCSAVLRFRHLRTKVTNIFIVSLALSDLFVAVLVMPWKAVAEVAGYWPFGT--FCNVWVAFDIMCSTASILNLCIISVDRYWAISSPFRYERKMTQRVAFVMISITWT--LSVLISFIPVQLNWHKASAEDRAHNSTSWQFEEN--CDSSLSRE--YAIS--SSLISFYIPVAIMIVTYTRIYRIAQIQIRRIASLERAAEHAQSCRTNRIECQHHTTLKTSIKRE 253          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000078415.1 (SMESG000078415.1)

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 394/394 (100.00%), Postives = 394/394 (100.00%), Query Frame = 2
Query:   98 MQSTQQIPPTLALLSIISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDXXXXXXXXXXXXXXEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQVHIEKKLTNLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKVRRKKDQLKGMNKMKRFKPKKLECKSHIKPKSQYRLENSDNSPIYSRFVVSNYPGCNRNVKPLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVIKTLKNVRDTTLLQNLKLAAMLFVVGITYIVTFLPANLMANGIIKLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLKSFRFLRPVIRK 1279
            MQSTQQIPPTLALLSIISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDIFTCIFIIPTTIFIEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQVHIEKKLTNLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKVRRKKDQLKGMNKMKRFKPKKLECKSHIKPKSQYRLENSDNSPIYSRFVVSNYPGCNRNVKPLGNPSTNHHHSNSPTNSSMNSLNNSVNNSSSIVIKTLKNVRDTTLLQNLKLAAMLFVVGITYIVTFLPANLMANGIIKLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLKSFRFLRPVIRK
Sbjct:    1 MQSTQQIPPTLALLSIISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDIFTCIFIIPTTIFIEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQVHIEKKLTNLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKVRRKKDQLKGMNKMKRFKPKKLECKSHIKPKSQYRLENSDNSPIYSRFVVSNYPGCNRNVKPLGNPSTNHHHSNSPTNSSMNSLNNSVNNSSSIVIKTLKNVRDTTLLQNLKLAAMLFVVGITYIVTFLPANLMANGIIKLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLKSFRFLRPVIRK 394          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000030128.1 (SMESG000030128.1)

HSP 1 Score: 261.922 bits (668), Expect = 7.877e-84
Identity = 176/403 (43.67%), Postives = 240/403 (59.55%), Query Frame = 2
Query:  107 TQQIPPTLALLSIISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDXXXXXXXXXXXXXXEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQV---HIEKKLTNLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKVRRKKDQLKGMNKM--------KRFKPKKLECKSHIKPKSQYRLENSDNS-PIYSRFVVSNYPGCNRNVKPLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVIKTLKNVRDTTLLQNLKLAAMLFVVGITYIVTFLPANLMANGIIKLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLKSFRFLRPVIRK 1279
            T QIP T+ +L IISV+G IGNL V++IY ++ DK T+N F+  LA SD   C+ IIP TI+IEF++W +    +CKSY F NNS IPF ALLI+LIA+DR+FC+C+PFL +M + RSK+ + I  M+S +LG L+ FQV    + K  TN++    +  S C++ S +AN +  + LF+ I Q+SQL+SY+ICI +VI LY  IY  V+   RKK +LKG+N          K FK + ++    I   S     N D S P  +   +   PG + N K +                                    +  ++T L+QN K A MLFVV ITYIVTFLPA LM N  + LNLPVFY+YY+NNAANPIIYCFMN+NFR  + +F F + +I+K
Sbjct:    9 TNQIPTTIGILIIISVIGSIGNLLVLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFMMSVVLGVLSVFQVKTFKLSKNSTNMN--STLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAICICVVICLYILIYRFVLAAARKKARLKGLNSSSTTSFLWNKFFKSRSIK---RINSDSN----NDDTSVPCQTTEELMTKPGPSNNDKAIK-----------------------------------RKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKNFREDVVNF-FHQHLIKK 366          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000064403.1 (SMESG000064403.1)

