FGGY carbohydrate kinase domain-containing protein

Overview
NameFGGY carbohydrate kinase domain-containing protein
Smed IDSMED30007003
Length (bp)2329
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FGGY carbohydrate kinase domain-containing protein (SMED30007003) t-SNE clustered cells

Violin plots show distribution of expression levels for FGGY carbohydrate kinase domain-containing protein (SMED30007003) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FGGY carbohydrate kinase domain-containing protein (SMED30007003) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FGGY carbohydrate kinase domain-containing protein (SMED30007003) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007003

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30007003SMESG000071132.1 SMESG000071130.1 dd_Smed_v4_10373_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Human
Match: FGGY (FGGY carbohydrate kinase domain containing [Source:HGNC Symbol;Acc:HGNC:25610])

HSP 1 Score: 301.597 bits (771), Expect = 1.726e-92
Identity = 165/444 (37.16%), Postives = 251/444 (56.53%), Query Frame = 3
Query:  969 NYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFM-DNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHW------HEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIID 2222
            ++RNVIMW+D RA  +   IN      L  VGG  SVEMQ PKLLWLK+N+     D  G  FDLPDFL ++ATG   RSLCS+ CKW + S   GWD  FWK  GL +   +N+S IGN  L PG+ + +GL+  AA++LGL   I V ASLIDA+AG LG I               +  +L  I GTS+CHM ++  PI++ G+WGPY + +   +++ E GQ++ G L+D +++             +L  +    C   + IY   ++H         +  L  D+H+ PDF GNR+P +D  ++G + GL +      ++ LYLAT+Q++  G + I++ +      I ++ +CGGLSKN L+ ++ AD++G+PV+L Q  E VL+GAA L         S+Q    K  +  + + P     KY+++KY+++ K+++
Sbjct:  107 SHRNVIMWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTY-SAEKGWDDSFWKMIGLEDFVADNYSKIGNQVLPPGASLGNGLTPEAARDLGLLPGIAVAASLIDAHAGGLGVIGADVRGHGLICEGQPVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQ-------GHAAFPELQVKATARC---QSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVE 539          

HSP 2 Score: 80.8777 bits (198), Expect = 3.392e-15
Identity = 45/99 (45.45%), Postives = 65/99 (65.66%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQ 323
            Y++GVDVG+ SVR  L     +++  L+   +  IK ++ + + +EQSS+DIW + C  T+ +V G  ID   I+G+GFDATCSLV LDK  HPL V+Q
Sbjct:   11 YYVGVDVGTGSVRAALV----DQSGVLLAFADQPIKNWEPQFNHHEQSSEDIWAACCVVTKKVVQG--IDLNQIRGLGFDATCSLVVLDKQFHPLPVNQ 103          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Human
Match: FGGY (FGGY carbohydrate kinase domain containing [Source:HGNC Symbol;Acc:HGNC:25610])

HSP 1 Score: 290.041 bits (741), Expect = 1.575e-88
Identity = 160/420 (38.10%), Postives = 239/420 (56.90%), Query Frame = 3
Query:  969 NYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFM-DNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHW------HEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVR 2150
            ++RNVIMW+D RA  +   IN      L  VGG  SVEMQ PKLLWLK+N+     D  G  FDLPDFL ++ATG   RSLCS+ CKW + S   GWD  FWK  GL +   +N+S IGN  L PG+ + +GL+  AA++LGL   I V ASLIDA+AG LG I               +  +L  I GTS+CHM ++  PI++ G+WGPY + +   +++ E GQ++ G L+D +++             +L  +    C   + IY   ++H         +  L  D+H+ PDF GNR+P +D  ++G + GL +      ++ LYLAT+Q++  G + I++ +      I ++ +CGGLSKN L+ ++ AD++G+PV+L Q  E VL+GAA L         S+Q+ ++ K R ++
Sbjct:  107 SHRNVIMWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTY-SAEKGWDDSFWKMIGLEDFVADNYSKIGNQVLPPGASLGNGLTPEAARDLGLLPGIAVAASLIDAHAGGLGVIGADVRGHGLICEGQPVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQ-------GHAAFPELQVKATARC---QSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQI-RKTKHRAIK 514          

HSP 2 Score: 80.4925 bits (197), Expect = 3.804e-15
Identity = 45/99 (45.45%), Postives = 65/99 (65.66%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQ 323
            Y++GVDVG+ SVR  L     +++  L+   +  IK ++ + + +EQSS+DIW + C  T+ +V G  ID   I+G+GFDATCSLV LDK  HPL V+Q
Sbjct:   11 YYVGVDVGTGSVRAALV----DQSGVLLAFADQPIKNWEPQFNHHEQSSEDIWAACCVVTKKVVQG--IDLNQIRGLGFDATCSLVVLDKQFHPLPVNQ 103          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Human
Match: FGGY (FGGY carbohydrate kinase domain containing [Source:HGNC Symbol;Acc:HGNC:25610])

HSP 1 Score: 289.271 bits (739), Expect = 2.311e-88
Identity = 157/402 (39.05%), Postives = 230/402 (57.21%), Query Frame = 3
Query:  969 NYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNF-MDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHW------HEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNILHS 2111
            ++RNVIMW+D RA  +   IN      L  VGG  SVEMQ PKLLWLK+N+     D  G  FDLPDFL ++ATG   RSLCS+ CKW + S   GWD  FWK  GL +   +N+S IGN  L PG+ + +GL+  AA++LGL   I V ASLIDA+AG LG I               +  +L  I GTS+CHM ++  PI++ G+WGPY + +   +++ E GQ++ G L+D +++             +L  +    C   + IY   ++H         +  L  D+H+ PDF GNR+P +D  ++G + GL +      ++ LYLAT+Q++  G + I++ +      I ++ +CGGLSKN L+ ++ AD++G+PV+L Q  E VL+GAA L    S
Sbjct:  107 SHRNVIMWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTY-SAEKGWDDSFWKMIGLEDFVADNYSKIGNQVLPPGASLGNGLTPEAARDLGLLPGIAVAASLIDAHAGGLGVIGADVRGHGLICEGQPVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQ-------GHAAFPELQVKATARC---QSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACAS 497          

HSP 2 Score: 80.4925 bits (197), Expect = 3.811e-15
Identity = 45/99 (45.45%), Postives = 65/99 (65.66%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQ 323
            Y++GVDVG+ SVR  L     +++  L+   +  IK ++ + + +EQSS+DIW + C  T+ +V G  ID   I+G+GFDATCSLV LDK  HPL V+Q
Sbjct:   11 YYVGVDVGTGSVRAALV----DQSGVLLAFADQPIKNWEPQFNHHEQSSEDIWAACCVVTKKVVQG--IDLNQIRGLGFDATCSLVVLDKQFHPLPVNQ 103          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Human
Match: FGGY (FGGY carbohydrate kinase domain containing [Source:HGNC Symbol;Acc:HGNC:25610])

