G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30007022
Length (bp)1594
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30007022) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30007022) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30007022) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30007022) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007022

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30007022SMESG000048976.1 dd_Smed_v4_14016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: srw-142 (Serpentine Receptor, class W [Source:UniProtKB/TrEMBL;Acc:O61970])

HSP 1 Score: 51.6026 bits (122), Expect = 7.627e-7
Identity = 63/251 (25.10%), Postives = 116/251 (46.22%), Query Frame = 1
Query:  652 FLCKLMEYVPNAAYLASSWIVIIFSCDRIITIFRPLKFMSIYYQLYAWAGSVVTIIFAFLLNICIV---------IIYEKILDKKHGLAMSNIKCEISSLY-KATDFICKYCLYLKLMGAFVIPNFLVLIMNFIICVKLWKIQTTRCKLLPSDSKNNVLEMSRVIGHLALSSCFILMTMPLVIAIILRMNSDRRNYKKLYPEYHDFLKHLSRLFSSVKDINYASDFFLCIFFLPNFRWRFLRYACLFCRRK 1374
            FL +++  + + +  +S+W++   +  R + I  P+K  + Y +L     S + II   L+  C +         I  EK     +   + +    IS L+ +  + I KY   +  M + +IP FL  ++ F++  +LWK +  R +LL S   N+ ++ ++++  L L+S F +   P+ IA  +    D+       P        +  LFS +  +N  S FF+CI  L + R+R      +FC RK
Sbjct:  112 FLDRILIMLKDHSQRSSTWLLFSIALIRTLVIRNPMK--TEYEKLTKPPTSFLAIIVVSLV-FCPISISTFLEYDIFSEKYKSTCNPKGVLSYYLYISDLFERNNEVILKYVTLVNAMVSNIIPCFLFPVVTFLLVKELWKNEINRGRLLSSKKVNDSIKSTQLV--LLLTSMFFIAQFPIGIANGVSYFFDKN------PGITKIFHEIMFLFSIMLVLNTISHFFICI--LISSRYRAEVKKVIFCGRK 349          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: srw-141 (Serpentine Receptor, class W [Source:UniProtKB/TrEMBL;Acc:O61908])

HSP 1 Score: 48.9062 bits (115), Expect = 5.222e-6
Identity = 61/251 (24.30%), Postives = 116/251 (46.22%), Query Frame = 1
Query:  652 FLCKLMEYVPNAAYLASSWIVIIFSCDRIITIFRPLKFMSIYYQLYAWAGSVVTII----FAFLLNICIVIIYEKILDKKHGLAMS-----NIKCEISSLYKATD-FICKYCLYLKLMGAFVIPNFLVLIMNFIICVKLWKIQTTRCKLLPSDSKNNVLEMSRVIGHLALSSCFILMTMPLVIAIILRMNSDRRNYKKLYPEYHDFLKHLSRLFSSVKDINYASDFFLCIFFLPNFRWRFLRYACLFCRRK 1374
            FL +++  + + +  +S+W++   +  R + I  P+K  + Y +L     S   II      F ++I   + Y+ I  +K+  A +     +    IS L++  +  I KY      M + +IP FL  ++ F++  +LWK +  R +LL S   N+ ++ ++++  L L+  F +   P+ IA  +    D+       P        +  LFS +  +N  S FF+CIF    +R    +   +FC R+