HSP 1 Score: 261.536 bits (667), Expect = 1.291e-83
Identity = 164/396 (41.41%), Postives = 233/396 (58.84%), Query Frame = 2
Query:  101 QSTQQIPPTLALLSIISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDXXXXXXXXXXXXXXEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQVHIEKKLTNLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKVRRKKDQLKGMNKMKRFKPKKL-ECKSHIK------------PKSQYRLENSDNSPIYSRFVVSNYPGCNRNVKPLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVIKTLKNVRDTTLLQNLKLAAMLFVVGITYIVTFLPANLMANGIIKLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLKS 1249
            Q   Q+  TL +LS+I V+G +GN  VI++Y R+ D++T+ LF+ +LA +D FTCI IIP TI+IE+ EWGI S+F+CK Y FFNN  IPFSA LISLIA+DRY CICHPF + M L +SK+ + + L +S LLG  ++FQV + K + + +D+   N   C + S+  N + ++KLF+ I QK QL+SY+ CI++VI LY  IY  V++ RRKK  LKG+  +K  KP  L E +S++             P     L ++ ++P    F+    P   R                                       +L+++ DT + QN + AAML VV + YI++FLPA LM N    L +P+FY+YY+NNAANPIIYCFMN  FR  +K+
Sbjct:   17 QDGSQVAATLIMLSVICVIGSLGNGLVIIVYTRKHDQLTTTLFINILAITDCFTCITIIPMTIYIEYWEWGISSAFLCKLYYFFNNCTIPFSAFLISLIAIDRYICICHPFNKFMTLFKSKVSVGLVLTVSVLLGIASTFQVKMIKGI-HPNDLT--NSYECADISKLTNTTTTEKLFFSIVQKIQLLSYTTCIILVICLYVAIYCKVLQTRRKKSILKGIKNVK--KPSYLWESRSNLTNVPDLDENPIKLPDGDTMLSSAKSTPNSKSFLTVPKPEHRR--------------------------------------VSLRSICDTQIFQNFRTAAMLSVVALMYIISFLPAFLMINYPQILYIPLFYMYYINNAANPIIYCFMNARFREDIKA 369          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000037778.1 (SMESG000037778.1)

HSP 1 Score: 182.57 bits (462), Expect = 3.578e-53
Identity = 152/387 (39.28%), Postives = 210/387 (54.26%), Query Frame = 2
Query:  110 QQIPPTLALLSIISVVGGIGNLFVILIY-IRQCDKVTSNLFMTVLAGSDXXXXXXXXXXXXXXEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQVHIEKKLTNLSDIGPMNMSF--CVEASEW---ANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKVRRKKDQLKGMNKMKRFKPKKLECKSHIKPKSQYRLENSDNSPIYSRFVVSNYPGCNRNVKPLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVIKTLKN--VRDTTLLQNLKLAAMLFVVGITYIVTFLPANLMANGIIKLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLK 1246
             QIP  +  + + S +G +GN  VILIY +++ +  T +LF+ VLA  D  TC+ +IP T+  EF  W IGS  +C  Y   N   +PFS+LL S +A+DRY  ICHPF QI  + R+K+ I I+L L +L   + + Q          S+I   N S   C + S+      +S   K+FY I  K     Y  CI++VI LY  IY  +I +R +K QL+G          +++ KSH    S   +  S+ +      V     G N N   L  P          + SS  S N SVN++    I+++    ++D+ LLQN++ A MLFVV I YI +F+PA LMAN +I LNL VFYLYYVNNAANPIIYCFMN+ FR   K
Sbjct:    7 HQIPIAMITMCVNSFIGCVGNGIVILIYCVQRNENCTVSLFIFVLAVIDFSTCLCVIPFTVVNEFLLWYIGSPALCFIYYVLNTFNVPFSSLLTSCVAIDRYCSICHPFHQIFTVHRAKILI-ISLGLFSLFLAITTTQFAFLSMAELASNISQGNKSEYKCTDPSQLTFHTVKSAHLKMFY-ILLKINHSCYVFCIIVVILLYILIYRAIILLRYRKRQLQG----------RIDAKSHEMMSSFMAIRKSEVAIPNISLV-----GLNPNENYLKIPQIKSGSFACYSRSSCCSRNFSVNDNFQTQIRSISKSLIKDSDLLQNIRSAIMLFVVAIVYITSFIPALLMANKMISLNLAVFYLYYVNNAANPIIYCFMNQQFRADFK 376          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000064085.1 (SMESG000064085.1)