HSP 1 Score: 288.115 bits (736), Expect = 3.366e-87
Identity = 165/468 (35.26%), Postives = 251/468 (53.63%), Query Frame = 3
Query:  969 NYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFM-DNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHW------HEMNVLAKDIHINPDFAGNRNPRSDTDIRG------------------------AIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIID 2222
            ++RNVIMW+D RA  +   IN      L  VGG  SVEMQ PKLLWLK+N+     D  G  FDLPDFL ++ATG   RSLCS+ CKW + S   GWD  FWK  GL +   +N+S IGN  L PG+ + +GL+  AA++LGL   I V ASLIDA+AG LG I               +  +L  I GTS+CHM ++  PI++ G+WGPY + +   +++ E GQ++ G L+D +++             +L  +    C   + IY   ++H         +  L  D+H+ PDF GNR+P +D  ++G                         + GL +      ++ LYLAT+Q++  G + I++ +      I ++ +CGGLSKN L+ ++ AD++G+PV+L Q  E VL+GAA L         S+Q    K  +  + + P     KY+++KY+++ K+++
Sbjct:  107 SHRNVIMWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTY-SAEKGWDDSFWKMIGLEDFVADNYSKIGNQVLPPGASLGNGLTPEAARDLGLLPGIAVAASLIDAHAGGLGVIGADVRGHGLICEGQPVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQ-------GHAAFPELQVKATARC---QSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMRTTGYLYIPALAALHSPSSLLSPQVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVE 563          

HSP 2 Score: 80.8777 bits (198), Expect = 3.512e-15
Identity = 45/99 (45.45%), Postives = 65/99 (65.66%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQ 323
            Y++GVDVG+ SVR  L     +++  L+   +  IK ++ + + +EQSS+DIW + C  T+ +V G  ID   I+G+GFDATCSLV LDK  HPL V+Q
Sbjct:   11 YYVGVDVGTGSVRAALV----DQSGVLLAFADQPIKNWEPQFNHHEQSSEDIWAACCVVTKKVVQG--IDLNQIRGLGFDATCSLVVLDKQFHPLPVNQ 103          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Human
Match: FGGY (FGGY carbohydrate kinase domain containing [Source:HGNC Symbol;Acc:HGNC:25610])

HSP 1 Score: 251.136 bits (640), Expect = 1.396e-74
Identity = 137/388 (35.31%), Postives = 217/388 (55.93%), Query Frame = 3
Query: 1134 DNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHW------HEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIID 2222
            D  G  FDLPDFL ++ATG   RSLCS+ CKW + S   GWD  FWK  GL +   +N+S IGN  L PG+ + +GL+  AA++LGL   I V ASLIDA+AG LG I               +  +L  I GTS+CHM ++  PI++ G+WGPY + +   +++ E GQ++ G L+D +++             +L  +    C   + IY   ++H         +  L  D+H+ PDF GNR+P +D  ++G + GL +      ++ LYLAT+Q++  G + I++ +      I ++ +CGGLSKN L+ ++ AD++G+PV+L Q  E VL+GAA L         S+Q    K  +  + + P     KY+++KY+++ K+++
Sbjct:   75 DKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTY-SAEKGWDDSFWKMIGLEDFVADNYSKIGNQVLPPGASLGNGLTPEAARDLGLLPGIAVAASLIDAHAGGLGVIGADVRGHGLICEGQPVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQ-------GHAAFPELQVKATARC---QSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVE 451          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Fly
Match: CG11594 (gene:FBgn0035484 transcript:FBtr0310046)

HSP 1 Score: 300.827 bits (769), Expect = 1.315e-92
Identity = 167/442 (37.78%), Postives = 257/442 (58.14%), Query Frame = 3
Query:  975 RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVL-----------GAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYN--------LSSAHW-HEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLK-NCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIID 2222
            +N+I+WMD RA+ ET+ IN+     L  VGG+ S+EM+ PKLLWLK+N+     NI  +FDLPDFL +RATG + RSLCSV CKW +D+ N  W+KEF K+  L EL  NNF  +G++   PG  +  GL+  AA ELGL     V  SLIDA+AG L           GA ++  ++  IAGTS CHM +T K  +  G+WGPY++ I   Y++ E GQ++ G+LLD +L+      +H         E+    GE++ IY         L++A    ++  L +D+H+ PD  GNR+P +D  +RG I GL++      ++  YLA +Q+L YG + I++ L +       ++  CGGL+KN LY +  AD+  LP ++   +E+VL+GAA L         S++   +    T + ++P+    ++HN+KYK++ ++++
Sbjct:  104 QNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKRNLSQTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKEFLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSAGTVVSTSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACFAQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLK------SHESYA-----ELKSQLGEDKFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRGVITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFCGGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLESASKSMGGTGQLVKPNAETLEFHNRKYKVFLQLLE 534          

HSP 2 Score: 83.1889 bits (204), Expect = 3.618e-16
Identity = 43/101 (42.57%), Postives = 61/101 (60.40%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQTS 329
            +F+GVDVG+ S R  L    D   LE   +    I+ +  E   Y QSSD+IW S+C+  + ++ G  +D + +KGIGFDATCSLV L   G PL+VS++ 
Sbjct:    6 FFVGVDVGTGSARAALV-ACDGRVLEQAVQT---IQTWNPEPGYYNQSSDNIWQSICQVVKKVIGG--VDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG 100          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Fly
Match: CG11594 (gene:FBgn0035484 transcript:FBtr0073283)

HSP 1 Score: 300.827 bits (769), Expect = 1.315e-92
Identity = 167/442 (37.78%), Postives = 257/442 (58.14%), Query Frame = 3
Query:  975 RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVL-----------GAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYN--------LSSAHW-HEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLK-NCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIID 2222
            +N+I+WMD RA+ ET+ IN+     L  VGG+ S+EM+ PKLLWLK+N+     NI  +FDLPDFL +RATG + RSLCSV CKW +D+ N  W+KEF K+  L EL  NNF  +G++   PG  +  GL+  AA ELGL     V  SLIDA+AG L           GA ++  ++  IAGTS CHM +T K  +  G+WGPY++ I   Y++ E GQ++ G+LLD +L+      +H         E+    GE++ IY         L++A    ++  L +D+H+ PD  GNR+P +D  +RG I GL++      ++  YLA +Q+L YG + I++ L +       ++  CGGL+KN LY +  AD+  LP ++   +E+VL+GAA L         S++   +    T + ++P+    ++HN+KYK++ ++++
Sbjct:  104 QNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKRNLSQTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKEFLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSAGTVVSTSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACFAQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLK------SHESYA-----ELKSQLGEDKFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRGVITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFCGGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLESASKSMGGTGQLVKPNAETLEFHNRKYKVFLQLLE 534          

HSP 2 Score: 83.1889 bits (204), Expect = 3.618e-16
Identity = 43/101 (42.57%), Postives = 61/101 (60.40%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQTS 329
            +F+GVDVG+ S R  L    D   LE   +    I+ +  E   Y QSSD+IW S+C+  + ++ G  +D + +KGIGFDATCSLV L   G PL+VS++ 
Sbjct:    6 FFVGVDVGTGSARAALV-ACDGRVLEQAVQT---IQTWNPEPGYYNQSSDNIWQSICQVVKKVIGG--VDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG 100          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Fly
Match: CG11594 (gene:FBgn0035484 transcript:FBtr0073284)