Sbjct:  112 FLDRILIMLKDHSQRSSTWLLFSIALIRTLVIRNPMK--TEYEKLTKPPTSFFAIIGISLLFFPISISTFLEYD-IFSEKYKSACNPKGVLSFYLYISKLFERNNGVILKYVTLGNAMVSNIIPCFLFPVVTFLLVKELWKNENNRWRLLSSKKVNDSIKSTQLV--LLLTCMFFIAQFPIGIASGVSYFFDKN------PGITKIFHEIMFLFSIMLVLNTISHFFICIFISSQYRAEVKK--VIFCGRR 349          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183L9P8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS523 PE=4 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.369e-69
Identity = 134/332 (40.36%), Postives = 205/332 (61.75%), Query Frame = 1
Query:  403 VDIFRAYFSIWISIIGITGNFIVLFVFAKERQKSRFSIYCMLLAMVHIVILFTNSFLDDFLGRGVTYLSNYTFTSSKIDIKSDFLCKLMEYVPNAAYLASSWIVIIFSCDRIITIFRPLKFMSIYYQLYAWAGSVVTIIFAFLLNICIVIIYEKILDKKHGLAMSNIKCEISSLYKATDFICKYCLYLKLMGAFVIPNFLVLIMNFIICVKLWKIQTTRCKLLPSDSKNNVLEMSRVIGHLALSSCFILMTMPLVIAIILRMNSDRRNYKKLYPEYHDFLKHLSRLFSSVKDINYASDFFLCIFFLPNFRWRFLRYAC-LFCRRKEWFRLSR 1395
            V  FRAY    I+IIG+ GN  ++ +F KE+Q SRFSIY + LA+ +I+ L  N+F+DDFLGRG+ Y +N+ F   K+D  S F CK +EY+ N  Y  SS++++IFS DR++TI +P+KF SIY++ +A    ++  +   L N  ++ +   ++DK    + +N  C + S +     + K+ +  + +  F IP  LVL +N  IC++LWK++  R  LLP+DS  N +EM RV GHLALS+ F+L+ +P+V  +++R++    +  +  P Y   +  LSRLFSSVKDI YA +FFL + FL NFR  F R  C + C++     L R
Sbjct:   14 VGSFRAYICPIIAIIGVIGNSFIIIIFLKEKQLSRFSIYSIFLAIANIITLIMNTFIDDFLGRGLYYATNHQF-YFKLDTISTFWCKSVEYISNTMYFTSSYLIVIFSIDRLLTIHKPIKFYSIYHKHWAMIACILVYLMGILSNSPLLFVQTLMVDKS---SRTNFTCRMISEHP----VAKFTITFETIVTFTIPFCLVLFLNIFICIELWKLKVNRTALLPADSSRNCMEMGRVSGHLALSTAFLLLYLPMVCFVLIRLSLTLSHVDRHKP-YAMCIIDLSRLFSSVKDITYAVNFFLYLIFLRNFRHGFRRSICTVSCKKMSPRPLDR 336          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183P8J0 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS10676 PE=4 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 6.208e-69
Identity = 131/318 (41.19%), Postives = 198/318 (62.26%), Query Frame = 1
Query:  403 VDIFRAYFSIWISIIGITGNFIVLFVFAKERQKSRFSIYCMLLAMVHIVILFTNSFLDDFLGRGVTYLSNYTFTSSKIDIKSDFLCKLMEYVPNAAYLASSWIVIIFSCDRIITIFRPLKFMSIYYQLYAWAGSVVTIIFAFLLNICIVIIYEKILDKKHGLAMSNIKCEISSLYKATDFICKYCLYLKLMGAFVIPNFLVLIMNFIICVKLWKIQTTRCKLLPSDSKNNVLEMSRVIGHLALSSCFILMTMPLVIAIILRMNSDRRNYKKLYPEYHDFLKHLSRLFSSVKDINYASDFFLCIFFLPNFRWRFLRYAC 1356
            V  FRAY    I+IIG+ GN  ++ +F KE+Q SRFSIY + LA+ +I+ L  N+F+DDFLGRG+ Y +N+ F   K+D  S F CK +EY+ N  Y  SS++++IFS DR++TI +P+KF SIY++ +A    ++      L N  ++ +   ++DK    + +N  C + S +     + K+ +  + +  F IP  LVL +N  IC++LWK++  R  LLP+DS  N +EM RV GHLALS+ F+L+ +P+V  +++R++    +  +  P Y   +  LSRLFSSVKDI YA +FFL + FL NFR  F R  C
