5-hydroxytryptamine receptor 1A

Overview
Name5-hydroxytryptamine receptor 1A
Smed IDSMED30007010
Length (bp)1943
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 5-hydroxytryptamine receptor 1A (SMED30007010) t-SNE clustered cells

Violin plots show distribution of expression levels for 5-hydroxytryptamine receptor 1A (SMED30007010) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 5-hydroxytryptamine receptor 1A (SMED30007010) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 5-hydroxytryptamine receptor 1A (SMED30007010) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007010

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007010SMESG000017736.1 SmedASXL_012408SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30007010SMESG000017736.1 dd_Smed_v4_5341_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007010SMESG000017736.1 dd_Smed_v4_5341_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30007010SMESG000017736.1 dd_Smed_v4_5341_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30007010SMESG000017736.1 dd_Smed_v4_5341_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30007010SMESG000017736.1 dd_Smed_v6_5341_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007010SMESG000017736.1 dd_Smed_v4_5341_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30007010SMESG000017736.1 dd_Smed_v4_5341_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30007010SMESG000017736.1 dd_Smed_v4_5341_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30007010SMESG000017736.1 dd_Smed_v4_5341_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Human
Match: HTR1A (5-hydroxytryptamine receptor 1A [Source:HGNC Symbol;Acc:HGNC:5286])

HSP 1 Score: 238.424 bits (607), Expect = 2.224e-71
Identity = 143/368 (38.86%), Postives = 200/368 (54.35%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEP---FRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLP-------NQSGRTN-----SAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNP---------------RKKKQSNNES----------KAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N  V+ AI L + LQ  +N+LI SLA +D  VSVLV+P+A   Q++  +W   ++ CD FI  DVL CTSSIL+LCAI++DRY  IT P+ YV +RTP      I+  W+I  LISIPP++ W+ P     P  C ++++ GY IY+T GAFYIPL++MLVLY RIF+ AR   ++  K+   TG  T    +  P        +SG  N      ++    L      ++  +G      +V + G   +  P                +K + N E+          K + TLG+IMG F LCWLPFFI+ ++ P    S   H   LL     +  WLGY NS LNPVIYA FN++F+N FK+I+
Sbjct:   54 NACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLN-KWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSC--HMPTLLG---AIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Human
Match: HTR7 (5-hydroxytryptamine receptor 7 [Source:HGNC Symbol;Acc:HGNC:5302])

HSP 1 Score: 223.787 bits (569), Expect = 1.415e-65
Identity = 130/353 (36.83%), Postives = 186/353 (52.69%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKL-GTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLP-WCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGL 1551
            N LV++++  VKKL+ PSN+LI+SLA +D  V+V VMP      L+  +W F   FC+ FI  DV+ CT+SI+ LC ISIDRYL ITRP+ Y VR+    +   I   W++S  I++PP+  W +       C ++++ GY IY+T  AFYIP+ +ML +YY+I+K AR  A   AK K  G  ++  +   +L          EE   L R    +R                       +       E KA TTLG+I+G FT+CWLPFF++   +P +  +        +P W    FLWLGY NS +NP IYA FNR+ R  ++ +L     NIN ++      E   L
Sbjct:   99 NCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSA---AKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHER-----------------------KNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCS----CIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKL 421          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Human
Match: HTR7 (5-hydroxytryptamine receptor 7 [Source:HGNC Symbol;Acc:HGNC:5302])

HSP 1 Score: 223.016 bits (567), Expect = 1.891e-65
Identity = 130/353 (36.83%), Postives = 186/353 (52.69%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKL-GTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLP-WCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGL 1551
            N LV++++  VKKL+ PSN+LI+SLA +D  V+V VMP      L+  +W F   FC+ FI  DV+ CT+SI+ LC ISIDRYL ITRP+ Y VR+    +   I   W++S  I++PP+  W +       C ++++ GY IY+T  AFYIP+ +ML +YY+I+K AR  A   AK K  G  ++  +   +L          EE   L R    +R                       +       E KA TTLG+I+G FT+CWLPFF++   +P +  +        +P W    FLWLGY NS +NP IYA FNR+ R  ++ +L     NIN ++      E   L
Sbjct:   99 NCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSA---AKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHER-----------------------KNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCS----CIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKL 421          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Human
Match: HTR7 (5-hydroxytryptamine receptor 7 [Source:HGNC Symbol;Acc:HGNC:5302])

HSP 1 Score: 223.402 bits (568), Expect = 5.409e-65
Identity = 130/353 (36.83%), Postives = 186/353 (52.69%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKL-GTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLP-WCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGL 1551
            N LV++++  VKKL+ PSN+LI+SLA +D  V+V VMP      L+  +W F   FC+ FI  DV+ CT+SI+ LC ISIDRYL ITRP+ Y VR+    +   I   W++S  I++PP+  W +       C ++++ GY IY+T  AFYIP+ +ML +YY+I+K AR  A   AK K  G  ++  +   +L          EE   L R    +R                       +       E KA TTLG+I+G FT+CWLPFF++   +P +  +        +P W    FLWLGY NS +NP IYA FNR+ R  ++ +L     NIN ++      E   L
Sbjct:   99 NCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSA---AKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHER-----------------------KNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCS----CIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKL 421          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Human
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 206.453 bits (524), Expect = 6.594e-60
Identity = 118/343 (34.40%), Postives = 183/343 (53.35%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKE--PFRPGTCQLT-ENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFD--------VEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHC 1497
            N LVI AI + +KL  P+N+LI SLA +DF V+VLVMP ++   ++R  W   ++ CD ++  D+  CT SIL+L AI++DRY  IT  ++Y  +RTP   G  I   WIIS  IS+PP + W+     R   C +  +++   IY+T GAFYIPL ++L+LYY+I++ A+ +  +    ++   ++         N      S E+  K +        S  +    FD        +       K+  R+K     E KA TTLG+I+G F +CWLPFF+ +++  +    K+  E            WLGYLNS +NP+IY  FN +F+  F++++   C
Sbjct:   41 NSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIV-YIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAGIMITIVWIISVFISMPP-LFWRHQGTSRDDECIIKHDHIVSTIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRIAKEEV---------NGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCDKCKISEEM------SNFLAWLGYLNSLINPLIYTIFNEDFKKAFQKLVRCRC 366          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Celegans
Match: ser-7 (SERotonin/octopamine receptor family [Source:UniProtKB/TrEMBL;Acc:Q8T3C1])

HSP 1 Score: 222.246 bits (565), Expect = 1.531e-65
Identity = 136/375 (36.27%), Postives = 205/375 (54.67%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWK------EPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGT-------GPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPMQKTMSTSQYE 1587
            N LV LA+ LV+KL+ P N+L++SLA +DFFV ++VMP+A+ + L   +WP     C  +   D+ LCT+SI+NLCAIS+DRYLVI+ P++Y  +RT   I  +IA  WII+ ++SI   I+             GTCQ+  +  YQ YAT+ +FY P  IM++L  +I++ A+ +A +D  R +      D  +    N S  T     +++ +     +R +  N    F +E+               P  ++   +E KA  TLGVIM  F +CWLPFFI+ I K            ++  W   L LWLGY NS LNP+IY K+N+EFR PF+++L   C  +   +R  +F  +YG P++    +S Y 
Sbjct:   59 NALVCLAVLLVRKLKHPQNFLLVSLAVADFFVGLVVMPLALIDLLFD-KWPLGSTMCSVYTTSDLTLCTASIVNLCAISVDRYLVISSPLRYSAKRTTKRIMMYIACVWIIAAIVSISSHIIANLLNDGTYVDDTGTCQVIPHFIYQSYATIISFYAPTFIMVILNIKIWRAAKRLAAQD--RLMSHCNSVDASERP-RNGSAETKDFLNEKETIDVPKKERANSTN-SRLFKLERKYLHRPSAFFSAAKGPLIRQTEKSECKARKTLGVIMSVFIICWLPFFILAIFK--------SFGMWIPDWLDLLALWLGYSNSTLNPLIYCKYNKEFRIPFREMLACRCATLQTVMRQQSFTSRYGPPVRYRTQSSSYR 420          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Celegans
Match: ser-7 (SERotonin/octopamine receptor family [Source:UniProtKB/TrEMBL;Acc:Q8T3C1])

HSP 1 Score: 219.935 bits (559), Expect = 8.466e-65
Identity = 134/367 (36.51%), Postives = 202/367 (55.04%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWK------EPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGT-------GPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPMQK 1563
            N LV LA+ LV+KL+ P N+L++SLA +DFFV ++VMP+A+ + L   +WP     C  +   D+ LCT+SI+NLCAIS+DRYLVI+ P++Y  +RT   I  +IA  WII+ ++SI   I+             GTCQ+  +  YQ YAT+ +FY P  IM++L  +I++ A+ +A +D  R +      D  +    N S  T     +++ +     +R +  N    F +E+               P  ++   +E KA  TLGVIM  F +CWLPFFI+ I K            ++  W   L LWLGY NS LNP+IY K+N+EFR PF+++L   C  +   +R  +F  +YG P+ +
Sbjct:   59 NALVCLAVLLVRKLKHPQNFLLVSLAVADFFVGLVVMPLALIDLLFD-KWPLGSTMCSVYTTSDLTLCTASIVNLCAISVDRYLVISSPLRYSAKRTTKRIMMYIACVWIIAAIVSISSHIIANLLNDGTYVDDTGTCQVIPHFIYQSYATIISFYAPTFIMVILNIKIWRAAKRLAAQD--RLMSHCNSVDASERP-RNGSAETKDFLNEKETIDVPKKERANSTN-SRLFKLERKYLHRPSAFFSAAKGPLIRQTEKSECKARKTLGVIMSVFIICWLPFFILAIFK--------SFGMWIPDWLDLLALWLGYSNSTLNPLIYCKYNKEFRIPFREMLACRCATLQTVMRQQSFTSRYGPPVSR 412          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Celegans
Match: ser-7 (SERotonin/octopamine receptor family [Source:UniProtKB/TrEMBL;Acc:Q8T3C1])

HSP 1 Score: 218.779 bits (556), Expect = 1.712e-64
Identity = 134/365 (36.71%), Postives = 201/365 (55.07%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWK------EPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGT-------GPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPM 1557
            N LV LA+ LV+KL+ P N+L++SLA +DFFV ++VMP+A+ + L   +WP     C  +   D+ LCT+SI+NLCAIS+DRYLVI+ P++Y  +RT   I  +IA  WII+ ++SI   I+             GTCQ+  +  YQ YAT+ +FY P  IM++L  +I++ A+ +A +D  R +      D  +    N S  T     +++ +     +R +  N    F +E+               P  ++   +E KA  TLGVIM  F +CWLPFFI+ I K            ++  W   L LWLGY NS LNP+IY K+N+EFR PF+++L   C  +   +R  +F  +YG P+
Sbjct:   59 NALVCLAVLLVRKLKHPQNFLLVSLAVADFFVGLVVMPLALIDLLFD-KWPLGSTMCSVYTTSDLTLCTASIVNLCAISVDRYLVISSPLRYSAKRTTKRIMMYIACVWIIAAIVSISSHIIANLLNDGTYVDDTGTCQVIPHFIYQSYATIISFYAPTFIMVILNIKIWRAAKRLAAQD--RLMSHCNSVDASERP-RNGSAETKDFLNEKETIDVPKKERANSTN-SRLFKLERKYLHRPSAFFSAAKGPLIRQTEKSECKARKTLGVIMSVFIICWLPFFILAIFK--------SFGMWIPDWLDLLALWLGYSNSTLNPLIYCKYNKEFRIPFREMLACRCATLQTVMRQQSFTSRYGPPV 410          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 196.823 bits (499), Expect = 2.413e-56
Identity = 115/355 (32.39%), Postives = 186/355 (52.39%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTP-SNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKL----ARNMAQEDAKRKLGTGQMT-----------------------DEEQTSLPNQSGRTNSAEEDRKLLRFDPTQR-----PSEGNQGNGFDVEKTGTGPK-TNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFR 1464
            N LV++ ++  +KL+    NWLI+SLA +D  V +LVMP+ +  +++   W    + C+ ++  DVL  T+SIL++CAIS+DRY  +T P+ Y   RTPL +  +I  +WI+S LI +PP+  W+     G C ++ +LGY +Y++LG+FYIP++I++++Y +I+ +    +R   +E  +R      +T                       DE++  + N+        + RK+    P Q       +  N     D+ +     K    RK+K    E +A   LG+I+  F L WLPFF+I       ++    HE    P  ++ F WLGY NS +NPVIY  FNREF+
Sbjct:   39 NLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVG-EWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPERAEGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQRLKETERRDHTLNMLTIRSSTNERYNMEYELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKIALDTNHNSPPASDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIY------VIGAFGHEAP--PLVFKFFFWLGYCNSGINPVIYTVFNREFK 384          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 196.052 bits (497), Expect = 4.689e-56
Identity = 115/357 (32.21%), Postives = 186/357 (52.10%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTP-SNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKL----ARNMAQEDAKRKLGTGQMT-----------------------DEEQTSLPNQSGRTNSAEEDRKLLRFDPTQR-------PSEGNQGNGFDVEKTGTGPK-TNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFR 1464
            N LV++ ++  +KL+    NWLI+SLA +D  V +LVMP+ +  +++   W    + C+ ++  DVL  T+SIL++CAIS+DRY  +T P+ Y   RTPL +  +I  +WI+S LI +PP+  W+     G C ++ +LGY +Y++LG+FYIP++I++++Y +I+ +    +R   +E  +R      +T                       DE++  + N+        + RK+    P Q         +  N     D+ +     K    RK+K    E +A   LG+I+  F L WLPFF+I       ++    HE    P  ++ F WLGY NS +NPVIY  FNREF+
Sbjct:   39 NLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVG-EWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPERAEGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQRLKETERRDHTLNMLTIRSSTNERYNMEYELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKVSIALDTNHNSPPASDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIY------VIGAFGHEAP--PLVFKFFFWLGYCNSGINPVIYTVFNREFK 386          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0334508)