HSP 1 Score: 300.827 bits (769), Expect = 1.315e-92
Identity = 167/442 (37.78%), Postives = 257/442 (58.14%), Query Frame = 3
Query:  975 RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVL-----------GAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYN--------LSSAHW-HEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLK-NCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIID 2222
            +N+I+WMD RA+ ET+ IN+     L  VGG+ S+EM+ PKLLWLK+N+     NI  +FDLPDFL +RATG + RSLCSV CKW +D+ N  W+KEF K+  L EL  NNF  +G++   PG  +  GL+  AA ELGL     V  SLIDA+AG L           GA ++  ++  IAGTS CHM +T K  +  G+WGPY++ I   Y++ E GQ++ G+LLD +L+      +H         E+    GE++ IY         L++A    ++  L +D+H+ PD  GNR+P +D  +RG I GL++      ++  YLA +Q+L YG + I++ L +       ++  CGGL+KN LY +  AD+  LP ++   +E+VL+GAA L         S++   +    T + ++P+    ++HN+KYK++ ++++
Sbjct:  104 QNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKRNLSQTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKEFLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSAGTVVSTSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACFAQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLK------SHESYA-----ELKSQLGEDKFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRGVITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFCGGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLESASKSMGGTGQLVKPNAETLEFHNRKYKVFLQLLE 534          

HSP 2 Score: 83.1889 bits (204), Expect = 3.618e-16
Identity = 43/101 (42.57%), Postives = 61/101 (60.40%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQTS 329
            +F+GVDVG+ S R  L    D   LE   +    I+ +  E   Y QSSD+IW S+C+  + ++ G  +D + +KGIGFDATCSLV L   G PL+VS++ 
Sbjct:    6 FFVGVDVGTGSARAALV-ACDGRVLEQAVQT---IQTWNPEPGYYNQSSDNIWQSICQVVKKVIGG--VDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG 100          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Fly
Match: CG11594 (gene:FBgn0035484 transcript:FBtr0309791)

HSP 1 Score: 300.827 bits (769), Expect = 1.315e-92
Identity = 167/442 (37.78%), Postives = 257/442 (58.14%), Query Frame = 3
Query:  975 RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVL-----------GAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYN--------LSSAHW-HEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLK-NCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIID 2222
            +N+I+WMD RA+ ET+ IN+     L  VGG+ S+EM+ PKLLWLK+N+     NI  +FDLPDFL +RATG + RSLCSV CKW +D+ N  W+KEF K+  L EL  NNF  +G++   PG  +  GL+  AA ELGL     V  SLIDA+AG L           GA ++  ++  IAGTS CHM +T K  +  G+WGPY++ I   Y++ E GQ++ G+LLD +L+      +H         E+    GE++ IY         L++A    ++  L +D+H+ PD  GNR+P +D  +RG I GL++      ++  YLA +Q+L YG + I++ L +       ++  CGGL+KN LY +  AD+  LP ++   +E+VL+GAA L         S++   +    T + ++P+    ++HN+KYK++ ++++
Sbjct:  104 QNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKRNLSQTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKEFLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSAGTVVSTSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACFAQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLK------SHESYA-----ELKSQLGEDKFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRGVITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFCGGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLESASKSMGGTGQLVKPNAETLEFHNRKYKVFLQLLE 534          

HSP 2 Score: 83.1889 bits (204), Expect = 3.618e-16
Identity = 43/101 (42.57%), Postives = 61/101 (60.40%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQTS 329
            +F+GVDVG+ S R  L    D   LE   +    I+ +  E   Y QSSD+IW S+C+  + ++ G  +D + +KGIGFDATCSLV L   G PL+VS++ 
Sbjct:    6 FFVGVDVGTGSARAALV-ACDGRVLEQAVQT---IQTWNPEPGYYNQSSDNIWQSICQVVKKVIGG--VDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG 100          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Fly
Match: Gk1 (gene:FBgn0025592 transcript:FBtr0072529)

HSP 1 Score: 58.5362 bits (140), Expect = 1.843e-8
Identity = 32/107 (29.91%), Postives = 64/107 (59.81%), Query Frame = 3
Query: 1773 DIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNC-VEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAA 2090
            D++  P F G   P  + D RG I GL+ +++  +I +   AT++++ +  ++ILD + K+C + +  + V GG++ N+L+ ++ +D+ G+ V+  +  E   LGAA
Sbjct:  367 DVYFVPAFNGLYAPYWNQDARGVICGLSEETTSEHIVR---ATLEAVCFQVRDILDSMHKDCKIPLAKLMVDGGMTVNNLFLQLQSDLVGIQVLRAKIAETTALGAA 470          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Zebrafish
Match: fggy (FGGY carbohydrate kinase domain containing [Source:NCBI gene;Acc:406567])

HSP 1 Score: 234.958 bits (598), Expect = 1.751e-69
Identity = 136/394 (34.52%), Postives = 219/394 (55.58%), Query Frame = 3
Query: 1116 NIPNFM-DNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAG---VLGA----INMP-------KQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEMNV-------LAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNILH-----SIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKI 2216
            N+P+         FDLPDFL ++ATGS  RSLC++ CKW + S + GWD  FW   GL +L +++++ IG+    PG+ +  GL+  AA +LGL     V ASLIDA+AG   VLGA    +++P        ++  I GTS+CHM ++ +P+ + G+WGPY + +    ++ E GQ+  G LLD +++             + ++E  E  G +  IY   + H  +M+        L   +HI PDF GNR+P +D   RG ++GL++  +   ++ LYLAT+Q+L  G + I+  + +   +I ++ +CGGLSKN+L+ +  A+ +GLPV+L    E VLLGAA +         SI     K  R  R + P+  L  ++ +KY ++ ++
Sbjct:    1 NLPDSCWTRAAHFFDLPDFLSWKATGSLSRSLCTLVCKWTY-SASEGWDDTFWSAIGLEDLIEDSYARIGSQVCCPGAAVGRGLTAAAAADLGLNEGTAVGASLIDAHAGGIGVLGADVSGLHLPCEHQPLTARMALICGTSSCHMAVSREPLLVPGVWGPYLSAMLPGLWLNEGGQSATGKLLDHVVK--------GHAAFRQLEEQAEHSGRH--IYTQLNLHLQQMSTDATHLEQLTTHLHIWPDFHGNRSPLADQTARGTVVGLSLSQTLDDLALLYLATLQALALGSRHIIAAMTEAGHDITTLFLCGGLSKNTLFVQTHANTTGLPVVLPAEREAVLLGAAVIGACASSDCTSIPEAMRKMSRVGRVVRPNPELQSFYRRKYSVFLRL 383          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Xenopus
Match: fggy (FGGY carbohydrate kinase domain containing [Source:NCBI gene;Acc:100145330])