Sbjct:   14 VGSFRAYICPIIAIIGVIGNSFIVIIFLKEKQLSRFSIYSIFLAIANIITLIMNTFIDDFLGRGLYYATNHQF-YFKLDTISTFWCKSVEYISNTMYFTSSYLIVIFSIDRLLTIHKPIKFYSIYHKHWALIACILVYSMGILSNSPLLFVQTLMVDKS---SRTNFTCRMISEHP----VAKFTITFETIVTFTIPFCLVLFLNVFICIELWKLKVNRTALLPADSSRNRMEMGRVFGHLALSTAFLLLYLPMVCFVLIRLSLTLSHVDRHKP-YAMCIIDLSRLFSSVKDITYAVNFFLYLIFLRNFRHGFQRSIC 322          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A094ZE57 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma haematobium OX=6185 GN=MS3_00775 PE=4 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.918e-68
Identity = 133/332 (40.06%), Postives = 203/332 (61.14%), Query Frame = 1
Query:  403 VDIFRAYFSIWISIIGITGNFIVLFVFAKERQKSRFSIYCMLLAMVHIVILFTNSFLDDFLGRGVTYLSNYTFTSSKIDIKSDFLCKLMEYVPNAAYLASSWIVIIFSCDRIITIFRPLKFMSIYYQLYAWAGSVVTIIFAFLLNICIVIIYEKILDKKHGLAMSNIKCEISSLYKATDFICKYCLYLKLMGAFVIPNFLVLIMNFIICVKLWKIQTTRCKLLPSDSKNNVLEMSRVIGHLALSSCFILMTMPLVIAIILRMNSDRRNYKKLYPEYHDFLKHLSRLFSSVKDINYASDFFLCIFFLPNFRWRFLRYAC-LFCRRKEWFRLSR 1395
            V  FRAY    I+IIG+ GN  ++ +F KE+Q SRFSIY + LA+ +I+ L  N+F+DDFLGRG+ Y +N+ F   K+D  S F CK +EY+ N  Y  SS++++IFS DR++TI +P+KF SIY++ +A    ++      L N  ++ +   ++D     + +N  C + S +     + K+ +  + +  F IP  LVL +N  IC++LWK++  R  LLP+DS  N +EM RV GHLALS+ F+L+ +P+V  +++R++    +  +  P Y   +  LSRLFSSVKDI YA +FFL + FL NFR  F R  C + C++     L R
Sbjct:   14 VGSFRAYICPIIAIIGVIGNSFIVIIFLKEKQLSRFSIYSIFLAIANIITLIMNTFIDDFLGRGLYYATNHQF-YFKLDTISTFWCKSVEYISNTMYFTSSYLIVIFSIDRLLTIHKPIKFYSIYHKHWALIACILAYSMGILSNSPLLFVQTLMVDTS---SRTNFTCRMISEHP----VAKFTITFETIVTFTIPFCLVLFLNVFICIELWKLKVNRTALLPTDSSRNRMEMGRVFGHLALSTAFLLLYLPMVCFVLIRLSLTLSHVDRHKP-YAMCIIDLSRLFSSVKDITYAVNFFLYLIFLRNFRHGFQRSICTVSCKKMSPRPLDR 336          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A430QMQ3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0001525 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 2.476e-68
Identity = 133/332 (40.06%), Postives = 203/332 (61.14%), Query Frame = 1
Query:  403 VDIFRAYFSIWISIIGITGNFIVLFVFAKERQKSRFSIYCMLLAMVHIVILFTNSFLDDFLGRGVTYLSNYTFTSSKIDIKSDFLCKLMEYVPNAAYLASSWIVIIFSCDRIITIFRPLKFMSIYYQLYAWAGSVVTIIFAFLLNICIVIIYEKILDKKHGLAMSNIKCEISSLYKATDFICKYCLYLKLMGAFVIPNFLVLIMNFIICVKLWKIQTTRCKLLPSDSKNNVLEMSRVIGHLALSSCFILMTMPLVIAIILRMNSDRRNYKKLYPEYHDFLKHLSRLFSSVKDINYASDFFLCIFFLPNFRWRFLRYAC-LFCRRKEWFRLSR 1395
            V  FRAY    I+IIG+ GN  ++ +F KE+Q SRFSIY + LA+ +I+ L  N+F+DDFLGRG+ Y +N+ F   K+D  S F CK +EY+ N  Y  SS++++IFS DR++TI +P+KF SIY++ +A    ++      L N  ++ +   ++D     + +N  C + S +     + K+ +  + +  F IP  LVL +N  IC++LWK++  R  LLP+DS  N +EM RV GHLALS+ F+L+ +P+V  +++R++    +  +  P Y   +  LSRLFSSVKDI YA +FFL + FL NFR  F R  C + C++     L R