HSP 1 Score: 152.14 bits (383), Expect = 7.710e-42
Identity = 126/386 (32.64%), Postives = 187/386 (48.45%), Query Frame = 2
Query:  125 TLALLSIISVVGGIGNLFVILIYIRQCDKVTSN--LFMTVLAGSDXXXXXXXXXXXXXXEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQVHIEKKLTNLSDIGPMNMS-----FCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKVRRKKDQLKGMNKMKRFKPK-KLECKSHIKPKSQYRLENSDNSPIYSRFVVSNYPGCNRNVKPLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVIKTLKNVRDTTLLQNLKLAAMLFVVGITYIVTFLPANLM-ANGIIKLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLKSFR 1255
            T+ LLS ++VVG IGN  V+L+Y R   +  +N   F+ +LA SD+  CI ++P TI++E   + I S   CKSY F N S + FS LLI +IA DRY  ICHP   I+ L+R+K  +     +S   G LA   V ++   ++       N S      C E     N + SQ +FY+I +KS    Y+  I+++I  YS+I+  +I+ RRK +  K       F P    +  +  +PKS   L       +      S +  C +N         +  +                         T K    +  LQN++ A++L VV   Y+++FLP  L+ A  +I  NL +++ YYVNNA NPIIYCFM   F  +LK  R
Sbjct:   16 TIILLSFVTVVGAIGNFLVLLVY-RNKRRHENNDIFFIIILAASDLAVCIILVPGTIYVELKAFEI-SEIACKSYYFLNTSNLVFSTLLILVIAFDRYLSICHPLKSILPLARAKKLVIFLFFISVTQGILAMLSVKLKLSTSSPGTYISSNTSIVKKFICDEIKHNLNITKSQMIFYEIVEKSNHFLYTSSIILIILFYSSIFKVIIRFRRKDNYYK-------FAPHFTDDFTTEYQPKSFVSLPKPRPKYLSPEIETSKWRICCQNDFKTEFKREHLSNR-----------------------NTDKKFERSKFLQNIRSASLLSVVTGAYVLSFLPVLLIVAFKVINFNLILYHFYYVNNAVNPIIYCFMKSRFLYQLKQMR 369          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tacr1a1.078e-629.51tachykinin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
tacr1a1.090e-629.51tachykinin receptor 1a [Source:NCBI gene;Acc:10000... [more]
tacr1a1.090e-629.51tachykinin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
tacr1b1.222e-628.69tachykinin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUC30.000e+0100.00GCR110 OS=Schmidtea mediterranea OX=79327 GN=gcr11... [more]
A0A193KUN52.832e-8043.67GCR056 OS=Schmidtea mediterranea OX=79327 GN=gcr05... [more]
A0A193KUG24.643e-8041.41GCR036 OS=Schmidtea mediterranea OX=79327 GN=gcr03... [more]
A0A193KU981.287e-4939.28GCR075 OS=Schmidtea mediterranea OX=79327 GN=gcr07... [more]
A0A5J4NU142.277e-4446.41G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
galr2a5.810e-628.63galanin receptor type 2 [Source:NCBI gene;Acc:1011... [more]
DRD56.425e-624.78dopamine receptor D5 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078415.10.000e+0100.00SMESG000078415.1[more]
SMESG000030128.17.877e-8443.67SMESG000030128.1[more]
SMESG000064403.11.291e-8341.41SMESG000064403.1[more]
SMESG000037778.13.578e-5339.28SMESG000037778.1[more]
SMESG000064085.17.710e-4232.64SMESG000064085.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007024 ID=SMED30007024|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1295bp
CTTATGTTGATGATATCAAGCTCCATGGTGTATTTATATCGAAAGGAAAT
TTCAAGTCTATTAATTTCATTTAGAATAAAATAAATAAATTAAAAAAATG
CAGTCAACTCAACAAATCCCACCGACATTGGCATTGCTATCAATTATAAG
TGTTGTTGGTGGCATCGGCAATCTATTTGTAATTCTTATATATATCAGAC
AATGTGACAAAGTCACCAGTAACCTTTTTATGACAGTACTTGCCGGATCA
GATATTTTTACATGCATTTTCATTATTCCTACGACAATATTCATTGAATT
CCATGAATGGGGTATTGGAAGCTCATTTGTTTGTAAATCATATATGTTTT
TTAACAATTCTTTAATACCATTCAGTGCTCTTTTGATTAGTTTAATTGCA
ATGGATCGGTACTTTTGTATTTGCCATCCGTTTTTGCAAATTATGAACCT
GAGTCGATCCAAATTGTTTATATGTATAGCTTTGATGTTATCAACTCTAC
TTGGAACTTTAGCATCTTTTCAAGTTCACATTGAGAAAAAACTGACAAAT
TTAAGCGATATTGGGCCGATGAATATGTCGTTCTGTGTTGAAGCATCTGA
ATGGGCAAATCGTTCAATGTCTCAAAAGCTTTTCTATCAAATTACACAAA
AAAGCCAACTTGTCAGTTATTCAATCTGTATACTAATAGTAATCGGGCTG
TATTCAACTATCTATTACACAGTGATCAAAGTACGAAGGAAAAAAGACCA
ACTAAAGGGAATGAATAAAATGAAAAGATTCAAACCTAAAAAGCTTGAGT
GTAAGTCTCACATTAAACCGAAATCTCAATATCGACTCGAAAATTCAGAC
AATTCTCCAATTTACAGTCGGTTTGTTGTGTCAAATTATCCGGGTTGTAA
TAGAAATGTGAAACCATTGGGAAACCCTTCAACAAACCATCATCATTCCA
ATTCTCCGACGAATTCCTCAATGAATTCGTTAAACAATTCTGTGAACAAT
TCCTCGTCAATTGTCATTAAAACCTTGAAAAACGTCAGAGATACCACTTT
GCTCCAGAATCTCAAATTGGCTGCCATGTTATTTGTCGTCGGAATAACTT
ACATTGTGACGTTTCTACCCGCCAATTTAATGGCCAATGGAATTATTAAA
CTTAATTTACCCGTATTTTATTTATATTACGTTAATAATGCTGCAAATCC
TATTATTTATTGTTTCATGAATCGAAACTTTCGTAACAAATTGAAATCTT
TTAGATTTTTGAGGCCGGTAATCAGGAAATAGTATGATTTTGTCA
back to top