HSP 1 Score: 314.694 bits (805), Expect = 1.676e-97
Identity = 169/443 (38.15%), Postives = 256/443 (57.79%), Query Frame = 3
Query:  966 QNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNI-PNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEM------NVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKI 2216
            ++ RNVIMWMD RA  +   IN  + K L  VGG  SVEMQPPKLLWLK+N+     +  G  FDLPDFL ++ATG   RS C++ CKW + S++ GWD  FWK+ GL ++C+ N+  IGN  ++PG+ I + L+  AAK+LGL   + V ASLIDA+AG LG I               +  +L  I GTS+CHM ++ KPI++ G+WGPY + +    ++ E GQ+  G L+D ++      M              E+    + IY   + H  ++        LA D+H+ PDF GNR+P +D  ++G ++GL +  S   ++ LYLATIQ++  G + IL+ +      I ++ +CGGLSKN L+ ++ AD++GLPV+L +  E VL+GAA L         SI+   EK  +  + I P+     ++++KY+++ K+
Sbjct:  105 EHMRNVIMWMDHRAGSQVDRINRTNHKVLRYVGGVMSVEMQPPKLLWLKENLLEECWNKSGQFFDLPDFLTWKATGDTTRSFCTLVCKWTY-SLDHGWDDSFWKEIGLEDICEGNYVKIGNQVMSPGASIGNCLTAAAAKDLGLPEGLAVAASLIDAHAGGLGVIGASLKEYGLQGKHHPITSRLALICGTSSCHMGISEKPIFVSGVWGPYYSAMIPGLWLNEGGQSATGKLIDHVVRGHSAFMELE----------TESKARGQHIYTYLNNHLDQIKKSGPVGFLAADLHVWPDFHGNRSPLADLTMKGMVVGLTLSKSLDDLATLYLATIQAIALGTRYILETMQTAGHHISTLHLCGGLSKNPLFVQMHADITGLPVVLSKEVESVLVGAAILGACASGDFPSIKEAMEKMSKVGKIIFPNYKDKSFYDKKYEVFLKL 536          

HSP 2 Score: 85.8853 bits (211), Expect = 8.146e-17
Identity = 43/97 (44.33%), Postives = 63/97 (64.95%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSV 317
            Y++G+DVG+ SVR  L     ++   ++ + E +IK+++     YEQSSDDIW + C+ T+ +V     DP  I+G+GFDATCSLVALD    PL+V
Sbjct:   10 YYVGIDVGTASVRVALV----DQFGTVVDQMEQSIKIWEPRPDHYEQSSDDIWAACCRVTKQIVHSK--DPRCIRGLGFDATCSLVALDTQFQPLAV 100          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Xenopus
Match: fggy (FGGY carbohydrate kinase domain containing [Source:NCBI gene;Acc:100145330])

HSP 1 Score: 314.694 bits (805), Expect = 2.565e-97
Identity = 169/443 (38.15%), Postives = 256/443 (57.79%), Query Frame = 3
Query:  966 QNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNI-PNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEM------NVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKI 2216
            ++ RNVIMWMD RA  +   IN  + K L  VGG  SVEMQPPKLLWLK+N+     +  G  FDLPDFL ++ATG   RS C++ CKW + S++ GWD  FWK+ GL ++C+ N+  IGN  ++PG+ I + L+  AAK+LGL   + V ASLIDA+AG LG I               +  +L  I GTS+CHM ++ KPI++ G+WGPY + +    ++ E GQ+  G L+D ++      M              E+    + IY   + H  ++        LA D+H+ PDF GNR+P +D  ++G ++GL +  S   ++ LYLATIQ++  G + IL+ +      I ++ +CGGLSKN L+ ++ AD++GLPV+L +  E VL+GAA L         SI+   EK  +  + I P+     ++++KY+++ K+
Sbjct:  117 EHMRNVIMWMDHRAGSQVDRINRTNHKVLRYVGGVMSVEMQPPKLLWLKENLLEECWNKSGQFFDLPDFLTWKATGDTTRSFCTLVCKWTY-SLDHGWDDSFWKEIGLEDICEGNYVKIGNQVMSPGASIGNCLTAAAAKDLGLPEGLAVAASLIDAHAGGLGVIGASLKEYGLQGKHHPITSRLALICGTSSCHMGISEKPIFVSGVWGPYYSAMIPGLWLNEGGQSATGKLIDHVVRGHSAFMELE----------TESKARGQHIYTYLNNHLDQIKKSGPVGFLAADLHVWPDFHGNRSPLADLTMKGMVVGLTLSKSLDDLATLYLATIQAIALGTRYILETMQTAGHHISTLHLCGGLSKNPLFVQMHADITGLPVVLSKEVESVLVGAAILGACASGDFPSIKEAMEKMSKVGKIIFPNYKDKSFYDKKYEVFLKL 548          

HSP 2 Score: 85.8853 bits (211), Expect = 8.381e-17
Identity = 43/97 (44.33%), Postives = 63/97 (64.95%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSV 317
            Y++G+DVG+ SVR  L     ++   ++ + E +IK+++     YEQSSDDIW + C+ T+ +V     DP  I+G+GFDATCSLVALD    PL+V
Sbjct:   22 YYVGIDVGTASVRVALV----DQFGTVVDQMEQSIKIWEPRPDHYEQSSDDIWAACCRVTKQIVHSK--DPRCIRGLGFDATCSLVALDTQFQPLAV 112          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Xenopus
Match: fggy (FGGY carbohydrate kinase domain containing [Source:NCBI gene;Acc:100145330])

HSP 1 Score: 313.923 bits (803), Expect = 2.837e-97
Identity = 169/443 (38.15%), Postives = 256/443 (57.79%), Query Frame = 3
Query:  966 QNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNI-PNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEM------NVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKI 2216
            ++ RNVIMWMD RA  +   IN  + K L  VGG  SVEMQPPKLLWLK+N+     +  G  FDLPDFL ++ATG   RS C++ CKW + S++ GWD  FWK+ GL ++C+ N+  IGN  ++PG+ I + L+  AAK+LGL   + V ASLIDA+AG LG I               +  +L  I GTS+CHM ++ KPI++ G+WGPY + +    ++ E GQ+  G L+D ++      M              E+    + IY   + H  ++        LA D+H+ PDF GNR+P +D  ++G ++GL +  S   ++ LYLATIQ++  G + IL+ +      I ++ +CGGLSKN L+ ++ AD++GLPV+L +  E VL+GAA L         SI+   EK  +  + I P+     ++++KY+++ K+
Sbjct:  105 EHMRNVIMWMDHRAGSQVDRINRTNHKVLRYVGGVMSVEMQPPKLLWLKENLLEECWNKSGQFFDLPDFLTWKATGDTTRSFCTLVCKWTY-SLDHGWDDSFWKEIGLEDICEGNYVKIGNQVMSPGASIGNCLTAAAAKDLGLPEGLAVAASLIDAHAGGLGVIGASLKEYGLQGKHHPITSRLALICGTSSCHMGISEKPIFVSGVWGPYYSAMIPGLWLNEGGQSATGKLIDHVVRGHSAFMELE----------TESKARGQHIYTYLNNHLDQIKKSGPVGFLAADLHVWPDFHGNRSPLADLTMKGMVVGLTLSKSLDDLATLYLATIQAIALGTRYILETMQTAGHHISTLHLCGGLSKNPLFVQMHADITGLPVVLSKEVESVLVGAAILGACASGDFPSIKEAMEKMSKVGKIIFPNYKDKSFYDKKYEVFLKL 536          

HSP 2 Score: 80.8777 bits (198), Expect = 3.093e-15
Identity = 42/97 (43.30%), Postives = 61/97 (62.89%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSV 317
            Y++G+DVG+ SVR  L     ++   ++ + E +IK+++     YEQSSDDIW + C+ T+       I P  I+G+GFDATCSLVALD    PL+V
Sbjct:   14 YYVGIDVGTASVRVALV----DQFGTVVDQMEQSIKIWEPRPDHYEQSSDDIWAACCRVTK------VIYPRCIRGLGFDATCSLVALDTQFQPLAV 100          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Xenopus
Match: fggy (FGGY carbohydrate kinase domain containing [Source:NCBI gene;Acc:100145330])