Sbjct:   14 VGSFRAYICPIIAIIGVIGNSFIVIIFLKEKQLSRFSIYSIFLAIANIITLIMNTFIDDFLGRGLYYATNHQF-YFKLDTISTFWCKSVEYISNTMYFTSSYLIVIFSIDRLLTIHKPIKFYSIYHKHWALIACILVYSMGILSNSPLLFVQTLMVDTS---SRTNFTCRMISEHP----VAKFTITFETIVTFTIPFCLVLFLNVFICIELWKLKVNRTALLPADSSRNRMEMGRVFGHLALSTAFLLLYLPMVCFVLIRLSLTLSHVDRHKP-YAMCIIDLSRLFSSVKDITYAVNFFLYLIFLRNFRHGFQRSICTVSCKKMSPRPLDR 336          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183KKN2 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS15594 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 3.593e-68
Identity = 130/318 (40.88%), Postives = 197/318 (61.95%), Query Frame = 1
Query:  403 VDIFRAYFSIWISIIGITGNFIVLFVFAKERQKSRFSIYCMLLAMVHIVILFTNSFLDDFLGRGVTYLSNYTFTSSKIDIKSDFLCKLMEYVPNAAYLASSWIVIIFSCDRIITIFRPLKFMSIYYQLYAWAGSVVTIIFAFLLNICIVIIYEKILDKKHGLAMSNIKCEISSLYKATDFICKYCLYLKLMGAFVIPNFLVLIMNFIICVKLWKIQTTRCKLLPSDSKNNVLEMSRVIGHLALSSCFILMTMPLVIAIILRMNSDRRNYKKLYPEYHDFLKHLSRLFSSVKDINYASDFFLCIFFLPNFRWRFLRYAC 1356
            V  FRAY    I+IIG+ GN  ++ +F KE+Q SRFSIY + LA+ +I+ L  N+F+DDFLGRG+ Y +N+ F   K+D  S F CK +EY+ N  Y  SS++++IFS DR++TI +P+KF SIY++ +A    ++      L N  ++ +   ++D     + +N  C + S +     + K+ +  + +  F IP  LVL +N  IC++LWK++  R  LLP+DS  N +EM RV GHLALS+ F+L+ +P+V  +++R++    +  +  P Y   +  LSRLFSSVKDI YA +FFL + FL NFR  F R  C
Sbjct:   14 VGSFRAYICPIIAIIGVIGNSFIVIIFLKEKQLSRFSIYSIFLAIANIITLIMNTFIDDFLGRGLYYATNHQF-YFKLDTISTFWCKSVEYISNTMYFTSSYLIVIFSIDRLLTIHKPIKFYSIYHKHWALIACILVYSMGILSNSPLLFVQTLMVDTS---SRTNFTCRMISEHP----VAKFTITFETIVTFTIPFCLVLFLNVFICIELWKLKVNRTALLPADSSRNRMEMGRVFGHLALSTAFLLLYLPMVCFVLIRLSLTLSHVDRHKP-YAMCIIDLSRLFSSVKDITYAVNFFLYLIFLRNFRHGFQRSIC 322          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000048976.1 (SMESG000048976.1)

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 419/419 (100.00%), Postives = 419/419 (100.00%), Query Frame = 1
Query:  328 MAYNFSRISKTLYSHRRFSSATEISVDIFRAYFSIWISIIGITGNFIVLFVFAKERQKSRFSIYCMLLAMVHIVILFTNSFLDDFLGRGVTYLSNYTFTSSKIDIKSDFLCKLMEYVPNAAYLASSWIVIIFSCDRIITIFRPLKFMSIYYQLYAWAGSVVTIIFAFLLNICIVIIYEKILDKKHGLAMSNIKCEISSLYKATDFICKYCLYLKLMGAFVIPNFLVLIMNFIICVKLWKIQTTRCKLLPSDSKNNVLEMSRVIGHLALSSCFILMTMPLVIAIILRMNSDRRNYKKLYPEYHDFLKHLSRLFSSVKDINYASDFFLCIFFLPNFRWRFLRYACLFCRRKEWFRLSRWGQIFERNVQKFDSSIVKRKFGTSLHQQSNNNLEMKSNLLERSLSPLQKQAFKRSLFKNLTII 1584