HSP 1 Score: 259.996 bits (663), Expect = 2.868e-78
Identity = 150/391 (38.36%), Postives = 214/391 (54.73%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVW-----KEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKT-------------------------------NPRKKK---QSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCY-ELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLP 1554
            N LV +A+ +V+KL+ P N+L++SLA SD  V++LVMP+A+  +++  +W F  L CD ++  DVL CT+SILNLCAIS+DRYL IT+P++Y V+RTP  +   +   W+ +  IS+PP+++       E  +P  C + +N  YQIYATLG+FYIPL +ML +YY+IF+ AR +  E+ +            QT L      T S    +      P       + GNG      G    T                               +P  KK   Q   E KA TTLG+IM  FT+CWLPFFI+ +++P         E   +P     LFLWLGY NS LNP+IYA  NR+FR PF++IL+F C ++N  +R + + +QYG P
Sbjct:  180 NVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLE-KWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQP-ICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKR-----------AQTHLQQALNGTGSPSAPQA----PPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPF--------ETMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEILYFRCSSLNTMMRENYYQDQYGEP 545          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0085746)

HSP 1 Score: 259.996 bits (663), Expect = 2.868e-78
Identity = 150/391 (38.36%), Postives = 214/391 (54.73%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVW-----KEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKT-------------------------------NPRKKK---QSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCY-ELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLP 1554
            N LV +A+ +V+KL+ P N+L++SLA SD  V++LVMP+A+  +++  +W F  L CD ++  DVL CT+SILNLCAIS+DRYL IT+P++Y V+RTP  +   +   W+ +  IS+PP+++       E  +P  C + +N  YQIYATLG+FYIPL +ML +YY+IF+ AR +  E+ +            QT L      T S    +      P       + GNG      G    T                               +P  KK   Q   E KA TTLG+IM  FT+CWLPFFI+ +++P         E   +P     LFLWLGY NS LNP+IYA  NR+FR PF++IL+F C ++N  +R + + +QYG P
Sbjct:  180 NVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLE-KWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQP-ICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKR-----------AQTHLQQALNGTGSPSAPQA----PPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPF--------ETMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEILYFRCSSLNTMMRENYYQDQYGEP 545          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Fly
Match: Dop2R (gene:FBgn0053517 transcript:FBtr0343167)

HSP 1 Score: 190.66 bits (483), Expect = 1.854e-51
Identity = 125/369 (33.88%), Postives = 182/369 (49.32%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVI-VWKEPFR-PGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMA-QEDAKRKLGTGQMTDEEQTSLPNQSGR--TNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNP------------------------------------RKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N LVIL++   + LQT +N+ I+SLA +D  V+V+VMP AVY  L+   W   ++ CDF+I  DV+  TSSI NL AISIDRY+ +T+P++Y   +    +   I   W IS  I  P V+ +   P R P  C    N  + +Y++L +FYIP IIM+ LY+ IFK  R+ A ++ A RK    ++T         Q+ R    + +  R   R  P +  +    G+  + ++    P  +                                     R+K  +  E KA  TL +++G F  CWLPFF   I+  +    K D    L    Y +  WLGY+NSF+NPVIY  FN EFR  FK+I+
Sbjct:  393 NILVILSVCRERSLQTVTNYFIVSLAIADLLVAVVVMPFAVY-FLVNGAWALPDVVCDFYIAMDVICSTSSIFNLVAISIDRYIAVTQPIKYAKHKNSRRVCLTILLVWAISAAIGSPIVLGLNNTPNREPDVCAFY-NADFILYSSLSSFYIPCIIMVFLYWNIFKALRSRARKQRAARKPHLSELTGGSVIENIAQTRRLAETALDSSRHASRILPDEAATNTASGSNEEEDENAISPDIDDCHVIVNDKSTEFMLATVVEETGKFTIYKVHKASKKKREKSSAKKERKATKTLAIVLGVFLFCWLPFFSCNIMDAMCAKFKKDCRPGLT--AYMMTTWLGYINSFVNPVIYTIFNPEFRKAFKKIM 757          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Fly
Match: Dop1R2 (gene:FBgn0266137 transcript:FBtr0085468)

HSP 1 Score: 185.267 bits (469), Expect = 7.948e-51
Identity = 121/377 (32.10%), Postives = 184/377 (48.81%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-----TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQM---TDEEQTSLPNQSGRTNSAEEDRKLLRF-------------------------------------DPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHC 1497
            N LVILA+   + L T +N+ I SLA +D  V ++VMP +   +++   W F   +CD +   DVL  T+SILNLC IS+DRY  IT P  Y +R T     G IA  WI S  IS P ++ W+   R G      C  TE+LGY ++++  +FY+PL++M+  Y RI++ A     +    K+GT Q+   + E Q +L    G T   ++++                                          +P   P      NG    +      +  RK  +   E KA  TLG++MG F +CWLPFF++ +L    I   ++HE+ +      +  WLG++NS +NPVIYA ++R+FR  F ++L   C
Sbjct:  126 NSLVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSSAISFPAIVWWRAA-RDGEMPAYKCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAA---VIQTRSLKIGTKQVLMASGELQLTLRIHRGGTTRDQQNQVSGGGGGGGGGGGGGGSLSHSHSHSHHHHHNHGGGTTTSTPEEPDDEPLSALHNNGLARHRHMGKNFSLSRKLAKFAKEKKAAKTLGIVMGVFIICWLPFFVVNLLSGFCI-ECIEHEEIV----SAIVTWLGWINSCMNPVIYACWSRDFRRAFVRLLCMCC 493          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Fly
Match: Dop1R2 (gene:FBgn0266137 transcript:FBtr0085467)

HSP 1 Score: 185.267 bits (469), Expect = 7.980e-51
Identity = 121/377 (32.10%), Postives = 184/377 (48.81%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-----TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQM---TDEEQTSLPNQSGRTNSAEEDRKLLRF-------------------------------------DPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHC 1497
            N LVILA+   + L T +N+ I SLA +D  V ++VMP +   +++   W F   +CD +   DVL  T+SILNLC IS+DRY  IT P  Y +R T     G IA  WI S  IS P ++ W+   R G      C  TE+LGY ++++  +FY+PL++M+  Y RI++ A     +    K+GT Q+   + E Q +L    G T   ++++                                          +P   P      NG    +      +  RK  +   E KA  TLG++MG F +CWLPFF++ +L    I   ++HE+ +      +  WLG++NS +NPVIYA ++R+FR  F ++L   C
Sbjct:  126 NSLVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSSAISFPAIVWWRAA-RDGEMPAYKCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAA---VIQTRSLKIGTKQVLMASGELQLTLRIHRGGTTRDQQNQVSGGGGGGGGGGGGGGSLSHSHSHSHHHHHNHGGGTTTSTPEEPDDEPLSALHNNGLARHRHMGKNFSLSRKLAKFAKEKKAAKTLGIVMGVFIICWLPFFVVNLLSGFCI-ECIEHEEIV----SAIVTWLGWINSCMNPVIYACWSRDFRRAFVRLLCMCC 493          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Zebrafish
Match: htr1aa (5-hydroxytryptamine (serotonin) receptor 1A a [Source:ZFIN;Acc:ZDB-GENE-071203-1])

HSP 1 Score: 241.121 bits (614), Expect = 8.125e-73
Identity = 142/359 (39.55%), Postives = 199/359 (55.43%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEP---FRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLR-FDPTQRPSEGNQGNG--FDVEKTGTGPK--------------------TNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCI 1500
            N  VI AI L + LQ  +N+LI SLA +D  VSVLV+P+A   Q++  +W   +  CD FI  DVL CTSSIL+LCAI++DRY  IT P+ YV +RTP      I+  W+I   ISIPP++ W++P     P  C ++++ GY IY+T GAFYIPLI+MLVLY RIF+ AR   ++  K K    ++ D+     P    R  + E  +   R  +P    +  N  +G  F++ +  +  K                    T  ++K     E K + TLG+IMG F  CWLPFFI+ ++ P         + ++  W   +  WLGY NS LNPVIYA FN++F+N FK+IL   CI
Sbjct:   46 NACVIAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLN-KWTLGQEMCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAILISLTWLIGFSISIPPMLGWRKPEDRADPDACTISQDHGYTIYSTFGAFYIPLILMLVLYGRIFRAARFRIRKTVK-KTEKAKIADKCLAVSPALFPRKANGEVGKTWRRSVEPCANGALKNSDDGESFEITEVQSISKNHLSLPNNPQPCFENRNEKNTEAKRKVALARERKTVKTLGIIMGTFIFCWLPFFIVALVLPFC------QDCFMPEWLGAVINWLGYSNSLLNPVIYAYFNKDFQNAFKKILKCKCI 396          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Zebrafish
Match: CR555296.1 (5-hydroxytryptamine (serotonin) receptor 7b [Source:NCBI gene;Acc:565304])

HSP 1 Score: 237.269 bits (604), Expect = 1.634e-71
Identity = 136/353 (38.53%), Postives = 191/353 (54.11%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFR-PGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSN---NESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYG 1548
            N LV++A+ +VKKL+ PSN+L++SLA +D  V+V VMP A+   L    W F E+FC+ FI  DV+ CT+SI+ LC IS+DRYL ITRP+ Y  R+   L+   I G W++S  I++PP   W       G C +++++GY +Y+T  AFYIP+++ML +YY+IFK AR   +  AK             TSLP                   P Q        NG   E+  T      R+++ ++    E KA TTLGVIMG F+ CWLPFF+    +P +     +       W   + LWLGY NS +NP IYA FNR+ R+ +K +L     NIN R+      E  G
Sbjct:   74 NTLVVIAVCVVKKLRQPSNYLLVSLAIADLSVAVAVMPFAIVTDLTGGVWLFGEVFCNIFIGMDVMCCTASIMTLCVISVDRYLGITRPLTYPARQNGQLMAKMIVGVWLVSASITLPPFCGWAHNVNTAGVCLISQDVGYTLYSTAVAFYIPMVVMLFMYYKIFKAAR---RSGAKHNF----------TSLP-------------------PIQLACPEPALNGATSEEFSTLSCLLNRERRSASIFRREQKAATTLGVIMGVFSFCWLPFFLFTTARPFICGLLCNCAPV---WLERVLLWLGYTNSLMNPFIYAFFNRDLRSTYKDLLRCRYRNINRRLSAMGVHEHEG 391          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Zebrafish
Match: htr7c (5-hydroxytryptamine (serotonin) receptor 7c [Source:ZFIN;Acc:ZDB-GENE-060526-5])

HSP 1 Score: 236.884 bits (603), Expect = 3.142e-71
Identity = 131/344 (38.08%), Postives = 191/344 (55.52%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVW-KEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSN---NESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLP-WCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARI 1518
            N LV++A+ +VKKL+ PSN+L++SLA +D  V+++VMP  +   L   +W F E+FC+ FI  DV+ CT+SI+ LC IS+DRYL ITRP+ Y  R+   L+   I G W++S  I++PP   W K     G C ++++ GY IY+T  AFYIP+I+ML +YY+IFK AR   +  AK +           T    +      A E  ++    P   P           E+     +   R+++  +    E KA TTLGVI+G F +CWLPFFI+   +P +   K       +P W     LW GY NS +NP IYA FNR+ R+ ++ +L     NIN R+
Sbjct:   71 NMLVVIAVCVVKKLRQPSNYLLVSLAVADLSVAIVVMPFVIVTDLTGGKWLFGEVFCNIFIGMDVMCCTASIMTLCVISVDRYLGITRPLTYPARQNGQLMAKMIFGVWLVSASITLPPFCGWAKNVNTAGVCLISQDFGYTIYSTAVAFYIPMIVMLFMYYKIFKAAR---KSGAKHRF----------TDFSRRERLETVASEALRMQGLKPQHTPGVA--------EECAALSRLLSRERQNISIFKREQKAATTLGVIVGVFGICWLPFFILSTARPFICGVKCS----CIPIWLERTLLWFGYANSLMNPFIYAFFNRDLRSTYRDLLRCRYRNINRRL 389          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Zebrafish
Match: CR450836.2 (5-hydroxytryptamine (serotonin) receptor 7b [Source:NCBI gene;Acc:565304])

HSP 1 Score: 235.728 bits (600), Expect = 8.215e-71
Identity = 135/353 (38.24%), Postives = 190/353 (53.82%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFR-PGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSN---NESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYG 1548
            N LV++A+ +VKKL+ PSN+L++SLA +D  V+V VMP A+   L    W F E+FC+ FI  DV+ CT+SI+ LC IS+DRYL ITRP+ Y  R+   L+   I G W++S  I++PP   W       G C +++++GY +Y+T  AFYIP+++ML +YY+IFK AR   +  AK             TSLP                   P Q        NG   E+         R+++ ++    E KA TTLGVIMG F+ CWLPFF+    +P +     +       W   + LWLGY NS +NP IYA FNR+ R+ +K +L     NIN R+      E  G
Sbjct:   74 NTLVVIAVCVVKKLRQPSNYLLVSLAIADLSVAVAVMPFAIVTDLTGGVWLFGEVFCNIFIGMDVMCCTASIMTLCVISVDRYLGITRPLTYPARQNGQLMAKMIVGVWLVSASITLPPFCGWAHNVNTAGVCLISQDVGYTLYSTAVAFYIPMVVMLFMYYKIFKAAR---RSGAKHNF----------TSLP-------------------PIQLACPEPALNGATSEEFSALSCLLNRERRSASIFRREQKAATTLGVIMGVFSFCWLPFFLFTTARPFICGLLCNCAPV---WLERVLLWLGYTNSLMNPFIYAFFNRDLRSTYKDLLRCRYRNINRRLSAMGVHEHEG 391          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Zebrafish
Match: htr7b (5-hydroxytryptamine (serotonin) receptor 7b [Source:ZFIN;Acc:ZDB-GENE-091118-105])