HSP 1 Score: 306.99 bits (785), Expect = 1.459e-94
Identity = 163/417 (39.09%), Postives = 241/417 (57.79%), Query Frame = 3
Query:  966 QNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNI-PNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEM------NVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNILHSIQLFQEKKFRTVRR 2153
            ++ RNVIMWMD RA  +   IN  + K L  VGG  SVEMQPPKLLWLK+N+     +  G  FDLPDFL ++ATG   RS C++ CKW + S++ GWD  FWK+ GL ++C+ N+  IGN  ++PG+ I + L+  AAK+LGL   + V ASLIDA+AG LG I               +  +L  I GTS+CHM ++ KPI++ G+WGPY + +    ++ E GQ+  G L+D ++      M          +   E+    + IY   + H  ++        LA D+H+ PDF GNR+P +D  ++G ++GL +  S   ++ LYLATIQ++  G + IL+ +      I ++ +CGGLSKN L+ ++ AD++GLPV+L +  E VL+GAA L    S      K  ++  R
Sbjct:  108 EHMRNVIMWMDHRAGSQVDRINRTNHKVLRYVGGVMSVEMQPPKLLWLKENLLEECWNKSGQFFDLPDFLTWKATGDTTRSFCTLVCKWTY-SLDHGWDDSFWKEIGLEDICEGNYVKIGNQVMSPGASIGNCLTAAAAKDLGLPEGLAVAASLIDAHAGGLGVIGASLKEYGLQGKHHPITSRLALICGTSSCHMGISEKPIFVSGVWGPYYSAMIPGLWLNEGGQSATGKLIDHVVRGHSAFM----------ELETESKARGQHIYTYLNNHLDQIKKSGPVGFLAADLHVWPDFHGNRSPLADLTMKGMVVGLTLSKSLDDLATLYLATIQAIALGTRYILETMQTAGHHISTLHLCGGLSKNPLFVQMHADITGLPVVLSKEVESVLVGAAILGACASGDFPSIKTAKSPHR 513          

HSP 2 Score: 85.8853 bits (211), Expect = 9.590e-17
Identity = 43/97 (44.33%), Postives = 63/97 (64.95%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSV 317
            Y++G+DVG+ SVR  L     ++   ++ + E +IK+++     YEQSSDDIW + C+ T+ +V     DP  I+G+GFDATCSLVALD    PL+V
Sbjct:   13 YYVGIDVGTASVRVALV----DQFGTVVDQMEQSIKIWEPRPDHYEQSSDDIWAACCRVTKQIVHSK--DPRCIRGLGFDATCSLVALDTQFQPLAV 103          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Xenopus
Match: fggy (FGGY carbohydrate kinase domain containing [Source:NCBI gene;Acc:100145330])

HSP 1 Score: 306.605 bits (784), Expect = 1.776e-94
Identity = 160/399 (40.10%), Postives = 236/399 (59.15%), Query Frame = 3
Query:  966 QNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNI-PNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEM------NVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLN 2099
            ++ RNVIMWMD RA  +   IN  + K L  VGG  SVEMQPPKLLWLK+N+     +  G  FDLPDFL ++ATG   RS C++ CKW + S++ GWD  FWK+ GL ++C+ N+  IGN  ++PG+ I + L+  AAK+LGL   + V ASLIDA+AG LG I               +  +L  I GTS+CHM ++ KPI++ G+WGPY + +    ++ E GQ+  G L+D ++      M          +   E+    + IY   + H  ++        LA D+H+ PDF GNR+P +D  ++G ++GL +  S   ++ LYLATIQ++  G + IL+ +      I ++ +CGGLSKN L+ ++ AD++GLPV+L +  E VL+GAA L 
Sbjct:  105 EHMRNVIMWMDHRAGSQVDRINRTNHKVLRYVGGVMSVEMQPPKLLWLKENLLEECWNKSGQFFDLPDFLTWKATGDTTRSFCTLVCKWTY-SLDHGWDDSFWKEIGLEDICEGNYVKIGNQVMSPGASIGNCLTAAAAKDLGLPEGLAVAASLIDAHAGGLGVIGASLKEYGLQGKHHPITSRLALICGTSSCHMGISEKPIFVSGVWGPYYSAMIPGLWLNEGGQSATGKLIDHVVRGHSAFM----------ELETESKARGQHIYTYLNNHLDQIKKSGPVGFLAADLHVWPDFHGNRSPLADLTMKGMVVGLTLSKSLDDLATLYLATIQAIALGTRYILETMQTAGHHISTLHLCGGLSKNPLFVQMHADITGLPVVLSKEVESVLVGAAILG 492          

HSP 2 Score: 85.5001 bits (210), Expect = 9.879e-17
Identity = 43/97 (44.33%), Postives = 63/97 (64.95%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSV 317
            Y++G+DVG+ SVR  L     ++   ++ + E +IK+++     YEQSSDDIW + C+ T+ +V     DP  I+G+GFDATCSLVALD    PL+V
Sbjct:   10 YYVGIDVGTASVRVALV----DQFGTVVDQMEQSIKIWEPRPDHYEQSSDDIWAACCRVTKQIVHSK--DPRCIRGLGFDATCSLVALDTQFQPLAV 100          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Mouse
Match: Fggy (FGGY carbohydrate kinase domain containing [Source:MGI Symbol;Acc:MGI:1922828])

HSP 1 Score: 308.145 bits (788), Expect = 3.896e-95
Identity = 164/442 (37.10%), Postives = 255/442 (57.69%), Query Frame = 3
Query:  975 RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFM-DNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHW------HEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIID 2222
            RNVIMW+D RA  +   IN    + L  VGG  SVEMQ PKLLWLK+N+     D  G  FDLPDFL ++ATG   RSLCS+ CKW + S   GWD  FWK  GL +L D+N+S IGN  L PG+ +  GL+  AA+ELGL   I V ASLIDA+AG LG I               +  +L  I GTS+CHM ++  P+++ G+WGPY + +   +++ E GQ++ G L+D +++             +L  +    C   + IY   ++H         +  L  D+H+ PDF GNR+P +D  ++G + GL +      ++ LYLAT+Q++ +G + I++ +      + ++ +CGGLSKN L+ ++ AD++G+PV+L Q  E VL+GAA L         S+Q    +  +  + + P+++  KY+++KY+++ ++++
Sbjct:  110 RNVIMWLDHRAVSQVHRINETKHRVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTY-SAEKGWDDSFWKMIGLEDLIDDNYSKIGNLVLLPGAALGIGLTPEAARELGLPSGIAVAASLIDAHAGGLGVIGADVRGHGLTCEGQPVTSRLAVICGTSSCHMGISKDPVFVPGVWGPYYSAMVPGFWLNEGGQSVTGKLIDHMVQ-------GHPAFPELQAKATARC---QSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLTLSQDLDDLAILYLATVQAIAFGTRFIIETMEAAGHSLSTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAILGACASGDFTSVQEAMARMSKVGKVVFPEHADKKYYDKKYQVFLRMVE 540          