            MAYNFSRISKTLYSHRRFSSATEISVDIFRAYFSIWISIIGITGNFIVLFVFAKERQKSRFSIYCMLLAMVHIVILFTNSFLDDFLGRGVTYLSNYTFTSSKIDIKSDFLCKLMEYVPNAAYLASSWIVIIFSCDRIITIFRPLKFMSIYYQLYAWAGSVVTIIFAFLLNICIVIIYEKILDKKHGLAMSNIKCEISSLYKATDFICKYCLYLKLMGAFVIPNFLVLIMNFIICVKLWKIQTTRCKLLPSDSKNNVLEMSRVIGHLALSSCFILMTMPLVIAIILRMNSDRRNYKKLYPEYHDFLKHLSRLFSSVKDINYASDFFLCIFFLPNFRWRFLRYACLFCRRKEWFRLSRWGQIFERNVQKFDSSIVKRKFGTSLHQQSNNNLEMKSNLLERSLSPLQKQAFKRSLFKNLTII
Sbjct:    1 MAYNFSRISKTLYSHRRFSSATEISVDIFRAYFSIWISIIGITGNFIVLFVFAKERQKSRFSIYCMLLAMVHIVILFTNSFLDDFLGRGVTYLSNYTFTSSKIDIKSDFLCKLMEYVPNAAYLASSWIVIIFSCDRIITIFRPLKFMSIYYQLYAWAGSVVTIIFAFLLNICIVIIYEKILDKKHGLAMSNIKCEISSLYKATDFICKYCLYLKLMGAFVIPNFLVLIMNFIICVKLWKIQTTRCKLLPSDSKNNVLEMSRVIGHLALSSCFILMTMPLVIAIILRMNSDRRNYKKLYPEYHDFLKHLSRLFSSVKDINYASDFFLCIFFLPNFRWRFLRYACLFCRRKEWFRLSRWGQIFERNVQKFDSSIVKRKFGTSLHQQSNNNLEMKSNLLERSLSPLQKQAFKRSLFKNLTII 419          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000003388.1 (SMESG000003388.1)

HSP 1 Score: 261.151 bits (666), Expect = 3.954e-82
Identity = 139/331 (41.99%), Postives = 209/331 (63.14%), Query Frame = 1
Query:  394 EISVDIFRAYFSIWISIIGITGNFIVLFVFAKERQKSRFSIYCMLLAMVHIVILFTNSFLDDFLGRGVTYLSNYTFTSSKIDIKSDFLCKLMEYVPNAAYLASSWIVIIFSCDRIITIFRPLKFMSIYYQLYAWAGSVVTIIFAFLLNICIVIIYEKI-LDKKHGLAMSNIKCEISSLYKATDFICKYCLYLKLMGAFVIPNFLVLIMNFIICVKLWKIQTTRCKLL--------------PSDSKNNVLEMSRVIGHLALSSCFILMTMPLVIAIILRMNSDRRNYKKLYPEYHDFLKHLSRLFSSVKDINYASDFFLCIFFLPNFRWRF 1341
            E+ V  FRAY +  ++++GI GN  V+ +F  E + SRFS+YC+ LA V +V L  NSF+DDFLGRG++++  Y   + K D  SD  CK+MEYVPN  +  +S++ ++FS DR++TI +PLKF S+YY  Y+    V T +F F +NI +++ Y  I  + + G+ +   KC + +   A  F+  + LYL L+G+F IP F+VLI+N +I +KLW++   R ++               PS  KN   E++RV+GHLA++  F+L+TMPLVI IILRM SD           ++  +HLSRLFSS+KD+N++ +FF+ + FLPNFR  F
Sbjct:   19 EVVVGSFRAYVTPVVAVVGIFGNIFVILIFYFETKLSRFSVYCISLAFVQLVALIVNSFMDDFLGRGLSHVLGYYLLAFKWDTHSDMSCKMMEYVPNTMFFIASFVTVLFSIDRLLTIHQPLKFHSVYYIKYSIMACVGTFLFGFAINIPLLLSYGLIKQENEFGITL---KCTVVAT-GARKFVADFGLYLVLLGSFTIPTFIVLILNTLISIKLWQLHLNRAEMTKSFDTSDSKSSAINPSLMKNQEKELNRVLGHLAVNVVFLLLTMPLVIVIILRMYSDDNKMYLTNLYLYNSFQHLSRLFSSLKDVNFSCEFFIYMIFLPNFRNGF 345          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000070788.1 (SMESG000070788.1)

HSP 1 Score: 250.751 bits (639), Expect = 8.988e-78
Identity = 138/339 (40.71%), Postives = 214/339 (63.13%), Query Frame = 1
Query:  403 VDIFRAYFSIWISIIGITGNFIVLFVFAKERQKSRFSIYCMLLAMVHIVILFTNSFLDDFLGRGVTYLSNYTFTSSKIDIKSDFLCKLMEYVPNAAYLASSWIVIIFSCDRIITIFRPLKFMSIYYQLYAWAGSVVTIIFAFLLNICIVIIYEKILDKKHGLAMSNIKCEISSLYKATDFICKYCLYLKLMGAFVIPNFLVLIMNFIICVKL------WKIQTTRCKLLP--------------SDSKNNVLEMSRVIGHLALSSCFILMTMPLVIAIILRM---NSDRRNYKKLYPEYHDFLKHLSRLFSSVKDINYASDFFLCIFFLPNFRWRFLRY 1350