HSP 1 Score: 232.261 bits (591), Expect = 8.326e-70
Identity = 136/358 (37.99%), Postives = 194/358 (54.19%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFR-PGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEG----NQGNGFDVEKTGTGPKTNPRKKKQSN---NESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGL 1551
            N LV++A+ +VKKL+ PSN+L++SLA +D  V+V VMP A+   L    W F E+FC+ FI  DV+ CT+SI+ LC IS+DRYL ITRP+ Y  R+   L+   I G W++S  I++PP   W       G C +++++GY +Y+T  AFYIP+++ML +YY+IFK AR   +  AK             TSLP             +L   +P     +G       NG   E+         R+++ ++    E KA TTLGVIMG F+ CWLPFF+    +P +     +       W   + LWLGY NS +NP IYA FNR+ R+ +K +L     NIN R+      E   L
Sbjct:   39 NTLVVIAVCVVKKLRQPSNYLLVSLAIADLSVAVAVMPFAIVTDLTGGVWLFGEVFCNIFIGMDVMCCTASIMTLCVISVDRYLGITRPLTYPARQNGQLMAKMIVGVWLVSASITLPPFCGWAHNVNTAGVCLISQDVGYTLYSTAVAFYIPMVVMLFMYYKIFKAAR---RSGAKHNF----------TSLP-----------PIQLACPEPALATVDGFCMHGMKNGATSEEFSALSCLLNRERRSASIFRREQKAATTLGVIMGVFSFCWLPFFLFTTARPFICGLLCNCAPV---WLERVLLWLGYTNSLMNPFIYAFFNRDLRSTYKDLLRCRYRNINRRLSAMGVHEALKL 369          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Xenopus
Match: ENSXETT00000046867.1 (5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled [Source:NCBI gene;Acc:100488829])

HSP 1 Score: 241.891 bits (616), Expect = 8.102e-73
Identity = 142/364 (39.01%), Postives = 202/364 (55.49%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEP---FRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLAR--------------------NMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSA---EEDRKLLRFDPTQR----------PSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N  VI AI L + LQT +N+LI SLA +D  VSVLV+P+A +NQ++  +W   ++ CD FI  DVL CTSSIL+LCAI++DRY  IT P+ YV +RTP      I+  WI+   ISIPP++ W+ P     P  C+++E+ GY IY+T GAFYIPLI+MLVLY +IFK AR                    +++   A+RK       + ++T  P  S   N A    ED  +L                 P+  +        +      T+ ++K     E K + TLG+IMG F  CWLPFFI+ ++ P     +  H  +LL   +++  WLGY NS LNP+IYA FN++F++ FK+I+
Sbjct:   47 NACVIAAIALERCLQTVANYLIGSLAVTDLMVSVLVLPMAAHNQVLN-KWTLGQVTCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISITWIVGFSISIPPMLGWRTPEDRSDPNACKISEDPGYTIYSTFGAFYIPLILMLVLYGKIFKAARFRIRKTVKKAEKKKVADTCLSVSPAVAERKSNGEPSKNWKRTVEPKPSACVNGAIRHGEDGAVLEIIEVHHYVNSKSHLDLPNHAHDMAVAPCSEKRNDRATDAKRKVALARERKTVKTLGIIMGTFIFCWLPFFIVALVLPF---CETCHMPHLL---FDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 403          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Xenopus
Match: exd2 (exonuclease 3'-5' domain containing 2 [Source:Xenbase;Acc:XB-GENE-5752408])

HSP 1 Score: 233.417 bits (594), Expect = 3.282e-69
Identity = 134/353 (37.96%), Postives = 189/353 (53.54%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQS-NNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLP-WCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGL 1551
            N LV++++  VKKL+ PSN+LI+SLA +D  V++ VMP      L+   W F  +FC+ FI  DV+ CT+SI+ LC ISIDRYL ITRP+ Y VR+    +   I   W++S  I++PP+  W +       C ++++ GY IY+T  AFYIP+ +ML +YYRIFK A+  A   AK K  TG    EE   + + +G   + +E  +        R                     N RK       E KA TTLG+I+G FT+CWLPFF++   +P +       E   +P W    FLWLGY NS +NP IYA FNR+ R  ++ +L     NIN ++      E   L
Sbjct:   96 NCLVVISVCFVKKLRQPSNYLIVSLALADLSVAIAVMPFVSVTDLIGGEWIFGHVFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGRCMAKMILCVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYRIFKAAKRSA---AKHKF-TGLPRPEESEGMISANGNVKTHKESEECTNLSKLLR---------------------NDRKNISIFKREQKAATTLGIIVGAFTICWLPFFLLSTARPFI----CGTECSCIPLWLERTFLWLGYANSLINPFIYAFFNRDLRTTYRNLLQCRYRNINRKLSAAGMHEALKL 419          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Xenopus
Match: HTR1F (5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled [Source:NCBI gene;Acc:100494586])

HSP 1 Score: 204.142 bits (518), Expect = 3.559e-59
Identity = 116/334 (34.73%), Postives = 181/334 (54.19%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPF--RPGTCQLT-ENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKL---GTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N LVI AI + +KL  P+N+LI SLA +DF V+VLVMP ++   +M+  W   +  CD ++  D+  CT SIL+L AI++DRY  IT  ++Y  +RTP      IA  WIIS  IS+PP + W+     +   C +  +++ + IY+T GAFYIPL ++L+LYY+I+K A+ +  + +  ++     GQ+  +  T+L       +    D   +         E  Q   +             ++K  S  E KA TTLG+I+G F +CWLPFF+ +++  I          Y+         WLGYLNS +NP+IY  FN +F+  F++++
Sbjct:   41 NSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIM-YIMKETWIMGQAICDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAAFMIAVVWIISIFISMPP-LFWRHQALNKEDECIIKHDHIVFTIYSTFGAFYIPLALILILYYKIYKAAKTLYHKRSVSRVEREQNGQVLLDATTTLCIAEKSFSDHSTDFDKIHITVRNARVEMKQEKAY------------RKQKISSTRERKAATTLGLILGAFVICWLPFFVKEVIVNIC------ESCYISDDMSNFLTWLGYLNSLINPLIYTIFNEDFKKAFQKLM 354          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Xenopus
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 201.445 bits (511), Expect = 2.614e-58
Identity = 113/331 (34.14%), Postives = 183/331 (55.29%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRP--GTCQL-TENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N  VI  ++  +KL TP+N+LI SLAF+D  VS+LV+P+A+   +   +W   ++ CD ++  D+  CT+SIL+LC I++DRY  IT  ++Y  +RTP      IA  W+ S  IS+PP + W++        C + T+++ Y +Y+T+GAFYIP ++++ LY RI+  AR+   + + +   TG+   +      +    + S+   R L      + PS+       +  K         +KK  +  E KA  TLGVI+G + +CWLPFFII ++ PI          +  P  ++ F WLGYLNS +NP+IY   N +F+  F +++
Sbjct:   36 NAFVITTVYQTRKLHTPANYLIASLAFTDLLVSILVLPIAIVYTVTG-KWTLGQIICDMWLSSDITCCTASILHLCVIALDRYWAITDAVEYTKKRTPKRAVVMIALVWVFSISISMPP-LFWRQSKAEEIAVCAVNTDHILYTVYSTVGAFYIPTLLLIALYGRIYVEARSRILKQSPKT--TGKRLTKAHLITDSPGSSSVSSTNSRTL------EMPSDAGSPVYLNQVKVKVSDALLEKKKIMAARERKATKTLGVILGAYIVCWLPFFIISLVMPI-----CKDACWFHPAIFDFFNWLGYLNSLINPIIYTMSNEDFKQAFHKLI 351          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Xenopus
Match: HTR1E (5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled [Source:NCBI gene;Acc:100380026])

HSP 1 Score: 196.823 bits (499), Expect = 1.457e-56
Identity = 119/354 (33.62%), Postives = 189/354 (53.39%), Query Frame = 1
Query:  436 PVGMEVFLXXXXXXXXXXXXXXNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFR---PGTCQLT-ENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            PV  ++ + +   +I +     N  VILAI   KKL  P+N+LI SLA +DF V++LVMP+++   +M   W    + C+ ++  D+  CT SIL+LC I++DRY  IT  ++Y  +RT    G  I   W IS  ISIPP + W+       P  C +  ++L Y IY+T GAFYIPL ++L+LYYRI+  A+N+ Q+    +  + +  D + +    +  +T    E       DPT    + N                + +++  S+ E KA   LG+I+G F L WLPFFI +++  I + +       + P   +   WLGY+NS +NP++Y  FN +F+  FK+++
Sbjct:   12 PVTEKMLISLTLAIITILTTVLNSAVILAICTTKKLHQPANYLICSLAVTDFLVAILVMPLSITYIVMD-TWTLGYVICEIWLSVDMTCCTCSILHLCVIALDRYWAITDAIEYARKRTVKRAGIMILTVWTISVFISIPP-LFWRNHHNINIPSKCIIQHDHLIYTIYSTCGAFYIPLTLILILYYRIYHAAKNLYQKRGSSRHLSNRSNDSQNSFAHCKLTQTFCVSE---FSTSDPTTEFEKMNASVRTPPYDNDIDIFGDRQQQISSSRERKAARILGLILGAFILSWLPFFIKELVVGIQLCT-------VSPEVADFLTWLGYVNSLVNPLLYTSFNDDFKLAFKKLI 353          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Mouse
Match: Htr1a (5-hydroxytryptamine (serotonin) receptor 1A [Source:MGI Symbol;Acc:MGI:96273])

HSP 1 Score: 236.113 bits (601), Expect = 1.218e-70
Identity = 148/368 (40.22%), Postives = 198/368 (53.80%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEP---FRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLP-------NQSGRTN---SAE----------------EDRKLLRFDPTQR----------PSEGNQGNGFDVEKTGTGPKTNPRKKKQS-NNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N  V+ AI L + LQ  +N+LI SLA +D  VSVLV+P+A   Q++  +W   ++ CD FI  DVL CTSSIL+LCAI++DRY  IT P+ YV +RTP      I+  W+I  LISIPP++ W+ P     P  C ++++ GY IY+T GAFYIPL++MLVLY RIF+ AR   ++  K+    G  T    +S P        Q G  +   SAE                ED   L      R          PSE    +           +T   K+K +   E K + TLG+IMG F LCWLPFFI+ ++ P    S   H   LL     +  WLGY NS LNPVIYA FN++F+N FK+I+
Sbjct:   54 NACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLN-KWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKKGAGTSFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAVRQGEDDATLEVIEVHRVGNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSC--HMPELLG---AIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Mouse
Match: Htr7 (5-hydroxytryptamine (serotonin) receptor 7 [Source:MGI Symbol;Acc:MGI:99841])

HSP 1 Score: 224.172 bits (570), Expect = 8.517e-66
Identity = 131/353 (37.11%), Postives = 185/353 (52.41%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKL-GTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLP-WCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGL 1551
            N LV++++  VKKL+ PSN+LI+SLA +D  V+V VMP      L+  +W F   FC+ FI  DV+ CT+SI+ LC ISIDRYL ITRP+ Y VR+    +   I   W++S  I++PP+  W +       C ++++ GY IY+T  AFYIP+ +ML +YY+I+K AR  A   AK K  G  ++  E   SL          EE   L R    +R                       +       E KA TTLG+I+G FT+CWLPFF++   +P +  +        +P W     LWLGY NS +NP IYA FNR+ R  ++ +L     NIN ++      E   L
Sbjct:  102 NCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSA---AKHKFSGFPRVQPESVISLNGVVKLQKEVEECANLSRLLKHER-----------------------KNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCS----CIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKL 424          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Mouse
Match: Htr7 (5-hydroxytryptamine (serotonin) receptor 7 [Source:MGI Symbol;Acc:MGI:99841])

HSP 1 Score: 223.402 bits (568), Expect = 1.016e-65
Identity = 131/353 (37.11%), Postives = 185/353 (52.41%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKL-GTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLP-WCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGL 1551
            N LV++++  VKKL+ PSN+LI+SLA +D  V+V VMP      L+  +W F   FC+ FI  DV+ CT+SI+ LC ISIDRYL ITRP+ Y VR+    +   I   W++S  I++PP+  W +       C ++++ GY IY+T  AFYIP+ +ML +YY+I+K AR  A   AK K  G  ++  E   SL          EE   L R    +R                       +       E KA TTLG+I+G FT+CWLPFF++   +P +  +        +P W     LWLGY NS +NP IYA FNR+ R  ++ +L     NIN ++      E   L
Sbjct:  102 NCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSA---AKHKFSGFPRVQPESVISLNGVVKLQKEVEECANLSRLLKHER-----------------------KNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCS----CIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKL 424          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Mouse
Match: Htr7 (5-hydroxytryptamine (serotonin) receptor 7 [Source:MGI Symbol;Acc:MGI:99841])

HSP 1 Score: 223.787 bits (569), Expect = 1.687e-65
Identity = 131/353 (37.11%), Postives = 185/353 (52.41%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKL-GTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLP-WCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGL 1551
            N LV++++  VKKL+ PSN+LI+SLA +D  V+V VMP      L+  +W F   FC+ FI  DV+ CT+SI+ LC ISIDRYL ITRP+ Y VR+    +   I   W++S  I++PP+  W +       C ++++ GY IY+T  AFYIP+ +ML +YY+I+K AR  A   AK K  G  ++  E   SL          EE   L R    +R                       +       E KA TTLG+I+G FT+CWLPFF++   +P +  +        +P W     LWLGY NS +NP IYA FNR+ R  ++ +L     NIN ++      E   L
Sbjct:  102 NCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSA---AKHKFSGFPRVQPESVISLNGVVKLQKEVEECANLSRLLKHER-----------------------KNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCS----CIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKL 424          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Mouse
Match: Htr1f (5-hydroxytryptamine (serotonin) receptor 1F [Source:MGI Symbol;Acc:MGI:99842])