HSP 2 Score: 81.6481 bits (200), Expect = 1.604e-15
Identity = 46/99 (46.46%), Postives = 63/99 (63.64%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQ 323
            Y++G+DVG+ SVR  L    D   L L+   E  IK ++ + + +EQSS+DIW + C  T+ +V G  ID   I+G+GFDATCSLV LDK  HPL V+ 
Sbjct:   12 YYVGIDVGTGSVRAALV---DQRGL-LLAFAEQPIKKWEPQFNHHEQSSEDIWAACCLVTKEVVQG--IDAHRIRGLGFDATCSLVVLDKEFHPLPVNH 104          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Mouse
Match: Fggy (FGGY carbohydrate kinase domain containing [Source:MGI Symbol;Acc:MGI:1922828])

HSP 1 Score: 258.455 bits (659), Expect = 1.695e-77
Identity = 136/388 (35.05%), Postives = 222/388 (57.22%), Query Frame = 3
Query: 1134 DNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHW------HEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIID 2222
            D  G  FDLPDFL ++ATG   RSLCS+ CKW + S   GWD  FWK  GL +L D+N+S IGN  L PG+ +  GL+  AA+ELGL   I V ASLIDA+AG LG I               +  +L  I GTS+CHM ++  P+++ G+WGPY + +   +++ E GQ++ G L+D +++             +L  +    C   + IY   ++H         +  L  D+H+ PDF GNR+P +D  ++G + GL +      ++ LYLAT+Q++ +G + I++ +      + ++ +CGGLSKN L+ ++ AD++G+PV+L Q  E VL+GAA L         S+Q    +  +  + + P+++  KY+++KY+++ ++++
Sbjct:   76 DKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTY-SAEKGWDDSFWKMIGLEDLIDDNYSKIGNLVLLPGAALGIGLTPEAARELGLPSGIAVAASLIDAHAGGLGVIGADVRGHGLTCEGQPVTSRLAVICGTSSCHMGISKDPVFVPGVWGPYYSAMVPGFWLNEGGQSVTGKLIDHMVQ-------GHPAFPELQAKATARC---QSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLTLSQDLDDLAILYLATVQAIAFGTRFIIETMEAAGHSLSTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAILGACASGDFTSVQEAMARMSKVGKVVFPEHADKKYYDKKYQVFLRMVE 452          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Mouse
Match: Fggy (FGGY carbohydrate kinase domain containing [Source:MGI Symbol;Acc:MGI:1922828])

HSP 1 Score: 213.772 bits (543), Expect = 8.547e-62
Identity = 108/236 (45.76%), Postives = 145/236 (61.44%), Query Frame = 3
Query:  975 RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNF-MDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILE 1637
            RNVIMW+D RA  +   IN    + L  VGG  SVEMQ PKLLWLK+N+     D  G  FDLPDFL ++ATG   RSLCS+ CKW + S   GWD  FWK  GL +L D+N+S IGN  L PG+ +  GL+  AA+ELGL   I V ASLIDA+AG LG I               +  +L  I GTS+CHM ++  P+++ G+WGPY + +   +++ E GQ++ G L+D +++
Sbjct:  110 RNVIMWLDHRAVSQVHRINETKHRVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTY-SAEKGWDDSFWKMIGLEDLIDDNYSKIGNLVLLPGAALGIGLTPEAARELGLPSGIAVAASLIDAHAGGLGVIGADVRGHGLTCEGQPVTSRLAVICGTSSCHMGISKDPVFVPGVWGPYYSAMVPGFWLNEGGQSVTGKLIDHMVQ 344          

HSP 2 Score: 81.2629 bits (199), Expect = 8.243e-16
Identity = 46/99 (46.46%), Postives = 63/99 (63.64%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQ 323
            Y++G+DVG+ SVR  L    D   L L+   E  IK ++ + + +EQSS+DIW + C  T+ +V G  ID   I+G+GFDATCSLV LDK  HPL V+ 
Sbjct:   12 YYVGIDVGTGSVRAALV---DQRGL-LLAFAEQPIKKWEPQFNHHEQSSEDIWAACCLVTKEVVQG--IDAHRIRGLGFDATCSLVVLDKEFHPLPVNH 104          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Mouse
Match: Fggy (FGGY carbohydrate kinase domain containing [Source:MGI Symbol;Acc:MGI:1922828])

HSP 1 Score: 97.8265 bits (242), Expect = 7.651e-24
Identity = 50/92 (54.35%), Postives = 60/92 (65.22%), Query Frame = 3
Query: 1182 ATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAI 1457
             TG   RSLCS+ CKW + S   GWD  FWK  GL +L D+N+S IGN  L PG+ +  GL+  AA+ELGL   I V ASLIDA+AG LG I
Sbjct:   19 GTGVTARSLCSLVCKWTY-SAEKGWDDSFWKMIGLEDLIDDNYSKIGNLVLLPGAALGIGLTPEAARELGLPSGIAVAASLIDAHAGGLGVI 109          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Mouse
Match: Fggy (FGGY carbohydrate kinase domain containing [Source:MGI Symbol;Acc:MGI:1922828])

HSP 1 Score: 87.4261 bits (215), Expect = 1.806e-19
Identity = 42/147 (28.57%), Postives = 79/147 (53.74%), Query Frame = 3
Query: 1491 TSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHW------HEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSL 1913
            TS+CHM ++  P+++ G+WGPY + +   +++ E GQ++ G L+D +++             +L  +    C   + IY   ++H         +  L  D+H+ PDF GNR+P +D  ++G + GL +      ++ LYLAT+Q++
Sbjct:    1 TSSCHMGISKDPVFVPGVWGPYYSAMVPGFWLNEGGQSVTGKLIDHMVQ-------GHPAFPELQAKATARC---QSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLTLSQDLDDLAILYLATVQAI 137          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DCD1|FGGY_XENLA (FGGY carbohydrate kinase domain-containing protein OS=Xenopus laevis OX=8355 GN=fggy PE=2 SV=2)

HSP 1 Score: 320.087 bits (819), Expect = 7.492e-99
Identity = 173/443 (39.05%), Postives = 264/443 (59.59%), Query Frame = 3
Query:  966 QNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNI-PNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAI------------NMP--KQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEM------NVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKI 2216
            ++ RN+IMWMD RA  +   IN  + K L  VGG  SVEMQPPKLLWLK+N+     +  G LFDLPDFL ++ATG N RS C++ CKW + S++ GWD  FWK+ GL ++C+ N+  IGN  ++PG+ I + L+  AAKELGL   + V ASLIDA+AG LG I            N P   +L  I GTS+CHM ++ KPI++ G+WGPY + +    ++ E GQ+  G L+D ++        H  +    ++  N+     + IY   + H  ++        LA D+H+ PDF GNR+P +D  ++G ++GL +  S   ++ LYLATIQ++  G + IL+ +      I ++ +CGGLSKN L+ ++ AD++GLPV+L +  E VL+GAA L         SI+   EK  +  + I P++   +++++KY+++ K+
Sbjct:  105 EHKRNIIMWMDHRAGCQVDRINRTNHKVLRYVGGVMSVEMQPPKLLWLKENLREECWNKSGQLFDLPDFLTWKATGDNTRSFCTLVCKWTY-SLDHGWDDSFWKEIGLEDICEGNYVKIGNQVMSPGASIGNCLTATAAKELGLPEGLPVAASLIDAHAGGLGVIGASLKEYGLEGENHPITSRLALICGTSSCHMGISEKPIFVPGVWGPYYSAMIPGLWLNEGGQSATGKLIDHVV--------HGHI--AFMELENQAKARGQHIYTYLNNHLDKIKKSGPVGFLAADLHVWPDFHGNRSPLADLTMKGMVVGLTLSKSLDDLATLYLATIQAIALGTRHILETMQTAGHHISTLYLCGGLSKNPLFVQMHADITGLPVVLSKEVESVLVGAAILGACASGDFPSIKEAMEKMSKVGKIIFPNHEDKRFYDKKYEVFLKL 536          