            V +FR + +  + +IG  GN  ++ +F+KE + SRFSIYC+ LA+ H + LFTN FLDDFLGRG+ Y+++ + +  K+D+ S+  CKLMEY+PN+ Y ASS I+++FS DR++TI++P+K  + YY   +       +   F+LNI + + Y  + DK H L     KC++      T+ I ++ +Y+KL GAF+ P F+VLI+N +I  K       + I   R + L               S ++    ++SR++GH+A++S F+ +T+PLVI IILR+   N+D+R +  LY  Y++ LKHLSRLFSS+KDINYAS+FF+ + FLPNF   F+ +
Sbjct:   16 VGVFRGFITPLLCVIGFIGNGFIILIFSKETKISRFSIYCITLAITHSLALFTNGFLDDFLGRGLAYVTHNSHSVCKLDVFSNESCKLMEYIPNSLYFASSAIIVVFSIDRLLTIYQPIKMFAAYYLNLSIFICGFCVSAGFILNIPLFMSYSLVKDKYHALHEWEYKCDMLVGKSGTEIISRFAIYMKLFGAFICPTFIVLILNTVIIYKFCTLNRKFNIYNDRNRNLVNKSTLKRHSTGIFFSKTQTQDGDLSRIVGHIAVNSAFLSLTLPLVIVIILRIYSENTDKREH-GLY--YYNSLKHLSRLFSSIKDINYASNFFVYMKFLPNFYNGFMEF 351          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000079690.1 (SMESG000079690.1)

HSP 1 Score: 225.713 bits (574), Expect = 6.285e-68
Identity = 146/379 (38.52%), Postives = 223/379 (58.84%), Query Frame = 1
Query:  394 EISVDIFRAYFSIWISIIGITGNFIVLFVFAKERQKSRFSIYCMLLAMVHIVILFTNSFLDDFLGRGVTY-LSNYTFTSSKIDIKSDFLCKLMEYVPNAAYLASSWIVIIFSCDRIITIFRPLKFMSIYYQLYAWAGSVVTIIFAFLLNICIVIIYEKILDKKHGLAMSNIKCEISSLYKATDFICKYCLYLKLMGAFVIPNFLVLIMNFIICVKLWKIQTTRCKLLPSDSKNNVLEMSRVIGHLALSSCFILMTMPLVIAIILRMNSDRRNYKKLYPEYHDFLKHLSRLFSSVKDINYASDFFLCIFFLPNFRWRFLRYACLFCRRKEWFRLSRWGQIFERNVQKFDSSIVKRKFGTSLHQQSN-NNLEMKSNLLERS 1524
            + ++ ++R Y    I+I GI GN IV+ VF  E +KSRFSIYC+ ++  H+VIL  NS +DDF+G+G+ +    Y     K D  S  +C++MEYVPN  Y ASS ++++FS DRI+TIF+P++F SI+++ +A    ++ ++F+     CI+ I   +          ++KC + +     + I K  +  K+   F IP F++LI+N IIC+KLW+ +  R KLLP D + N LEM+R+ GHLAL++ F+L T PLV+A+++R  +    Y K+          LSRLFSSVKDI+Y+ DF L   FL NFRWRF++Y  +        R S  G   +  + K DS+  +RK+       S  NN  M S L+ ++
Sbjct:   15 DYAIGVYRLYAVPIIAIFGILGNIIVILVFLLEHKKSRFSIYCVAISSTHVVILIMNSLMDDFMGKGLEHWRPEYRI---KFDTYSLTMCRIMEYVPNCMYTASSGLLLVFSIDRIVTIFKPMQFYSIHFRKFAIYLCLIVVLFS-----CIITIPLFVSSHLEFQFNKSLKCALKN-----NTIGKVSVLTKVFVTFSIPTFIILILNIIICLKLWRAKIQRAKLLPGDLQKNNLEMNRICGHLALNTVFLLFTFPLVVAMLMRQYNGCSLYAKV----------LSRLFSSVKDISYSLDFLLYFIFLTNFRWRFIKYLAVPLLHCATVRKSSLGLYLDSKLMKHDSNSSRRKYSAIAAALSTCNNHHMFSVLMYKT 370          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000011885.1 (SMESG000011885.1)

HSP 1 Score: 216.468 bits (550), Expect = 5.034e-65
Identity = 130/340 (38.24%), Postives = 212/340 (62.35%), Query Frame = 1