protein sequence of SMED30007024-orf-1

>SMED30007024-orf-1 ID=SMED30007024-orf-1|Name=SMED30007024-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=395bp
MQSTQQIPPTLALLSIISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAG
SDIFTCIFIIPTTIFIEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLI
AMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQVHIEKKLT
NLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIG
LYSTIYYTVIKVRRKKDQLKGMNKMKRFKPKKLECKSHIKPKSQYRLENS
DNSPIYSRFVVSNYPGCNRNVKPLGNPSTNHHHSNSPTNSSMNSLNNSVN
NSSSIVIKTLKNVRDTTLLQNLKLAAMLFVVGITYIVTFLPANLMANGII
KLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLKSFRFLRPVIRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 9..33
score: 24.88
coord: 324..348
score: 19.11
coord: 353..379
score: 33.13
coord: 41..62
score: 24.37
coord: 86..108
score: 25.48
coord: 183..206
score: 17.93
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 24..371
e-value: 5.4E-22
score: 78.4
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 92..108
NoneNo IPR availablePANTHERPTHR24230G-PROTEIN COUPLED RECEPTORcoord: 9..385
NoneNo IPR availableCDDcd152077tmA_NPFFRcoord: 327..380
e-value: 5.4669E-5
score: 42.2233
NoneNo IPR availableCDDcd152037tmA_NPYR-likecoord: 15..229
e-value: 2.01273E-19
score: 85.7339
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 8..388
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
NoneNo IPR availableTMHMMTMhelixcoord: 123..145
NoneNo IPR availableTMHMMTMhelixcoord: 188..210
NoneNo IPR availableTMHMMTMhelixcoord: 81..102
NoneNo IPR availableTMHMMTMhelixcoord: 356..375
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 324..346
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 24..371
score: 21.716