HSP 2 Score: 83.5741 bits (205), Expect = 2.197e-15
Identity = 42/97 (43.30%), Postives = 63/97 (64.95%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSV 317
            Y++G+DVG+ SVR  L     ++   ++ + E +IK+++ +   YEQSSDDIW + C+ T+ +V     DP  I+G+GFDATCSLV LD    PL+V
Sbjct:   10 YYVGIDVGTASVRVALV----DQFGTVVDQVEQSIKIWEPQPDHYEQSSDDIWAACCQVTKQVVRTK--DPRCIRGLGFDATCSLVVLDTQFQPLAV 100          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|A2AJL3|FGGY_MOUSE (FGGY carbohydrate kinase domain-containing protein OS=Mus musculus OX=10090 GN=Fggy PE=1 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 2.725e-94
Identity = 164/442 (37.10%), Postives = 255/442 (57.69%), Query Frame = 3
Query:  975 RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFM-DNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHW------HEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIID 2222
            RNVIMW+D RA  +   IN    + L  VGG  SVEMQ PKLLWLK+N+     D  G  FDLPDFL ++ATG   RSLCS+ CKW + S   GWD  FWK  GL +L D+N+S IGN  L PG+ +  GL+  AA+ELGL   I V ASLIDA+AG LG I               +  +L  I GTS+CHM ++  P+++ G+WGPY + +   +++ E GQ++ G L+D +++             +L  +    C   + IY   ++H         +  L  D+H+ PDF GNR+P +D  ++G + GL +      ++ LYLAT+Q++ +G + I++ +      + ++ +CGGLSKN L+ ++ AD++G+PV+L Q  E VL+GAA L         S+Q    +  +  + + P+++  KY+++KY+++ ++++
Sbjct:  110 RNVIMWLDHRAVSQVHRINETKHRVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTY-SAEKGWDDSFWKMIGLEDLIDDNYSKIGNLVLLPGAALGIGLTPEAARELGLPSGIAVAASLIDAHAGGLGVIGADVRGHGLTCEGQPVTSRLAVICGTSSCHMGISKDPVFVPGVWGPYYSAMVPGFWLNEGGQSVTGKLIDHMVQ-------GHPAFPELQAKATARC---QSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLTLSQDLDDLAILYLATVQAIAFGTRFIIETMEAAGHSLSTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAILGACASGDFTSVQEAMARMSKVGKVVFPEHADKKYYDKKYQVFLRMVE 540          

HSP 2 Score: 81.6481 bits (200), Expect = 1.122e-14
Identity = 46/99 (46.46%), Postives = 63/99 (63.64%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQ 323
            Y++G+DVG+ SVR  L    D   L L+   E  IK ++ + + +EQSS+DIW + C  T+ +V G  ID   I+G+GFDATCSLV LDK  HPL V+ 
Sbjct:   12 YYVGIDVGTGSVRAALV---DQRGL-LLAFAEQPIKKWEPQFNHHEQSSEDIWAACCLVTKEVVQG--IDAHRIRGLGFDATCSLVVLDKEFHPLPVNH 104          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96C11|FGGY_HUMAN (FGGY carbohydrate kinase domain-containing protein OS=Homo sapiens OX=9606 GN=FGGY PE=1 SV=2)

HSP 1 Score: 301.597 bits (771), Expect = 8.287e-92
Identity = 165/444 (37.16%), Postives = 251/444 (56.53%), Query Frame = 3
Query:  969 NYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFM-DNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHW------HEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIID 2222
            ++RNVIMW+D RA  +   IN      L  VGG  SVEMQ PKLLWLK+N+     D  G  FDLPDFL ++ATG   RSLCS+ CKW + S   GWD  FWK  GL +   +N+S IGN  L PG+ + +GL+  AA++LGL   I V ASLIDA+AG LG I               +  +L  I GTS+CHM ++  PI++ G+WGPY + +   +++ E GQ++ G L+D +++             +L  +    C   + IY   ++H         +  L  D+H+ PDF GNR+P +D  ++G + GL +      ++ LYLAT+Q++  G + I++ +      I ++ +CGGLSKN L+ ++ AD++G+PV+L Q  E VL+GAA L         S+Q    K  +  + + P     KY+++KY+++ K+++
Sbjct:  107 SHRNVIMWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTY-SAEKGWDDSFWKMIGLEDFVADNYSKIGNQVLPPGASLGNGLTPEAARDLGLLPGIAVAASLIDAHAGGLGVIGADVRGHGLICEGQPVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQ-------GHAAFPELQVKATARC---QSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVE 539          

HSP 2 Score: 80.8777 bits (198), Expect = 1.629e-14
Identity = 45/99 (45.45%), Postives = 65/99 (65.66%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQ 323
            Y++GVDVG+ SVR  L     +++  L+   +  IK ++ + + +EQSS+DIW + C  T+ +V G  ID   I+G+GFDATCSLV LDK  HPL V+Q
Sbjct:   11 YYVGVDVGTGSVRAALV----DQSGVLLAFADQPIKNWEPQFNHHEQSSEDIWAACCVVTKKVVQG--IDLNQIRGLGFDATCSLVVLDKQFHPLPVNQ 103          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6NUW9|FGGY_DANRE (FGGY carbohydrate kinase domain-containing protein OS=Danio rerio OX=7955 GN=fggy PE=2 SV=2)

HSP 1 Score: 286.574 bits (732), Expect = 3.398e-86
Identity = 163/441 (36.96%), Postives = 250/441 (56.69%), Query Frame = 3
Query:  975 RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFM-DNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAG---VLGA----INMP-------KQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEMNV-------LAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNILH-----SIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKI 2216
            RNV+MWMD RA  +   I +     L  VGG  S E+QPPKLLWLK+N+P+         FDLPDFL ++ATGS  RSLC++ CKW + S + GWD  FW   GL +L +++++ IG+    PG+ +  GL+  AA +LGL     V ASLIDA+AG   VLGA    +++P        ++  I GTS+CHM ++ +P+ + G+WGPY + +    ++ E GQ+  G LLD +++        RQ     ++E  E  G +  IY   + H  +M+        L   +HI PDF GNR+P +D   RG ++GL++  +   ++ LYLAT+Q+L  G + I+  + +   +I ++ +CGGLSKN+L+ +  A+ +GLPV+L    E VLLGAA +         SI     K  R  R + P+  L  ++ +KY ++ ++
Sbjct:  103 RNVVMWMDHRAAAQASRITACRHTLLQRVGGVMSPEIQPPKLLWLKENLPDSCWTRAAHFFDLPDFLSWKATGSLSRSLCTLVCKWTY-SASEGWDDTFWSAIGLEDLIEDSYARIGSQVCCPGAAVGRGLTAAAAADLGLNEGTAVGASLIDAHAGGIGVLGADVSGLHLPCEHQPLTARMALICGTSSCHMAVSREPLLVPGVWGPYLSAMLPGLWLNEGGQSATGKLLDHVVK---GHAAFRQ-----LEEQAEHSGRH--IYTQLNLHLQQMSTDATHLEQLTTHLHIWPDFHGNRSPLADQTARGTVVGLSLSQTLDDLALLYLATLQALALGSRHIIAAMTEAGHDITTLFLCGGLSKNTLFVQTHANTTGLPVVLPAEREAVLLGAAVIGACASSDCTSIPEAMRKMSRVGRVVRPNPELQSFYRRKYSVFLRL 532          