Query:  403 VDIFRAYFSIWISIIGITGNFIVLFVFAKERQKSRFSIYCMLLAMVHIVILFTNSFLDDFLGRGVTYLS-----NYTFTSSKIDIKSDFLCKLMEYVPNAAYLASSWIVIIFSCDRIITIFRPLKFMSIYYQLYAWAGSVVTIIFAFLLNICIVIIYEKILDKKHGLAMSNIKCEISSLYKATDFICKYCLYLKLMGAFVIPNFLVLIMNFIICVKLWKIQTTRCKLLPSDSKNNVLEMSRVIGHLALSSCFILMTMPLVIAIILRMNSDRRNYKKLYPE-YHDFLKHLSRLFSSVKDINYASDFFLCIFFLPNFRWRFLRY--ACLFCRRKEWFRLSRW 1398
            V +FR Y S  I + G+ GN  V+ +F  +  ++RF+IY + LA  H++IL  ++FLDDF+GRG+ Y +     N+ F   K+D  S+  CK M+Y+P+  Y  SSWI ++FS DR +TI+RPL F S  +   +     V ++ +F++N+ +V+     ++K   +    +KC++  L ++  +I +  LY+K++ +F++P F++LI+N  I + L++I+ +R  L+P+D   N LEM+RVIGHL LSS F+L+  PL+I + +R N   R  + L  + + + L  LSRLFSS+KDI+YA+DF++ + FL NFRW FL +    L C   +  RL+ W
Sbjct:   11 VGLFRGYLSPVIFVFGLVGNIFVIRIFTDKPLRNRFAIYSIFLAGSHVIILVVDTFLDDFIGRGLAYAAYGKCNNHGF---KLDTISNASCKTMQYIPDTMYSISSWIFVVFSLDRALTIYRPLLFYSTLHTKKSLIFCCVVVVLSFIINVPLVVGSGLQINKSQNVTF--VKCDL--LTESQFYITRIELYIKMIFSFILPTFIILILNSFIIIILFQIKKSRRDLMPTDRAKNGLEMNRVIGHLGLSSFFLLLAFPLIITMFVRTNWTGRANENLNDKMFLEKLGDLSRLFSSLKDISYAADFYIYVLFLNNFRWYFLDHLIDILRCCIPKSKRLNEW 343          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
srw-1427.627e-725.10Serpentine Receptor, class W [Source:UniProtKB/Tr... [more]
srw-1415.222e-624.30Serpentine Receptor, class W [Source:UniProtKB/Tr... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183L9P81.369e-6940.36G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183P8J06.208e-6941.19G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A094ZE571.918e-6840.06G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A430QMQ32.476e-6840.06G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183KKN23.593e-6840.88G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048976.10.000e+0100.00SMESG000048976.1[more]
SMESG000003388.13.954e-8241.99SMESG000003388.1[more]
SMESG000070788.18.988e-7840.71SMESG000070788.1[more]
SMESG000079690.16.285e-6838.52SMESG000079690.1[more]
SMESG000011885.15.034e-6538.24SMESG000011885.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007022 ID=SMED30007022|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1594bp
TTTACATATAAATGTAACTAATTCATGTTATAAACAAACTATAATGTTAT
GCTTTCATATATTATCGCTATACGCGCATAATTTGAAAGAAATCCGTATT
CCAAATATGGTATTAATCCATGAACACGGAGTCTGGTTCCAGCATCATTC
CTGAAGCACCGAATCTCTGACTATTCATTCATTTAATTGCGTATTTGTAA
TCAGGAAATTCATTATTCAGTAAATGCTGTGATGCTATTCATCCAATCAG
ATTAGTCACTCATTTTCGCATTTTCAGCACATTTGTGTGCAATTCTCTTT
GAAAATTTTTTCCAATCTAGATTTTCAATGGCGTACAACTTTTCCCGAAT
TTCCAAGACTCTCTATTCTCATCGAAGATTCAGCAGTGCTACCGAAATCT
CAGTTGATATATTTCGGGCATATTTTTCCATTTGGATTTCCATAATCGGC