HSP 1 Score: 213.386 bits (542), Expect = 9.521e-63
Identity = 123/339 (36.28%), Postives = 187/339 (55.16%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKE--PFRPGTCQLT-ENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFD-VEKTGTGPKTN-------PRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N LVI AI + +KL  P+N+LI SLA +DF V+VLVMP ++   ++R  W   ++ CD ++  D++ CT SIL+L AI++DRY  IT  ++Y  +RTP   G  I   W+IS  IS+PP + W+     R   C +  +++   IY+T GAFYIPL+++L+LYY+I++ AR +       K    +M  EE     N      S E+  KL+        S  +    FD +  T   P++         R+K     E KA TTLG+I+G F +CWLPFF+ +++  +    K+  E            WLGYLNS +NP+IY  FN +F+  F++++
Sbjct:   41 NSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIV-YIVRESWIMGQVLCDIWLSVDIICCTCSILHLSAIALDRYRAITDAVEYARKRTPRHAGIMITIVWVISVFISMPP-LFWRHQGTSRDDECVIKHDHIVSTIYSTFGAFYIPLVLILILYYKIYRAARTLYH-----KRQASRMIKEEL----NGQVFLESGEKSIKLVSTSYMLEKSLSDPSTDFDRIHSTVKSPRSELKHEKSWRRQKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCEKCKISEEM------SNFLAWLGYLNSLINPLIYTIFNEDFKKAFQKLV 362          
BLAST of 5-hydroxytryptamine receptor 1A vs. UniProt/SwissProt
Match: sp|P20905|5HT1R_DROME (5-hydroxytryptamine receptor 1 OS=Drosophila melanogaster OX=7227 GN=5-HT7 PE=2 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 2.875e-77
Identity = 150/391 (38.36%), Postives = 214/391 (54.73%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVW-----KEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKT-------------------------------NPRKKK---QSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCY-ELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLP 1554
            N LV +A+ +V+KL+ P N+L++SLA SD  V++LVMP+A+  +++  +W F  L CD ++  DVL CT+SILNLCAIS+DRYL IT+P++Y V+RTP  +   +   W+ +  IS+PP+++       E  +P  C + +N  YQIYATLG+FYIPL +ML +YY+IF+ AR +  E+ +            QT L      T S    +      P       + GNG      G    T                               +P  KK   Q   E KA TTLG+IM  FT+CWLPFFI+ +++P         E   +P     LFLWLGY NS LNP+IYA  NR+FR PF++IL+F C ++N  +R + + +QYG P
Sbjct:  180 NVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLE-KWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQP-ICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKR-----------AQTHLQQALNGTGSPSAPQA----PPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPF--------ETMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEILYFRCSSLNTMMRENYYQDQYGEP 545          
BLAST of 5-hydroxytryptamine receptor 1A vs. UniProt/SwissProt
Match: sp|Q9N296|5HT1A_PONPY (5-hydroxytryptamine receptor 1A OS=Pongo pygmaeus OX=9600 GN=HTR1A PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 1.474e-71
Identity = 144/369 (39.02%), Postives = 200/369 (54.20%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEP---FRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNG-------------FDVEKTGTGPKTNP---------------RKKKQSNNES----------KAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N  V+ AI L + LQ  +N+LI SLA +D  VSVLV+P+A   Q++  +W   ++ CD FI  DVL CTSSIL+LCAI++DRY  IT P+ YV +RTP      I+  W+I  LISIPP++ W+ P     P  C ++++ GY IY+T GAFYIPL++MLVLY RIF+ AR   ++  K+   TG  T    +  P Q  ++ + E   +  R     +   G   NG              +V + G   +  P                +K + N E+          K + TLG+IMG F LCWLPFFI+ ++ P    S   H   LL     +  WLGY NS LNPVIYA FN++F+N FK+I+
Sbjct:   54 NACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLN-KWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTHHGASPAP-QPKKSVNGESGSRNWRLGVESKAGGGLCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSC--HMPTLLG---AIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of 5-hydroxytryptamine receptor 1A vs. UniProt/SwissProt
Match: sp|P08908|5HT1A_HUMAN (5-hydroxytryptamine receptor 1A OS=Homo sapiens OX=9606 GN=HTR1A PE=1 SV=3)

HSP 1 Score: 238.424 bits (607), Expect = 1.068e-70
Identity = 143/368 (38.86%), Postives = 200/368 (54.35%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEP---FRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLP-------NQSGRTN-----SAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNP---------------RKKKQSNNES----------KAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N  V+ AI L + LQ  +N+LI SLA +D  VSVLV+P+A   Q++  +W   ++ CD FI  DVL CTSSIL+LCAI++DRY  IT P+ YV +RTP      I+  W+I  LISIPP++ W+ P     P  C ++++ GY IY+T GAFYIPL++MLVLY RIF+ AR   ++  K+   TG  T    +  P        +SG  N      ++    L      ++  +G      +V + G   +  P                +K + N E+          K + TLG+IMG F LCWLPFFI+ ++ P    S   H   LL     +  WLGY NS LNPVIYA FN++F+N FK+I+
Sbjct:   54 NACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLN-KWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSC--HMPTLLG---AIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of 5-hydroxytryptamine receptor 1A vs. UniProt/SwissProt
Match: sp|Q9N297|5HT1A_GORGO (5-hydroxytryptamine receptor 1A OS=Gorilla gorilla gorilla OX=9595 GN=HTR1A PE=3 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 1.173e-70
Identity = 143/369 (38.75%), Postives = 201/369 (54.47%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEP---FRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPS----------EGNQGNGF---DVEKTGTGPKTNP---------------RKKKQSNNES----------KAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N  V+ AI L + LQ  +N+LI SLA +D  VSVLV+P+A   Q++  +W   ++ CD FI  DVL CTSSIL+LCAI++DRY  IT P+ YV +RTP      I+  W+I  LISIPP++ W+ P     P  C ++++ GY IY+T GAFYIPL++MLVLY RIF+ AR   ++  K+   TG  T    +  P Q  ++ + E   +  R     +            +G+ G      +V + G   +  P                +K + N E+          K + TLG+IMG F LCWLPFFI+ ++ P    S   H   LL     +  WLGY NS LNPVIYA FN++F+N FK+I+
Sbjct:   54 NACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLN-KWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAP-QPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSC--HMPTLLG---AIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of 5-hydroxytryptamine receptor 1A vs. UniProt/SwissProt
Match: sp|Q9N298|5HT1A_PANTR (5-hydroxytryptamine receptor 1A OS=Pan troglodytes OX=9598 GN=HTR1A PE=3 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 1.263e-70
Identity = 143/368 (38.86%), Postives = 202/368 (54.89%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEP---FRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMT-------DEEQTSLPNQSGRTN-----SAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNP---------------RKKKQSNNES----------KAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N  V+ AI L + LQ  +N+LI SLA +D  VSVLV+P+A   Q++  +W   ++ CD FI  DVL CTSSIL+LCAI++DRY  IT P+ YV +RTP      I+  W+I  LISIPP++ W+ P     P  C ++++ GY IY+T GAFYIPL++MLVLY RIF+ AR   ++  K+   TG  T        + + S+  +SG  N      ++    L      ++  +G      +V + G   +  P                +K + N E+          K + TLG+IMG F LCWLPFFI+ ++ P    S   H   LL     +  WLGY NS LNPVIYA FN++F+N FK+I+
Sbjct:   54 NACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLN-KWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAQQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSC--HMPTLLG---AIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of 5-hydroxytryptamine receptor 1A vs. TrEMBL
Match: A0A193KU92 (GCR052 OS=Schmidtea mediterranea OX=79327 GN=gcr052 PE=2 SV=1)

HSP 1 Score: 927.932 bits (2397), Expect = 0.000e+0
Identity = 476/478 (99.58%), Postives = 476/478 (99.58%), Query Frame = 1
Query:  280 MSVWRXXXXXXXXXXXPTCQMQNIVLNCSNYTNYVRINNLSRLVVPFECEKYPVGMEVFLXXXXXXXXXXXXXXNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPMQKTMSTSQYETTHLNTHVNSRRRSSVPFTPVSRKNKSSCQSRPTSDQSVNKA 1713
            MSVWRL IIIILF LLPTCQMQNIVLNCSNYTNYVRINNLSRLVVPFECEKYPVGMEVFLGMIFVVIVVGAIGGNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPMQKTMSTSQYETTHLNTHVNSRRRSSVPFTPVSRKNKSSCQSRPTSDQSVNKA
Sbjct:    1 MSVWRLTIIIILFSLLPTCQMQNIVLNCSNYTNYVRINNLSRLVVPFECEKYPVGMEVFLGMIFVVIVVGAIGGNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPMQKTMSTSQYETTHLNTHVNSRRRSSVPFTPVSRKNKSSCQSRPTSDQSVNKA 478          
BLAST of 5-hydroxytryptamine receptor 1A vs. TrEMBL
Match: O15969 (Serotonin receptor-like planarian receptor 4 OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 774.622 bits (1999), Expect = 0.000e+0
Identity = 388/460 (84.35%), Postives = 415/460 (90.22%), Query Frame = 1
Query:  340 MQNIVLNCSNYTNYVRINNLSRLVVPFECEKYPVGMEVFLXXXXXXXXXXXXXXNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPMQKTMSTSQYETTHLNTH--VNSRRRSSVPFTPVSRKNKSSCQSRPTSDQSVNKA 1713
            MQ+++LNC+NY+ YV +NNLSRL +PFECEKYPVGMEVFLG+IF +IVVGAIGGNFLVILAI LVKKLQT SNWLILSLAFSDFFVSVLVMP+A +NQL RFRWPFSE  CDF+  CDV+LCTSSILNLCAISIDRYLVITRPMQYVVRRTP LIGG I  AW++SGLISIPPV+ WKE F PG CQLT+NL YQIYAT  AFYIPLI+MLVLYY+IFKLARNMAQEDAKRKLGTGQMTDEEQTS+P Q GRTNS +EDRKLLR +  QR S+GNQGNGFD E   TGPK N +KKKQ NNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYL+PWCYELFLWLGY NSFLNPVIYAKFNREFRNPFKQILFFHC NINARIRVDTFAEQYGLPMQKTM+TS YET+HLNTH   NSRRRSSVPFTPVSRKNKSS QSRPTSDQS NKA
Sbjct:   20 MQDLILNCTNYSIYVTVNNLSRLAIPFECEKYPVGMEVFLGIIFFIIVVGAIGGNFLVILAIILVKKLQTASNWLILSLAFSDFFVSVLVMPIAAFNQLSRFRWPFSEKLCDFYNCCDVMLCTSSILNLCAISIDRYLVITRPMQYVVRRTPALIGGMIGVAWLMSGLISIPPVLGWKEKFTPGICQLTDNLLYQIYATFCAFYIPLIVMLVLYYQIFKLARNMAQEDAKRKLGTGQMTDEEQTSIPIQLGRTNSGDEDRKLLRLEDAQRLSKGNQGNGFDPEAQ-TGPKNNAKKKKQVNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLMPWCYELFLWLGYFNSFLNPVIYAKFNREFRNPFKQILFFHCFNINARIRVDTFAEQYGLPMQKTMATSLYETSHLNTHNTANSRRRSSVPFTPVSRKNKSSSQSRPTSDQSTNKA 478          
BLAST of 5-hydroxytryptamine receptor 1A vs. TrEMBL
Match: O15970 (Serotonin receptor-like planarian receptor 1 OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 7.434e-133
Identity = 230/436 (52.75%), Postives = 285/436 (65.37%), Query Frame = 1
Query:  358 NCSNYTNYVRINNLSRLVVPFECEKYPVGMEVFLXXXXXXXXXXXXXXNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTG-QMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRK-------KKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPMQKT-MSTSQYETTHLNTHV---NSRRRS 1629
            NC+ Y      NN S + VPF C K+    EVFL ++  + +VG  GGN LVI ++ +VKKLQT SN+LI++LA SDF VS+LV+P AV+  + R +WPFSE+ CD FI  DV+LCTSSILNLCAISIDRYLVITRP+QY V RTP  IG  +A +W+ S LISIPP+   KE F PG C  ++NL YQIYAT GAFYIPLI+ML+LY RIFKLAR MAQ DAK K+G     +D+EQ S        +    D  +      Q       G+   + K+     ++P K       K +S+ E+KAITTLGVIMGCFT+CWLPFF+IQI KP+L V+ VD   Y   W  EL LWLGY NSFLNP+IYAKFNREFR PFKQIL   C +INAR+R +TF ++YGLP          ++ T LN      N RRR+
Sbjct:    8 NCTFYFQLASKNN-SAVQVPFYCIKFSFEFEVFLIIVLTIFLVGTAGGNLLVISSVAIVKKLQTSSNFLIVNLACSDFLVSILVLPGAVHQVIYRGQWPFSEILCDIFISFDVILCTSSILNLCAISIDRYLVITRPLQYAVNRTPARIGTMVAISWVTSALISIPPMFGLKETFIPGQCNYSDNLIYQIYATFGAFYIPLIVMLILYGRIFKLAREMAQNDAKLKIGISPNSSDKEQHS--------HLRIVDSHICNTPNGQMNLSLYSGSLCSISKSNNLSDSSPNKVNLRNRVKLKSSTETKAITTLGVIMGCFTICWLPFFLIQISKPVLKVANVDSMNYFPIWLIELCLWLGYFNSFLNPIIYAKFNREFRTPFKQILLCKCNSINARLRSETFVQEYGLPNSSAPTKRGSFDQTSLNNGSFTKNRRRRT 434          
BLAST of 5-hydroxytryptamine receptor 1A vs. TrEMBL
Match: A0A267GD30 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005906g3 PE=3 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 1.273e-127
Identity = 221/435 (50.80%), Postives = 282/435 (64.83%), Query Frame = 1
Query:  355 LNCSNYTNYVRINNLSRLVV--------PFECEKYPVGMEVFLXXXXXXXXXXXXXXNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEE--QTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLL-PWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPM-QKTMSTSQYETTHLNTHVNSRR 1623
            LNC +  N  R+ N+S   +        P    +Y +  +VF+G+   ++  G   GN LVI+A+ LVKKLQ PSN LI+SLA SD  VSVLV+P+A+  QL+ + +PF E+ CDFFI CDVLLC+SSILNLCAISIDRYLVIT+P +Y V+RTP  +G  IA  W++S  ISIPP+  WKE F PG C   E LGYQIYAT GAFY+PLIIMLVLY  IFKLAR MA+ D K+K+   +  D+      LPN                   T RPS   Q +  D+ K        P  +K++N++SKAI TLGVIMGCFTLCWLPFFIIQI+ PI  V  V  EK  + P  +E FLWLGY+NSF+NP+IYAKFNR+FR PFK IL  HC +IN R+R + FAEQYGL   +K+++++       ++ V +RR
Sbjct:   74 LNCEDQLNLFRMKNISVFTLHNMSDDCKPLLSSRYDIPAKVFIGLFLSILASGTCFGNVLVIMAVGLVKKLQNPSNLLIVSLASSDLLVSVLVLPIAIMTQLLGY-FPFGEVVCDFFISCDVLLCSSSILNLCAISIDRYLVITKPFEYAVKRTPTRMGLMIAAVWLLSAFISIPPMFGWKEQFVPGYCGYPELLGYQIYATFGAFYLPLIIMLVLYGNIFKLARKMAKADEKQKVVHIKQEDKNLIDEQLPNGQ-----------------TARPSM--QSSASDLPKRSV---RQPASRKKNNSDSKAIKTLGVIMGCFTLCWLPFFIIQIVVPIYNV--VQGEKLDMNPNVFEFFLWLGYVNSFMNPIIYAKFNRDFRTPFKHILLCHCKSINDRLRAEQFAEQYGLAGNRKSIASTGGRQRRRSSDVAARR 483          
BLAST of 5-hydroxytryptamine receptor 1A vs. TrEMBL
Match: A0A1I8GLU4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 2.789e-123
Identity = 207/378 (54.76%), Postives = 257/378 (67.99%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEE--QTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLL-PWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPM-QKTMSTSQYETTHLNTHVNSRR 1623
            N LVI+A+ LVKKLQ PSN LI+SLA SD  VSVLV+P+A+  QL+ + +PF E+ CDFFI CDVLLC+SSILNLCAISIDRYLVIT+P +Y V+RTP  +G  IA  W++S  ISIPP+  WKE F PG C   E LGYQIYAT GAFY+PLIIMLVLY  IFKLAR MA+ D K+K+   +  D+      LPN                   T RPS   Q +  D+ K        P  +K++N++SKAI TLGVIMGCFTLCWLPFFIIQI+ PI  V  V  EK  + P  +E FLWLGY+NSF+NP+IYAKFNR+FR PFK IL  HC +IN R+R + FAEQYGL   +K+++++       ++ V +RR
Sbjct:  204 NVLVIMAVGLVKKLQNPSNLLIVSLASSDLLVSVLVLPIAIMTQLLGY-FPFGEVVCDFFISCDVLLCSSSILNLCAISIDRYLVITKPFEYAVKRTPTRMGLMIAAVWLLSAFISIPPMFGWKEQFVPGYCGYPELLGYQIYATFGAFYLPLIIMLVLYGNIFKLARKMAKADEKQKVVHIKQEDKNLIDEQLPNGQ-----------------TARPSM--QSSASDLPKRSV---RQPASRKKNNSDSKAIKTLGVIMGCFTLCWLPFFIIQIVVPIYNV--VQGEKLDMNPNVFEFFLWLGYVNSFMNPIIYAKFNRDFRTPFKHILLCHCKSINDRLRAEQFAEQYGLAGNRKSIASTGGRQRRRSSDVAARR 556          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Cavefish
Match: htr7c (5-hydroxytryptamine (serotonin) receptor 7c [Source:ZFIN;Acc:ZDB-GENE-060526-5])