ATCACTGGGAACTTCATTGTTTTGTTTGTCTTTGCAAAAGAGCGACAAAA
GTCTCGATTTTCCATTTATTGTATGTTGTTAGCTATGGTACACATTGTAA
TTTTGTTTACCAATAGTTTTCTTGACGATTTCCTTGGAAGAGGTGTGACA
TATTTATCGAATTACACATTTACTAGCTCTAAAATAGATATCAAATCTGA
CTTCCTTTGTAAATTAATGGAATACGTTCCAAACGCTGCGTATTTGGCGT
CCTCCTGGATTGTCATCATATTTTCATGTGACAGGATTATTACAATATTT
AGGCCGCTGAAATTCATGTCCATTTATTATCAATTATACGCCTGGGCCGG
ATCAGTCGTTACAATTATTTTTGCATTTCTCCTCAATATTTGTATTGTTA
TAATATATGAAAAAATATTGGATAAGAAACACGGATTGGCGATGTCGAAC
ATCAAATGCGAAATTTCATCTTTGTACAAGGCAACAGATTTCATTTGCAA
ATATTGTCTTTATCTAAAACTGATGGGGGCTTTTGTCATACCGAACTTTC
TTGTGCTAATCATGAATTTTATAATCTGTGTAAAGCTCTGGAAAATTCAA
ACCACCCGCTGTAAACTTCTTCCGTCAGATTCGAAGAACAATGTTCTAGA
AATGAGTCGTGTTATCGGCCATTTAGCCTTAAGTAGCTGTTTCATATTAA
TGACAATGCCCCTGGTCATTGCAATCATACTTCGGATGAACTCTGATAGA
AGAAATTATAAAAAACTCTATCCGGAATATCACGATTTCTTAAAACATTT
ATCGCGGCTTTTTTCATCAGTTAAAGATATAAATTATGCATCGGATTTCT
TTCTCTGTATCTTCTTTCTTCCGAATTTCCGATGGAGATTTCTCAGATAC
GCCTGTTTGTTTTGTCGTCGAAAGGAATGGTTTAGGTTATCGAGATGGGG
ACAGATTTTTGAAAGAAATGTGCAAAAATTTGACAGTAGTATTGTGAAAA
GAAAATTCGGAACGTCCCTTCACCAGCAGTCAAATAATAATTTAGAAATG
AAGTCCAATTTATTAGAGCGGTCTCTCTCCCCTCTCCAGAAACAAGCTTT
CAAAAGATCATTATTTAAGAACCTTACTATCATTTGATAAATAT
back to top

protein sequence of SMED30007022-orf-1

>SMED30007022-orf-1 ID=SMED30007022-orf-1|Name=SMED30007022-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=420bp
MAYNFSRISKTLYSHRRFSSATEISVDIFRAYFSIWISIIGITGNFIVLF
VFAKERQKSRFSIYCMLLAMVHIVILFTNSFLDDFLGRGVTYLSNYTFTS
SKIDIKSDFLCKLMEYVPNAAYLASSWIVIIFSCDRIITIFRPLKFMSIY
YQLYAWAGSVVTIIFAFLLNICIVIIYEKILDKKHGLAMSNIKCEISSLY
KATDFICKYCLYLKLMGAFVIPNFLVLIMNFIICVKLWKIQTTRCKLLPS
DSKNNVLEMSRVIGHLALSSCFILMTMPLVIAIILRMNSDRRNYKKLYPE
YHDFLKHLSRLFSSVKDINYASDFFLCIFFLPNFRWRFLRYACLFCRRKE
WFRLSRWGQIFERNVQKFDSSIVKRKFGTSLHQQSNNNLEMKSNLLERSL
SPLQKQAFKRSLFKNLTII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 12..353
e-value: 1.6E-29
score: 104.8
NoneNo IPR availablePANTHERPTHR24229NEUROPEPTIDES RECEPTORcoord: 26..366
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 28..335
e-value: 1.02351E-14
score: 72.2804
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 26..350
NoneNo IPR availableTMHMMTMhelixcoord: 262..284
NoneNo IPR availableTMHMMTMhelixcoord: 31..53
NoneNo IPR availableTMHMMTMhelixcoord: 320..339
NoneNo IPR availableTMHMMTMhelixcoord: 60..82
NoneNo IPR availableTMHMMTMhelixcoord: 116..134
NoneNo IPR availableTMHMMTMhelixcoord: 215..237
NoneNo IPR availableTMHMMTMhelixcoord: 155..177
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 44..320
score: 20.251