HSP 1 Score: 234.187 bits (596), Expect = 1.750e-70
Identity = 130/343 (37.90%), Postives = 189/343 (55.10%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFR-PGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQS--NNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLP-WCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARI 1518
            N LV++A+ +VKKL+ PSN+L++SLA +D  V+ +VMP A+   L   +W F ++FC+ FI  DV+ CT+SI+ LC IS+DRYL ITRP+ Y  R+   L+   I G W++S  I++PP   W +     G C ++++  Y IY+T  AFYIP+++ML +YY+IFK AR                          +SG  +      + L   P Q     + G G   E        +P ++  S    E KA TTLGVI+G F++CWLPFFI+   +P +       E   +P W   + LW GY NS +NP IYA FNR+ R+ +K +L     NIN R+
Sbjct:   58 NALVVIAVCVVKKLRQPSNYLLVSLAAADLSVATVVMPFAIVTDLTGGQWLFGQVFCNIFIAMDVMCCTASIMTLCVISVDRYLGITRPLTYPARQNGQLMAKMIFGVWLVSASITLPPFCGWAKNINTAGVCLISQDFSYTIYSTAVAFYIPMLVMLFMYYKIFKAAR--------------------------KSGAKHRFTSIVRSLDLPPPQ-----HHGTGVAEECAALSRLLSPERQNMSIFKREQKAATTLGVIVGVFSICWLPFFILSTARPFI----CGVECSCIPIWLERMLLWFGYANSLVNPFIYAFFNRDLRSTYKDLLRCRYRNINRRL 365          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Cavefish
Match: ENSAMXT00000006138.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:27993956:27999385:-1 gene:ENSAMXG00000005992.2 transcript:ENSAMXT00000006138.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.402 bits (568), Expect = 4.811e-66
Identity = 139/356 (39.04%), Postives = 201/356 (56.46%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEP---FRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKR-------------KLGTGQMTDEEQTSLPNQSGRTN----SAEEDRKLLRFDPTQRPSEGNQGNGF-DVEKTGT-------GPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N  VI AI L + LQT +N+LI SLA +D  VSVLV+P+A   Q+++ RW   ++ CD FI  DVL CTSSIL+LCAI++DRY  IT P+ Y+ RRT       I+  W++   ISIPP++ W+ P     P  C ++++ GY I++T GAFYIPL +MLVLY RIF+ AR   +  AK+             + GTG   +   +   + +G  +    S+ +D ++   D T+  +  +   G  +V + GT       G +     +     E + + TLG+IMG F LCWLPFFI+ ++ P            + PW   +  WLGY NS LNPVIYA FNR+F+N F+++L
Sbjct:   51 NACVIAAIALERSLQTINNYLIGSLAVTDLLVSVLVLPMAALYQVLQ-RWTLGQVACDLFIALDVLCCTSSILHLCAIALDRYWAITDPVAYMTRRTLCRAATLISLTWLVGFSISIPPMLGWRTPEDRANPLECTISQDPGYTIFSTFGAFYIPLALMLVLYGRIFRAARFRIRRSAKKNTDKMKMKEKEKDRKGTGLTGNGAPSPCTSVTGTPDVNRVSSPDDPRIDTPDGTRASTPDSTSLGSPEVTRVGTPEGISLEGTELLQDSRGALARERRTVKTLGIIMGTFILCWLPFFIVALVLPF-----CGSSCPMPPWLGAVINWLGYANSLLNPVIYAYFNRDFQNAFRKML 400          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Cavefish
Match: htr7a (5-hydroxytryptamine receptor 7-like [Source:NCBI gene;Acc:103024740])

HSP 1 Score: 225.713 bits (574), Expect = 5.263e-66
Identity = 131/362 (36.19%), Postives = 195/362 (53.87%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQ-GNGFD-----------VEKT--------GTGPKTNPRKKKQS-NNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLP-WCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARI 1518
            N LV++++  VKKL+ PSN+LI+SLA +D  V++ VMP      L+  RW F + FC+ FI  DV+ CT+SI+ LC ISIDRYL ITRP+ Y VR+    +   +   W++S  I++PP+  W +       C ++++ GY IY+T  AFYIP+ +ML++YYRI++ A+  A   AK  +          T  P         E++R+    +  + P +G++   G D           VE+         G G  ++ RK       E KA  TLGV++G F+ CWLPFF++   +P +       E   +P W     LWLGY NS +NP IYA FNR+ R  ++ +L     NIN R+
Sbjct:  132 NVLVLVSVCFVKKLRQPSNYLIVSLALADLSVALAVMPFVSITDLIGGRWIFGQFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGWCMAKMVLSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMTVMLIMYYRIYRAAKLSA---AKHTI----------TGFPRP-------EKNRQDEVDEDEEDPGDGSEVSTGVDCVTVAMKLHREVEECARLPRLLRGIGGGSSDRKSISIFKREQKAAATLGVVVGAFSFCWLPFFLLSTTRPFV----CGTECSCVPLWVERTLLWLGYANSLINPFIYAFFNRDLRTTYRSLLSCRYRNINRRL 469          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Cavefish
Match: ENSAMXT00000007940.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:42941:45329:1 gene:ENSAMXG00000007726.2 transcript:ENSAMXT00000007940.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.846 bits (538), Expect = 6.962e-62
Identity = 124/365 (33.97%), Postives = 189/365 (51.78%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDR----YLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFR-PGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGP---KTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLP-WCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPMQKTM 1569
            N LV++++  VKKL+ PSN+LI+SLA +D  V+V VMP      L+  +W F  +FC+ FI  DV+ CT+SI+ LC ISIDR    YL IT+P+ Y VR++   +   +   W++S  I++PP+  W +       C ++++LGY +Y+T  AFYIP+ +ML +YYRI++ A+    + A        M  +E         R +      KL R                D E  G+     + + R       E KA  TLG+++G F++CWLPFF++   +P +           +P W     LWLGY NS +NP IYA FNR+ R  ++ I+     NIN ++   +  E   L  +  M
Sbjct:   68 NLLVVISVCFVKKLKQPSNYLIVSLAVADLSVAVAVMPFVSITDLIGGQWIFGRVFCNVFIAMDVMCCTASIMTLCVISIDRCLVVYLGITKPLTYPVRQSGKCMAKIVLSVWLLSASITLPPLFGWAQNVNDDNVCLISQDLGYTVYSTAVAFYIPMSVMLFMYYRIYRAAKVSVAKHA-----IAIMPKDEDN-------RVDCVSAVLKLQR----------------DAEDCGSFSRLLRNDRRNISIFKREQKAAATLGIVVGAFSVCWLPFFLLSTARPFICGVTCS----CVPLWVERTLLWLGYANSLINPFIYAFFNRDLRTTYQNIICCRYRNINRKLSAASMHEALRLAERPGM 400          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Cavefish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 209.149 bits (531), Expect = 1.095e-60
Identity = 129/364 (35.44%), Postives = 189/364 (51.92%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFR--------PGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKR--------------KLGTGQM----TDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEG-------NQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFH 1494
            N  V+ AI L + LQ  +N+LI SLA +D  VSVLV+P+A   Q++  RW   ++ CD FI  D+L CTSSIL+LCAI++DRY  IT P+ Y+ +RT       I   W++   ISIPP+++ K   +        P  C ++ +  Y IY+T  AFYIPLI+MLVLY RIFK AR   ++  ++              K   G++    +  E   + + S       +D + L      +P          N      + +      T  ++K     E K + TLG+IMG F LCWLPFFI  ++ P     ++        W  ++  WLGY NS LNP+IYA FN++F++ FK+I+  H
Sbjct:   55 NSCVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMACLYQVLD-RWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAAVLIGVTWLVGFSISIPPMLIMKSQPKSKAEDIANPEACMISHDPWYTIYSTFCAFYIPLILMLVLYGRIFKAARFRIRKTVRKSEKVKCLTVSPALFKKSNGELKSWRSSVEPKPIADCSNGAAKRHDDGESLEIVEEVQPGGAKSSLPLPNAPGQVPLFENRHEKNTEAKRKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFCPSCQMPV------WLMDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKIIKCH 411          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 197.593 bits (501), Expect = 1.916e-57
Identity = 125/350 (35.71%), Postives = 187/350 (53.43%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEP---FRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDV---EKTGT---------------GPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEK-YLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N  VI AI L + LQ  +N+LI SLA +D  VS+LV+P+A   Q++  RW   ++ CD FI  DVL CTSSIL+LC I++DRY  IT P+ YV +RTP      I+  W++   ISIPP++ W+ P     P  C+++++ GY IY+T GAFYIPLI+MLVLY RIF+ AR   +++ K+   T + + +   ++ N++   ++A E        P     +  Q +  D+   E  G                 P   P +++Q  N + A                        K  L++S    E+ +L P  + +  WLGY NS LNP+IYA FN++F+N FK+I+
Sbjct:   54 NSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLD-RWTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPPMLGWRTPEDRADPNACKISQDHGYTIYSTFGAFYIPLILMLVLYSRIFRAARFRIRKNVKK--ATEKKSFDAPFAISNRAEMPSAAAEAETAAPPSPAPCNGDSKQRSHRDLALPEAVGARSPSSLAHSSARPHLSPAMMPTQQQQHGNGTGADACR-------------------RKTALLISPFCGERCHLPPGVFAVINWLGYSNSLLNPIIYAYFNKDFQNAFKKII 381          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 196.052 bits (497), Expect = 2.210e-56
Identity = 112/365 (30.68%), Postives = 191/365 (52.33%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVW--KEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTS----------------------LPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKT-----------NP--RKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N LVI AI   +KL+ P+N+LI SLA +D  V+ LVMPVA    ++   W      CD ++  DV  CT+SIL+LCAI++DR+  IT   +Y  +RTP      IA +W+++  IS+PP + W  ++P +P      +++ Y IY+T GAFY+PL ++L LY RIF+ A+ + ++   ++     ++ E   S                      LP     + ++  D+ L + + + +  +         +++   P++            P  +++   + E +A  TLG+I+G F +CWLPFFI +++  +     V       P   +L  WLGY+NS +NP+IY  FN +F++ F++++
Sbjct:   65 NALVIAAISATRKLRQPANYLIGSLAVADLLVAALVMPVAA-AYVVTGEWALGGALCDLWLSLDVTCCTASILHLCAIALDRFWAITDAAEYAHKRTPGRAALMIAASWLLAACISVPP-LFWRRRDPAKPRCIIEHDHVLYTIYSTFGAFYVPLALLLALYCRIFRAAKRLYEKRESKQREKLSVSAESAVSLEQPSQSQHQQQQQQPAGKLFRLPQPFCMSETSSSDQTLAQAERSGQHQQSVSAVARRSKRSLRPPRSVRFMSARLDQRRPCLQERISGSRERRAAKTLGLILGAFVVCWLPFFIKELVVNLCKSCAVS------PEVADLLTWLGYMNSLINPLIYTMFNEDFKSAFRKLV 421          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006411.1 (pep scaffold:Pmarinus_7.0:GL477077:14345:22367:-1 gene:ENSPMAG00000005791.1 transcript:ENSPMAT00000006411.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.185 bits (461), Expect = 3.558e-52
Identity = 102/332 (30.72%), Postives = 169/332 (50.90%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGT---CQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILF 1488
            N LVI+ I  VK      + L+ S+A SD  V+ LVMP+++ +++   RW    + CD +I CDVL CT+SI N+ AI++DR+  ITR ++Y  R    +    IA  W++S  IS+ P+  W E +       C L++   Y +++T+GAFY+PL ++L +Y++I+K  +      +++      M+D  + +                    DP+++P        F V       +       +   E +A   +G+++  F LCW+PFFI +++ P+           + P    +FLWLGY NSF NP+IY  FN+ + N F+ I F
Sbjct:   50 NVLVIVTILRVKTFHRVPHNLVASMAVSDVLVAALVMPLSLVSEVHERRWRLGPVMCDVWISCDVLCCTASIWNVTAIALDRFWSITRHLEYTTRARKCISNLMIALTWLLSATISLSPLFGWGEGYYSAESQRCHLSQGPSYTVFSTVGAFYLPLCVVLFVYWKIYKATKFCF--GSRKANSVMPMSDAIEAN--------------------DPSRKPQ-----TVFTVRHATVTFQIGEGDMWREQKERRAALMVGILIAVFVLCWIPFFIKELISPLCSCD-------VPPVWKSIFLWLGYSNSFFNPLIYTAFNKNYNNAFRNIFF 347          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Sea Lamprey
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 168.703 bits (426), Expect = 4.069e-46
Identity = 116/401 (28.93%), Postives = 190/401 (47.38%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVW--------KEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQE---------DAKRKLGTGQMTD----------------EEQTSLPNQSGRTNSA----------------EEDRKLLRFDPTQRPSEGNQGNGFDVEK--TGTGPKTNP-------------RKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININA 1512
            N LVI+A+     L+ P N  ++SLA +D  V+ LV+P +++N+LM + W F  ++C+ ++  DVL CTSSI++LCAIS+DRY  +++ ++Y ++RTP  I   I   W I+  IS+PP+I          +E  RP  C+L  N  Y + + +G+F+ P +IM+++Y RI+ L +  A +          + R + + +M++                       N +G  + +                + +   +  D  +R  +G+        K  + T    NP             R+K     E +    L V++G F +CW PFF    L  +         + L    ++ F W GY NS LNPVIY  FNR+FR  FK+IL   C+  +A
Sbjct:   69 NCLVIIAVLTRPSLKAPQNLFLVSLATADILVATLVIPFSLFNELMGY-WYFGRVWCEIYLALDVLFCTSSIVHLCAISLDRYWSVSQAVEYNIKRTPRRIKRIIVIVWFIAIAISLPPLISMNQKNRQQQEEVGRPN-CELNTNTWYILGSCIGSFFAPCLIMVLVYARIYHLVKWRAAKLRRDKEAPITSCRPMESIRMSEVNGNGGGGGGGGGGGEGNGNGEKNCNGAGDKSRHHPHHHPPSHHHPEVDVEETSVSSDKNERRRDGDSAGAKASRKPCSPTKDDYNPEMEILERQNKARERRKIAQARERRFTFVLSVMIGVFVICWFPFFFTYSLSALCSPESCAIPETL----FKFFFWFGYCNSCLNPVIYTVFNRDFRRAFKKIL---CMQFHA 460          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008360.1 (pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1 gene:ENSPMAG00000007563.1 transcript:ENSPMAT00000008360.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.236 bits (417), Expect = 9.505e-45
Identity = 120/422 (28.44%), Postives = 188/422 (44.55%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-----------------------TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKL----ARNMAQEDAKRKLGTGQMTDEEQTSL-------------------------PNQ--------SGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNP----------------------------------RKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N LV +A+F  K L+   N  ++SLA +D  V+ LVMP ++ N+LM + W F   +C+ ++  DVL CTSSI++LCAIS+DRY  +T+ ++Y ++RTP  +   I   W+I+ LIS PP++    P  P                        TC+L E   Y + +   +F+ P +IML++Y RI+++    AR+  +  ++R+       + +   L                         P Q        +G   S+  D ++L  +  ++P+   Q    + ++TGT   T                                    R+K  +  E +    L V+MG F  CW PFF    L  I   S     +YL    ++ F W GY NS LNP+IY  FN++FR  FK IL
Sbjct:   51 NSLVAIAVFTSKSLKAAQNLFLVSLAAADILVATLVMPFSLANELMGY-WVFGSFWCEMYLALDVLFCTSSIVHLCAISLDRYWSVTQAVRYNMKRTPRRVKRAIVIVWVIAALISFPPLVGTGRP--PANIHRHRHQGSGRNASSSPSSVLPTCKLNEETWYVLSSCTASFFTPCLIMLLVYARIYQVAKGRARHWIRGGSERESPFPSAFESQADELRPPFPPPPPRQHPPPSLSTPLAPCAPRQNGQCVRDAAGEDGSSAPDEEVL-VETAEKPTHDLQQQQEEQDETGTIRATRASVMDVWWRRGGDDAGGAGGSGGGDDGGGDDTKMARRKLTAAREKRFTFVLAVVMGVFVACWFPFFFSYSLTKICEAS-CKPPEYL----FKFFFWCGYCNSSLNPLIYTVFNQDFRRAFKNIL 463          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Nematostella
Match: EDO36610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI87])

HSP 1 Score: 131.339 bits (329), Expect = 4.280e-34
Identity = 94/339 (27.73%), Postives = 154/339 (45.43%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-----TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQIL---KPILI----VSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQI 1482
            NF+V+LA+ L  +++T +N+ ++SLA SD  V+ L +P  ++       W      C  +I+ D++ C +SI NL  IS+DR++ I  P +Y    TP+     I   WI+S  + +  +I W E   P       C+  + + Y + + +G F++PL I+L++Y ++F +A N A+  A  +                    T+S    R                                 R       E KA   L +++GCF +CW PFF++ ++   +P  +    +SK       L + Y     L  LNS LNP+IYA FNR+FR  F +I
Sbjct:   16 NFMVVLAVVLFHRMRTITNYFVVSLAVSDLLVATLSLPFRIHQTTHNTAWCLGLEACVAWIVVDIICCGASIWNLAMISVDRFIAIVMPFRYHALMTPMTGVCLIGAVWILSMGMGMLSLINWTELGSPHFHIEVQCRKFDPVYYTVVSVVG-FFLPLFIVLLMYGQVFVVAMNQARAVAALQ--------------------TDSKRRGR---------------------------------RSSINLVKEVKAAKILAIVVGCFVVCWFPFFVLTLVSLWEPHALSKETISKDTARGITLTFVYV----LPVLNSTLNPIIYALFNRDFRRAFGKI 296          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Nematostella
Match: EDO28321 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6T3])

HSP 1 Score: 130.954 bits (328), Expect = 7.426e-34
Identity = 91/335 (27.16%), Postives = 156/335 (46.57%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-----TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFI---IQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQI 1482
            NF+V+LA+ + ++++T +N+ ++SLA SD  V++L +P  ++       W  S   C  +I+ D++   +SI NL  ISIDR++ I  P +Y    TP+   G IA  W +S ++++   I W +  +P      +C   + + Y + + +  F++PL I+ V+Y R+F +A N A+  A  +      TD + T+   + G  N  +                                            E KA   L +++GCF +CW P+F+   + +  PIL+  +    +            L  LNS LNP IYA FN++FR  F +I
Sbjct:   25 NFMVVLAVVMFRRMRTITNYFVVSLAVSDLLVAMLSLPFRIHQTTHNTAWCLSLEACVAWIVVDIICAGASIWNLAIISIDRFIAIVLPFRYHALMTPISGFGLIASVWGLSFVMAVLSFINWTDYGKPHFNIFISCANFDPIYYTVVSVV-LFFLPLYIVFVMYGRVFTVALNHARAVAALQ------TDRQATTDGGRRGSINFLK--------------------------------------------EVKAAKVLAIVVGCFVVCWFPYFVLVLVSLWDPILLSRETISPEQAKGITQTFVYVLPVLNSTLNPFIYALFNKDFRRSFAKI 308          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Nematostella
Match: EDO36608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI85])

HSP 1 Score: 130.954 bits (328), Expect = 8.264e-34
Identity = 91/336 (27.08%), Postives = 155/336 (46.13%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-----TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFI---IQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            NF+V+LA+ + ++++T +N+ ++SLA SD  V+ L +P  ++       W  S   C  +I+ D++   +SI NL  ISIDR++ I  P +Y    TP+   G IA  W +S ++++   I W +  +P      +C   + + Y + + +  F++PL I+ V+Y R+F +A N A+  A  +      TD + T+   + G  N  +                                            E KA   L +++GCF +CW P+F+   + +  PIL+  +    +            L  LNS LNP IYA FN++FR  F +I 
Sbjct:   25 NFMVVLAVVMFRRMRTITNYFVVSLAVSDLLVATLSLPFRIHQTTHNTAWCLSLEACVAWIVVDIICAGASIWNLAIISIDRFIAIVLPFRYHALMTPISGFGLIASVWGLSFVMAVLSFINWTDYGKPHFNIFISCANFDPIYYTVVSVV-LFFLPLYIVFVMYGRVFTVALNHARAVAALQ------TDRQATTDGGRRGSINFLK--------------------------------------------EVKAAKVLAIVVGCFVVCWFPYFVLVLVSLWDPILLSRETISPEQAKGITQTFVYVLPVLNSTLNPFIYALFNKDFRRSFAKIF 309          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Nematostella
Match: EDO35211 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM55])

HSP 1 Score: 128.642 bits (322), Expect = 5.244e-33
Identity = 94/330 (28.48%), Postives = 151/330 (45.76%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWP--FSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N LV  A +L + L+T +N+ ++SLA +D  V  + MP+  +   + F+WP   SE++   ++  D+   T+SI+NL  IS+DR+  IT P QY  + T       I   W+ +  +S    I +  P R    Q +   GY  +    +F++PL +M+  Y RIF +AR                          Q+ +    +  R  +     + P  GN           T   +   +++  + + KA  TL ++MG F LCW P+ I  +L+          +KY L    +   WL Y NS LNP+IY   NR FR+ FK++L
Sbjct:   19 NSLVCAAFYLFRDLRTVTNYFVVSLAIADLLVGFVSMPL--WFTYLVFQWPPQNSEIYA-LWLCFDIATATASIMNLAVISVDRFYAITLPFQYSQKITKKRACLAIVFVWLYAFAVSSSRAISFAIPSRESRAQFS--FGYTFFVATASFFVPLPVMIYCYTRIFSVAR-------------------------VQAAKIRELDSVRSFI-----ESPRNGNS------RPVLTSQSSFRLQRRALSTDIKAAKTLAIVMGAFLLCWAPYIIALLLEVSCPRCVPFQDKYTLAKAVK---WLVYSNSALNPIIYTALNRAFRDAFKRVL 304          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Nematostella
Match: EDO36609 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI86])

HSP 1 Score: 129.028 bits (323), Expect = 7.694e-33
Identity = 90/340 (26.47%), Postives = 154/340 (45.29%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-----TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFI---IQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHC 1497
            NF+V+LA+ + ++++T +N+ ++SLA SD  V+ L +P  ++       W  S   C  +I+ D++   +SI NL  ISIDR++ I  P +Y    TP+   G IA  W +S ++++   I W +  +P      +C   + + Y + + +  F++PL I+ V+Y  +F +A   A+  A  +      TD + T+   + G  N  +                                            E KA   L +++GCF +CW P+F+   + +  PIL+       +            L  LNS LNP+IYA FN++FR  F +I    C
Sbjct:   46 NFMVVLAVVMFRRMRTITNYFVVSLAVSDLLVATLSLPFRIHQTTHNTAWCLSLEACVAWIVVDIMCAGASIWNLVIISIDRFIAIVLPFRYHALMTPISGFGLIASVWGLSFVMAVLSFINWTDYGKPHFNIFISCANFDPIYYTVLSVV-LFFLPLFIVFVMYGHVFTVALTQARAVAALQ------TDRQATTDGGRRGYINFLK--------------------------------------------EVKAAKVLAIVVGCFVVCWFPYFVLVLVSLWDPILLSRDTISPEQAKGINQTFVSALPVLNSTLNPIIYALFNKDFRRSFAKIFAQFC 334          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Medaka
Match: htr7c (5-hydroxytryptamine (serotonin) receptor 7c [Source:ZFIN;Acc:ZDB-GENE-060526-5])

HSP 1 Score: 244.973 bits (624), Expect = 7.693e-74
Identity = 137/357 (38.38%), Postives = 200/357 (56.02%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVW-KEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQS--NNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLP-WCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPMQ 1560
            N LV++A+ +VKKL+ PSN+L++SLA +D  V+++VMP  +   L   +W F E+FC+ FI  DV+ CT+SI+ LC IS+DRYL ITRP+ Y  R+   L+   I G W++S  I++PP   W K   + G C ++++ GY IY+T  AFYIP+++MLV+YY+IF+ AR   +  AK +  T  +  E   ++ N++ R                    +G + +G   E        N  +K  S    E KA TTLGVI+G F +CWLPFFI+   +P +       E   +P W     LWLGY NS +NP IYA FNR+ R+ ++ +L     NIN R+      E     MQ
Sbjct:  105 NTLVVIAVCVVKKLRQPSNYLLVSLAVADLSVAIVVMPFVIVTDLTGGKWLFGEVFCNIFIGMDVMCCTASIMTLCVISVDRYLGITRPLTYPARQNGQLMAKMILGVWLVSASITLPPFCGWAKNVHKAGVCLISQDFGYTIYSTAVAFYIPMLVMLVMYYKIFRAAR---KSGAKHRF-TDLLRRERLETVANEALRM-------------------QGLKPSGVAEECATLSRLLNRERKNISIFKREQKAATTLGVIVGVFAVCWLPFFILSTARPFI----CGVECSCVPIWLERTLLWLGYANSLMNPFIYAFFNRDLRSTYRDLLRCRYRNINRRLSAVGVHEALKKSMQ 434          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Medaka
Match: ENSORLT00000005282.2 (pep primary_assembly:ASM223467v1:9:8571029:8576106:1 gene:ENSORLG00000004220.2 transcript:ENSORLT00000005282.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 236.113 bits (601), Expect = 9.770e-71
Identity = 139/364 (38.19%), Postives = 202/364 (55.49%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWK---EPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPN-QSGRTNSAEEDRKLLRFDPTQRPS--------EGNQGNGFDVEKTGTGPKTN-----------------------PRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLP-WCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            N  V+ AI L + LQ  +N+LI SLA +D  VSVLV+P+A   Q++  +W   +  CD FI  DVL CTSSIL+LCAI++DRY  IT P+ YV +RTP+     I   W+I   ISIPP++ W+   +   P  C ++++ GY IY+T GAFYIPLI+MLVLY RIF+ AR   ++  K K+ T +++D+     P     ++N     R   R D ++  S         G++G   ++ +  +  KT+                        ++K   + E K + TLG+IMG F  CWLPFFI+ ++ P         E   +P W   +  WLGY NS LNP+IYA FN++F+N FK+I+
Sbjct:   60 NACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLN-KWTLGQEICDLFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPMRAVLLICATWLIGFSISIPPMLGWRSAEDRANPDACMISQDPGYTIYSTFGAFYIPLILMLVLYGRIFRAARFRIRKTVK-KIETAKVSDKCLAVSPAFFHKKSNGQSGGRGWKRCDGSKPSSPCVNGAVMHGDEGESLEIIEVISNSKTHLPLPNTPQSSSHGYENMNERNSGAKRKLALSRERKTVKTLGIIMGTFIFCWLPFFIVALVLPFC------PESCFMPDWLGAVINWLGYSNSLLNPIIYAYFNKDFQNAFKKII 415          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Medaka
Match: htr7a (5-hydroxytryptamine receptor 7 [Source:NCBI gene;Acc:101173573])

HSP 1 Score: 225.328 bits (573), Expect = 2.115e-66
Identity = 126/357 (35.29%), Postives = 188/357 (52.66%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPG-TCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKR---KLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQS--NNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLP-WCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGL 1551
            N LV++++  VKKL+ PSN+LI+SLA +D  V++ VMP      L+  +W F + FC+ FI  DV+ CT+SI++LC ISIDRYL IT+P+ Y VR+    +   +   W++S  I++PP+  W +    G  C ++++ GY +Y+T  AFYIP+ +ML++YYRIF+ A+  A +       +LG  Q    E               E+    R     +  E +Q                 ++K QS    E KA  TLG+++G FT CWLPFF++   +P +       E   +P W     LWLGY NS +NP IYA FNR+ R  +  +L     NIN ++      E   L
Sbjct:  113 NMLVVISVCFVKKLRQPSNYLIVSLAVADLSVALAVMPFVSITDLIGGQWVFGQFFCNVFIAMDVMCCTASIMSLCVISIDRYLGITKPLTYPVRQNGCCMAKMVLSVWLLSASITLPPLFGWAQNVNDGRVCLISQDFGYTVYSTAVAFYIPMSVMLIMYYRIFRAAKLSAAKHTITGFPRLGDSQALQRE--------------VEEECSTRVSRLLKSGEHHQ---------------RRKRKNQSIFKREQKAAATLGIVVGAFTFCWLPFFLVSTARPFI----CGVECSCVPLWLERTLLWLGYANSLINPFIYAFFNRDLRTTYSNLLRCRYRNINRKLSAAGMHEALKL 436          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Medaka
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 223.402 bits (568), Expect = 3.524e-66
Identity = 136/371 (36.66%), Postives = 199/371 (53.64%), Query Frame = 1
Query:  502 NFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWK--------EPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLA----RNMAQEDAKRKL-----------------GTGQMTDEEQT------SLPNQSGRTNSAEEDRKLLRFDPTQRPSEG-----NQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFH 1494
            N  V+ AI L + LQ  +N+LI SLA +D  VSVLV+P+A   Q++   W   ++ CD FI  DVL CTSSIL+LCAI++DRY  IT P+ Y+ +RTP      I+  W++   IS+PP++V +        +   P  C++ ++  Y IY+T GAFYIPL +MLVLY RIFK A    R   ++  K+K+                 G  Q    +++      +LP+ +G    A ED + L        S G     N  +   + ++     T  ++K     E K + TLG+IMG F LCWLPFFI+ ++ P           Y+  W  ++  WLGY NS LNP+IYA FN++F++ FK+I+  H
Sbjct:   36 NACVVAAIVLERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLN-SWTLGQVPCDIFISLDVLCCTSSILHLCAIALDRYWAITEPIDYMKKRTPRRAAVLISVTWLVGFSISVPPMLVMRSQPGSMAEDRANPKQCKIRQDPWYTIYSTFGAFYIPLTLMLVLYGRIFKAARFRIRRTVRKTEKKKVADSCLAISPSLFHKTPHGDAQGKSWKRSVEPRPLALPSVNGAVKHA-EDGESLEIIEVHSNSRGNLPLPNTPSTVPLFESRHDKATEAKRKIALARERKTVKTLGIIMGTFILCWLPFFIVALVMPF-----CQESCYMPRWLEDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKIIKCH 399          
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Medaka
Match: ENSORLT00000018283.2 (pep primary_assembly:ASM223467v1:22:9799933:9805173:-1 gene:ENSORLG00000014581.2 transcript:ENSORLT00000018283.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 212.616 bits (540), Expect = 2.294e-62
Identity = 126/370 (34.05%), Postives = 200/370 (54.05%), Query Frame = 1
Query:  403 RLVVPFECEKYPVGMEVFLXXXXXXXXXXXXXXNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTE------NLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQE---DAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQIL 1485
            R   P   E   +G++V L ++  ++ +  +  N  VI  IFL +KL TP+N+LI SLA +D  VS+LVMP+++   + +  W   ++ CD ++  D+  CT+SIL+LC I++DRY  IT  ++Y  RRT       +   W+IS  IS+PP + W++       +LTE       + Y +Y+T GAFY+P +++++LY RI+  AR+   +    + ++  T Q+    QTS  +     NS       L    T+    G      +  K         RK+  +  E KA  TLG+I+G F +CWLPFF+  +   +L + K   E +  P  ++LF WLGYLNS +NPVIY  FN EF+  F++++
Sbjct:   19 RSAAPTWSEDMLLGLQVSLSVLLALVTLATVLSNAFVITTIFLTRKLHTPANFLIGSLAVTDLLVSILVMPISILYTVSK-TWSLGQIVCDIWLSSDITFCTASILHLCVIALDRYWAITDALEYPKRRTMRRAAMMVGVVWVISISISMPP-LFWRQA--KAHEELTECVVNTDQISYTLYSTFGAFYVPTVLLIILYGRIYMAARSRILKTPCSSGKRFTTAQLI---QTSAGSSLCSLNSTSHQEAHLHSGSTR---SGGSPLFMNSVKVKLADSVLERKRLCAARERKATKTLGIILGAFIVCWLPFFVGTL---VLAICK---ECWFHPILFDLFTWLGYLNSLINPVIYTAFNDEFKQAFQKLI 372          
BLAST of 5-hydroxytryptamine receptor 1A vs. Planmine SMEST
Match: SMESG000017736.1 (SMESG000017736.1)

HSP 1 Score: 910.598 bits (2352), Expect = 0.000e+0
Identity = 458/458 (100.00%), Postives = 458/458 (100.00%), Query Frame = 1
Query:  340 MQNIVLNCSNYTNYVRINNLSRLVVPFECEKYPVGMEVFLXXXXXXXXXXXXXXNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPMQKTMSTSQYETTHLNTHVNSRRRSSVPFTPVSRKNKSSCQSRPTSDQSVNKA 1713
            MQNIVLNCSNYTNYVRINNLSRLVVPFECEKYPVGMEVFLGMIFVVIVVGAIGGNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPMQKTMSTSQYETTHLNTHVNSRRRSSVPFTPVSRKNKSSCQSRPTSDQSVNKA
Sbjct:    1 MQNIVLNCSNYTNYVRINNLSRLVVPFECEKYPVGMEVFLGMIFVVIVVGAIGGNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPMQKTMSTSQYETTHLNTHVNSRRRSSVPFTPVSRKNKSSCQSRPTSDQSVNKA 458          
BLAST of 5-hydroxytryptamine receptor 1A vs. Planmine SMEST
Match: SMESG000017113.1 (SMESG000017113.1)

HSP 1 Score: 419.853 bits (1078), Expect = 5.655e-140
Identity = 235/439 (53.53%), Postives = 287/439 (65.38%), Query Frame = 1
Query:  358 NCSNYTNYVRINNLSRLVVPFECEKYPVGMEVFLXXXXXXXXXXXXXXNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTG------------QMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLP----MQKTMSTSQYETTHLNTHVNSRRR 1626
            NC+ Y      +N++ L VPF C K+    E+FL +IF V VVG  GGN LVI+++ +VKKLQTPSN+LI++LA SDF VS+LV+P A++  + R RWPFSE+ CD FI  DV+LCTSSILNLCAISIDRYLVITRP+QY V RTP  I   IA +WI S LISIPP+  WKE F PG C  +ENL YQIYAT GAFYIPL++ML+LY RIFKLAR +AQ DAK K+G              ++ D    S PN  G+ N +     L+    +   SE +Q                 R K +S+ E+KAITTLGVIMGCFT+CWLPFFIIQI KPIL V+ V+   Y   W  E+ LWLGY NSFLNP+IYAKFNREFR PFKQIL   C +INAR+R +TF ++YGLP      K  S  Q    + +   N RRR
Sbjct:    8 NCTLYLQLASNSNINALQVPFYCVKFSFDFEMFLIVIFTVFVVGTAGGNLLVIMSVAIVKKLQTPSNFLIVNLACSDFLVSILVLPGAIHQTINRSRWPFSEILCDVFISFDVILCTSSILNLCAISIDRYLVITRPLQYAVNRTPARISLMIAISWIASALISIPPLFGWKETFIPGQCSYSENLLYQIYATFGAFYIPLLVMLILYGRIFKLARVLAQNDAKMKIGISPNSSDREHQPNLRIVDSHLCSTPN--GQMNLSLYSGSLVSIIKSTNFSESSQNK----------LNNRSRAKIKSSTETKAITTLGVIMGCFTICWLPFFIIQIAKPILKVASVNSVNYFPIWLIEICLWLGYFNSFLNPIIYAKFNREFRTPFKQILLCRCSSINARLRSETFVQEYGLPNSLVNNKRGSMDQTSLNNGSFTKNRRRR 434          
BLAST of 5-hydroxytryptamine receptor 1A vs. Planmine SMEST
Match: SMESG000045237.1 (SMESG000045237.1)

HSP 1 Score: 362.844 bits (930), Expect = 2.850e-119
Identity = 203/382 (53.14%), Postives = 257/382 (67.28%), Query Frame = 1
Query:  424 CEKYPVGMEVFLXXXXXXXXXXXXXXNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAK-RKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGFDVEKTGTGP------KTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYG 1548
            C +Y   +E  L ++F +++ G +GGN LVI AI LVKKLQ PSN+LILSLA SD  V+   +P+  + QL    WPFSE FCD FI  DVLLC+SSILNLCAISIDRYL+IT+P+QY  RRT   +   I   W +SGLISIPPVI WKE F PG C  +ENLGYQIYAT GAFYIPLIIMLVLY RIFKL ++M ++DAK  K  +   +D  +  +P+ +  +   E   K L        S+ +  +  D +K           K   + +K +  E+KAITTLGVIMGCFT+CWLPFF+IQ++KP+L V+ +D   Y+  W  ++FLWLGYLNSFLNP+IYAKFNREFR PFK IL   C+ INA IR + + +QYG
Sbjct:   25 CWRYNSTIEHLLIVLFTLLIFGTLGGNCLVISAIILVKKLQIPSNFLILSLAASDTLVAFF-LPLVAFIQLRGGHWPFSETFCDIFICLDVLLCSSSILNLCAISIDRYLIITKPLQYGSRRTLKQMFLMILLVWFLSGLISIPPVIGWKEGFIPGKCIYSENLGYQIYATCGAFYIPLIIMLVLYGRIFKLTQSMVKKDAKLHKRASRYASDVLK--MPDLNDDSVVKENMCKRLSL------SDQSSNDWMDSKKLAISNAKEEFIKQYKKTEKANYAENKAITTLGVIMGCFTICWLPFFVIQLIKPLLKVANIDSNLYISQWIQDMFLWLGYLNSFLNPIIYAKFNREFRTPFKLILLCKCVGINAVIRSEAYTQQYG 397          
BLAST of 5-hydroxytryptamine receptor 1A vs. Planmine SMEST
Match: SMESG000075748.1 (SMESG000075748.1)

HSP 1 Score: 319.316 bits (817), Expect = 4.089e-101
Identity = 204/508 (40.16%), Postives = 279/508 (54.92%), Query Frame = 1
Query:  394 NLSRLVVPFECEKYPVGME----VFLXXXXXXXXXXXXXXNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEE--DRKLLR-----FDPTQR----------------PSEGNQG-----NGF------DVEKTGTGPKTNPRKK-------------------------------------KQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPMQKTMSTSQYETTHLNTHVNSRRRSSVPFTPVSRKNKSSCQSRPTS 1692
            NL+ L +P +C   PV  +    + +  +  ++ VG    N L+I A+ LVKKL+TP N LIL+LA +D  V  LV+P A   Q+  + W F E+ CD FI+ DVLLCTSSILNLCAIS+DRYLVIT+P +Y V+RT   +   I   W  SGLISIPP+  W++   P TC  +E+LGYQIYAT  AFY+PL++MLVLY RIF+LA+ M   + K K+ T   ++   TS+  +   T+  E+   +  L+     F P  R                P     G     N F      DV KT  G   N R++                                     ++++ E+KA+ TLG+IMGCFT+CWLPFF++QIL PIL +  +++       C+++F WLGY NSFLNP+IYAKFNREFR PF QIL  HC +INA +R +T+ +QYG     T S+ Q  + H      S   +S+P  P+SR  + S   R TS
Sbjct:   30 NLTFLQLPEQCR--PVSYDKVPLIVISTVLTLLSVGTCIDNCLMISAVALVKKLRTPCNMLILNLAVTDLLVGTLVIPFASIYQIKGY-WIFDEIVCDIFILFDVLLCTSSILNLCAISVDRYLVITQPFKYAVKRTRKRMLCMILLVWTASGLISIPPLFGWRQKRHPYTCDYSEDLGYQIYATFIAFYLPLVVMLVLYGRIFRLAKAMVAAEIKNKINT-DCSESITTSVSRRGSFTDDGEDTTTKGTLQVVGDFFKPISRRLSFRINTDNSNTIYNPVYDEMGLSPKKNVFFNRRSSDVSKTSLGNVNNKRRQVNPMDVPIIQIDYTGIKDENQNSEYLQNKPMQNFHKPQKASVEAKAVRTLGIIMGCFTICWLPFFLMQILFPILKMLNIEYSNGATNICFQIFYWLGYTNSFLNPLIYAKFNREFRRPFCQILMCHCRHINAHLRSETYNDQYG-----TNSSRQKASQHR----LSTTYTSIP--PISRNGRMSRTRRSTS 522          
BLAST of 5-hydroxytryptamine receptor 1A vs. Planmine SMEST
Match: SMESG000031003.1 (SMESG000031003.1)

HSP 1 Score: 315.849 bits (808), Expect = 8.913e-101
Identity = 188/447 (42.06%), Postives = 258/447 (57.72%), Query Frame = 1
Query:  418 FECEKYPVGMEVFLXXXXXXXXXXXXXXNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPM-QYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAKRKLGTG----------------QMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPT-----------------QRPSEGNQGNGFDVEKTGTGPKTNPRK-KKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQILFFHCININARIRVDTFAEQYGLPMQKTMSTSQYETTHLNTHVNSRRRSSVPF-TPV 1650
            F  E+Y V  ++ L  +  VI VG I GN L+I+A+FLV+KL TPSN L+ SLA SDF V+V V+P A+  Q+  + W FSE  CDFFI  D+LLCT+SILNLC ISIDRY  I +P+ QY     P+ +   I   WI+SGLISIPPV  WKEPF  G C  +E+L YQ YATLGAFYIPL++ML+LY RI+++A+ +A+ +   +   G                 +      ++P      N+     ++L  + +                 QR S+ +     D   +    K   +   K+  +ESKAI TLG++MGCFT CW PFF +Q++ P++    ++  KY+  W  E FLWLGY NSFLNP+IYAKFN++FR PFK+IL  HC +IN R+R  ++ EQ+G    +   +    T  L     SRR SS P  TP+
Sbjct:   27 FNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGY-WLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRPVFL--MICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQVAKKIAKNNNVNQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLSKKIISESKAIKTLGILMGCFTFCWFPFFTLQLIVPVIKTYNIN-TKYIPMWVRETFLWLGYFNSFLNPIIYAKFNKDFRQPFKEILSCHCKSINNRLRTASYTEQFGKSFVQRRRSGYESTLQLPA---SRRSSSRPHKTPI 466          
The following BLAST results are available for this feature:
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HTR1A2.224e-7138.865-hydroxytryptamine receptor 1A [Source:HGNC Symbo... [more]
HTR71.415e-6536.835-hydroxytryptamine receptor 7 [Source:HGNC Symbol... [more]
HTR71.891e-6536.835-hydroxytryptamine receptor 7 [Source:HGNC Symbol... [more]
HTR75.409e-6536.835-hydroxytryptamine receptor 7 [Source:HGNC Symbol... [more]
HTR1F6.594e-6034.405-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ser-71.531e-6536.27SERotonin/octopamine receptor family [Source:UniP... [more]
ser-78.466e-6536.51SERotonin/octopamine receptor family [Source:UniP... [more]
ser-71.712e-6436.71SERotonin/octopamine receptor family [Source:UniP... [more]
octr-12.413e-5632.39OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
octr-14.689e-5632.21OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
5-HT72.868e-7838.36gene:FBgn0004573 transcript:FBtr0334508[more]
5-HT72.868e-7838.36gene:FBgn0004573 transcript:FBtr0085746[more]
Dop2R1.854e-5133.88gene:FBgn0053517 transcript:FBtr0343167[more]
Dop1R27.948e-5132.10gene:FBgn0266137 transcript:FBtr0085468[more]
Dop1R27.980e-5132.10gene:FBgn0266137 transcript:FBtr0085467[more]
back to top
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr1aa8.125e-7339.555-hydroxytryptamine (serotonin) receptor 1A a [Sou... [more]
CR555296.11.634e-7138.535-hydroxytryptamine (serotonin) receptor 7b [Sourc... [more]
htr7c3.142e-7138.085-hydroxytryptamine (serotonin) receptor 7c [Sourc... [more]
CR450836.28.215e-7138.245-hydroxytryptamine (serotonin) receptor 7b [Sourc... [more]
htr7b8.326e-7037.995-hydroxytryptamine (serotonin) receptor 7b [Sourc... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000046867.18.102e-7339.015-hydroxytryptamine (serotonin) receptor 1A, G pro... [more]
exd23.282e-6937.96exonuclease 3'-5' domain containing 2 [Source:Xenb... [more]
HTR1F3.559e-5934.735-hydroxytryptamine (serotonin) receptor 1F, G pro... [more]
HTR1B2.614e-5834.145-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
HTR1E1.457e-5633.625-hydroxytryptamine (serotonin) receptor 1E, G pro... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Htr1a1.218e-7040.225-hydroxytryptamine (serotonin) receptor 1A [Sourc... [more]
Htr78.517e-6637.115-hydroxytryptamine (serotonin) receptor 7 [Source... [more]
Htr71.016e-6537.115-hydroxytryptamine (serotonin) receptor 7 [Source... [more]
Htr71.687e-6537.115-hydroxytryptamine (serotonin) receptor 7 [Source... [more]
Htr1f9.521e-6336.285-hydroxytryptamine (serotonin) receptor 1F [Sourc... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 1A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20905|5HT1R_DROME2.875e-7738.365-hydroxytryptamine receptor 1 OS=Drosophila melan... [more]
sp|Q9N296|5HT1A_PONPY1.474e-7139.025-hydroxytryptamine receptor 1A OS=Pongo pygmaeus ... [more]
sp|P08908|5HT1A_HUMAN1.068e-7038.865-hydroxytryptamine receptor 1A OS=Homo sapiens OX... [more]
sp|Q9N297|5HT1A_GORGO1.173e-7038.755-hydroxytryptamine receptor 1A OS=Gorilla gorilla... [more]
sp|Q9N298|5HT1A_PANTR1.263e-7038.865-hydroxytryptamine receptor 1A OS=Pan troglodytes... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 1A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KU920.000e+099.58GCR052 OS=Schmidtea mediterranea OX=79327 GN=gcr05... [more]
O159690.000e+084.35Serotonin receptor-like planarian receptor 4 OS=Du... [more]
O159707.434e-13352.75Serotonin receptor-like planarian receptor 1 OS=Du... [more]
A0A267GD301.273e-12750.80G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A1I8GLU42.789e-12354.76G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr7c1.750e-7037.905-hydroxytryptamine (serotonin) receptor 7c [Sourc... [more]
ENSAMXT00000006138.24.811e-6639.04pep primary_assembly:Astyanax_mexicanus-2.0:6:2799... [more]
htr7a5.263e-6636.195-hydroxytryptamine receptor 7-like [Source:NCBI g... [more]
ENSAMXT00000007940.26.962e-6233.97pep primary_assembly:Astyanax_mexicanus-2.0:4:4294... [more]
htr1ab1.095e-6035.445-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009127.11.916e-5735.71pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
HTR1F2.210e-5630.685-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
ENSPMAT00000006411.13.558e-5230.72pep scaffold:Pmarinus_7.0:GL477077:14345:22367:-1 ... [more]
adra2c4.069e-4628.93adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
ENSPMAT00000008360.19.505e-4528.44pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO366104.280e-3427.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283217.426e-3427.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366088.264e-3427.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352115.244e-3328.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366097.694e-3326.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 1A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr7c7.693e-7438.385-hydroxytryptamine (serotonin) receptor 7c [Sourc... [more]
ENSORLT00000005282.29.770e-7138.19pep primary_assembly:ASM223467v1:9:8571029:8576106... [more]
htr7a2.115e-6635.295-hydroxytryptamine receptor 7 [Source:NCBI gene;A... [more]
htr1ab3.524e-6636.665-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
ENSORLT00000018283.22.294e-6234.05pep primary_assembly:ASM223467v1:22:9799933:980517... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 1A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017736.10.000e+0100.00SMESG000017736.1[more]
SMESG000017113.15.655e-14053.53SMESG000017113.1[more]
SMESG000045237.12.850e-11953.14SMESG000045237.1[more]
SMESG000075748.14.089e-10140.16SMESG000075748.1[more]
SMESG000031003.18.913e-10142.06SMESG000031003.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007010 ID=SMED30007010|Name=5-hydroxytryptamine receptor 1A|organism=Schmidtea mediterranea sexual|type=transcript|length=1943bp
GCATTAAAAACAGAACATCATAGAATTATAACAGAGATGCTCGTTTCTAA
CACAACCGCAGCCTTGTGCATTGGTATTTGATTTTCTTATATGCGCGCTG
CTATAATCAAAAAATTAATAAAAATAAAAGAACCATCAACCGGAGTAGCT
TATCCGTCATCTTGTTACAATGGTGAGTTGAATCAGTCCGATTTCATGAC
ACAGAAATTAAAAAAGAAAAAACGAATAGACATTAGAAAACCGTGAATAA
AAATATCAGAGTGAGATTTGCATCAAATCATGTCAGTGTGGAGATTAATA
ATAATAATTATCTTATTTTTATTGTTACCGACATGTCAAATGCAGAATAT
CGTACTGAATTGTTCAAACTACACGAATTATGTCAGAATCAACAATCTGT
CAAGACTTGTCGTTCCATTCGAATGCGAAAAGTATCCGGTCGGGATGGAA
GTATTTCTGGGAATGATTTTCGTTGTCATTGTTGTGGGAGCGATCGGTGG
AAACTTTTTAGTTATTCTCGCGATATTTCTCGTCAAAAAACTACAAACTC
CCAGTAATTGGCTAATTTTAAGTTTGGCTTTTAGTGATTTTTTTGTGTCG
GTTTTGGTCATGCCTGTCGCGGTTTACAATCAACTGATGAGGTTCAGATG
GCCGTTTTCTGAATTGTTTTGCGATTTCTTTATCATTTGTGATGTGTTAC
TCTGCACATCCAGCATTCTCAATCTTTGTGCGATTTCAATCGATAGGTAT
TTAGTGATAACTCGACCGATGCAATACGTCGTCCGCCGGACTCCGCTTTT
AATTGGAGGATTCATTGCAGGAGCTTGGATCATATCAGGATTAATTAGCA
TACCACCGGTAATAGTGTGGAAGGAACCCTTTAGACCTGGAACTTGCCAG
TTGACGGAAAATTTGGGATACCAGATATATGCCACTCTTGGTGCCTTCTA
CATTCCATTAATAATTATGTTGGTGCTATATTATCGAATTTTTAAACTAG
CAAGAAATATGGCCCAAGAAGATGCCAAGAGAAAATTAGGTACAGGTCAA
ATGACTGATGAAGAACAAACTTCATTGCCAAATCAGTCAGGAAGAACAAA
TTCCGCTGAAGAAGACAGAAAACTTCTTCGGTTTGATCCCACTCAAAGAC
CGAGTGAAGGAAATCAAGGTAATGGGTTCGATGTTGAGAAGACTGGAACT
GGACCTAAAACAAATCCCCGGAAAAAGAAACAGAGTAACAATGAATCGAA
AGCAATAACAACTCTAGGAGTTATTATGGGCTGTTTCACATTATGTTGGC
TTCCATTTTTCATAATTCAGATTCTCAAACCCATTCTCATTGTTTCTAAA
GTTGATCATGAAAAGTATCTTTTGCCTTGGTGTTACGAGCTGTTTCTGTG
GCTTGGTTATCTCAATAGTTTCCTGAATCCCGTGATATATGCCAAATTCA
ATAGAGAATTTCGAAACCCATTTAAACAGATTTTATTTTTTCACTGTATA
AATATCAATGCTCGAATTCGAGTAGACACATTTGCCGAACAATACGGTTT
ACCAATGCAAAAAACTATGTCGACCTCTCAGTACGAAACGACTCACTTGA
ATACTCACGTTAACAGTCGTCGTCGAAGTTCAGTACCTTTCACACCTGTA
AGTAGGAAAAATAAATCTTCTTGCCAATCAAGACCGACCTCAGATCAGTC
AGTAAACAAGGCCTGATATATACGACAATTTCAAATCAAACCATCAATTT
GTATAAAATTTTCAACAATTATTTTTACTTTAATATAATTGTAATGTTTT
GAAATTCGATTCTTTCAAGAATTAAGATTTTTTAGAATATATTGGTTAAT
TTTTTTATTAAAAACCATATATGTGTCAATTAAAACAACAAAAAAAATAT
TAATAAAATATTGTATTCAAGTGCATTTTTTAAAAACCTCTCC
back to top

protein sequence of SMED30007010-orf-1

>SMED30007010-orf-1 ID=SMED30007010-orf-1|Name=SMED30007010-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=479bp
MSVWRLIIIIILFLLLPTCQMQNIVLNCSNYTNYVRINNLSRLVVPFECE
KYPVGMEVFLGMIFVVIVVGAIGGNFLVILAIFLVKKLQTPSNWLILSLA
FSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLC
AISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEP
FRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMAQEDAK
RKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKLLRFDPTQRPSEGNQGNGF
DVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILK
PILIVSKVDHEKYLLPWCYELFLWLGYLNSFLNPVIYAKFNREFRNPFKQ
ILFFHCININARIRVDTFAEQYGLPMQKTMSTSQYETTHLNTHVNSRRRS
SVPFTPVSRKNKSSCQSRPTSDQSVNKA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0045202synapse
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007213G-protein coupled acetylcholine receptor signaling pathway
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0016907G-protein coupled acetylcholine receptor activity
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 174..195
score: 25.0
coord: 325..349
score: 33.28
coord: 92..113
score: 31.28
coord: 369..395
score: 38.49
coord: 215..238
score: 30.23
coord: 59..83
score: 25.95
coord: 138..160
score: 40.68
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 67..402
e-value: 1.1E-6
score: -10.8
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 74..387
e-value: 2.3E-74
score: 250.0
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 144..160
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 246..316
e-value: 3.6E-98
score: 331.0
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 66..399
e-value: 3.6E-98
score: 331.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 258..273
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 445..478
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 251..320
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 58..442
NoneNo IPR availablePANTHERPTHR24247:SF2215-HYDROXYTRYPTAMINE RECEPTOR 1coord: 58..442
NoneNo IPR availableCDDcd153297tmA_5-HT7coord: 58..398
e-value: 1.56873E-138
score: 397.026
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..21
score: 0.858
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 45..410
NoneNo IPR availableTMHMMTMhelixcoord: 174..196
NoneNo IPR availableTMHMMTMhelixcoord: 363..385
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 326..348
NoneNo IPR availableTMHMMTMhelixcoord: 131..153
NoneNo IPR availableTMHMMTMhelixcoord: 63..85
NoneNo IPR availableTMHMMTMhelixcoord: 216..238
NoneNo IPR availableTMHMMTMhelixcoord: 2..24
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 74..387
score: 44.524