HSP 2 Score: 73.559 bits (179), Expect = 3.401e-12
Identity = 41/97 (42.27%), Postives = 55/97 (56.70%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSV 317
            Y++GVDVGS SVR  L         +L    E  I V +     YEQSS +IW+  C+  + +  G  +D A ++GIGFD TCSLV LD+   PL+V
Sbjct:    5 YYVGVDVGSASVRAALVSPDG----QLRRTAEEPIAVHEPCVDHYEQSSTEIWSKCCQTVKRVTEG--VDAACVRGIGFDGTCSLVVLDQQFRPLAV 95          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q04585|YDR09_YEAST (Uncharacterized sugar kinase YDR109C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YDR109C PE=1 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 5.601e-71
Identity = 157/463 (33.91%), Postives = 247/463 (53.35%), Query Frame = 3
Query:  951 FINLDQNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAF-----DSVNFGWDKEFWKKCGLSELCDNNFSIIGN------NFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAI---------------NMPK-------QLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRIL-------ELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQN-EELVLLGAAKLNILHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKI 2216
            F N DQN   +I+WMD RA  ET+ INS   K L  VGG+ SVEM+ PK+ WLK N+   +      FDLPD+L ++ATG  +RS CS  CK  F     +  + GW KEF    GLSEL  N+F  +G       NFL  G  IS  L + AA +LGL     V + +IDAYAG +G +               N  K       +L  +AGTS CH++++  PI++ G+WGPY++V+   ++  E GQ+  G LLD ++       ELS ++        + + +I ET  E   + ++ S        LAK +    D+ GNR+P +D ++R  IIG ++D+S   ++ +YL+  + +    ++I++++LK+  EI++I + GG  +NSL  R+LAD +GLP+++ +  +  V+ G+A L    S      ++ RT++  +   +  +  N  Y    K+
Sbjct:  136 FTNNDQN---IILWMDHRAMKETEEINSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGECISP-LDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVIS--------LAKHLFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFDYTREKRTLKGQKSSQTKTERFNDSYSSIQKL 586          

HSP 2 Score: 65.0846 bits (157), Expect = 1.825e-9
Identity = 35/88 (39.77%), Postives = 51/88 (57.95%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVAL 290
            +++GVDVG+ S R  +   S N    ++   E  IK  +   +   QSS +IW +VC   R +V  S +DP  ++GIGFDATCSLV +
Sbjct:   39 FYVGVDVGTGSARACVIDQSGN----MLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVEESGVDPERVRGIGFDATCSLVVV 122          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. TrEMBL
Match: A0A218UXQ9 (FGGY carbohydrate kinase domain-containing protein OS=Lonchura striata domestica OX=299123 GN=FGGY PE=4 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 5.465e-99
Identity = 171/444 (38.51%), Postives = 262/444 (59.01%), Query Frame = 3
Query:  966 QNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAI-------NMP--KQLIT-----IAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWH------EMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIID 2222
            QN+RNVIMWMD RA  + + IN+   + LN VGG  SVEMQPPKLLW+K+N+P   + +G+ FDLPDFL ++ATG   RSLC+V CKW + S + GWD  FW   GL +L  + +  IGN+ L+PG  +  GL+  AA++LGL   I V ASLIDA+AG LG I       N+P   Q IT     I GTS+CHM ++  PI++ G+WGPY + +    ++ E GQ+  G L+D ++    ++    +          +       IY   ++H         +  L  D+H+ PDF GNR+P +D  ++G ++GL +      ++ +YLATIQ++  G + IL+ +     EI ++ +CGGLSKN L+ ++ AD++G PV+L +  E VL+GAA L         SIQ    K  +  R ++P++   +++++KYK++ K+++
Sbjct:  106 QNHRNVIMWMDHRAVSQVQRINATQHRVLNYVGGAMSVEMQPPKLLWIKENLPESWEKVGYFFDLPDFLSWKATGVTARSLCTVVCKWTYTS-DRGWDDSFWNMIGLEDLVMDKYEKIGNHVLSPGEAVGKGLTPEAAEDLGLPKGIAVAASLIDAHAGGLGVIGADVKGHNLPCENQPITSRVAMICGTSSCHMGVSETPIFVPGVWGPYFSAMVPGLWLNEGGQSATGKLIDHVVR-GHVAFPELEA---------KAAASAHSIYTYLNSHLDLIKKSLPVGFLTVDLHVWPDFHGNRSPLTDLTLKGMVVGLTLSRGLDELALIYLATIQAIALGTRHILEAMQAAGHEISTLFLCGGLSKNPLFVQMHADITGKPVVLSKEVESVLVGAAILGACASGDFASIQEAMAKMGKIGRVVQPNHEHKRFYDKKYKVFLKLVE 538          

HSP 2 Score: 82.8037 bits (203), Expect = 1.100e-12
Identity = 43/103 (41.75%), Postives = 62/103 (60.19%), Query Frame = 3
Query:    9 KSYMYSYFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSV 317
            K    +Y++GVDVGS SVR  L          ++   E  I+V++ +   YEQSS DIW + C  T+ +V G  +D + I+G+GFDATCSLV +D+   PL+V
Sbjct:    5 KQTAVTYYVGVDVGSASVRAALVDGFGT----VVAHAEHPIQVWEPQPDHYEQSSADIWAACCSVTKEVVRG--VDASQIRGLGFDATCSLVVVDEQFQPLAV 101          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. TrEMBL
Match: A0A195EM23 (FGGY carbohydrate kinase domain-containing protein OS=Trachymyrmex cornetzi OX=471704 GN=ALC57_01386 PE=4 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 9.489e-99
Identity = 176/440 (40.00%), Postives = 262/440 (59.55%), Query Frame = 3
Query:  966 QNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNF---GWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAI---------NMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSD------ISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNIL----HSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKII 2219
            Q  +NVI+WMD RA +E  FINS+    L  VGGK S+EMQ PK+LWLKKN+P   ++   LFDLPDFL ++AT S  RSLCS+ CKW + +      GWD++F+++  L +L  +N+  IGN+   PG  I SGLS  AA ELGL     V ASLIDA+AG LG I         N  K+L  I GTS CHMI+    I+++G+WGPY + +   +++ E GQ+  G LLD +++         ++++  + I Q + E+     E +++ N+S         L KDIH+ PDF GNR+P +D  ++G + GL++   +  ++ LYLA +Q+L YG K I+++L      I+SI VCGGLS+N L+ ++ ADV  LPV+     E VL+GAA L       +SI    ++   +   ++P +   KYH +KY+++ K++
Sbjct:   98 QEKQNVILWMDHRAHEEADFINSMGHDILQYVGGKVSLEMQTPKMLWLKKNLPASWNSAALLFDLPDFLTWKATESESRSLCSLVCKWNYSANPIGKNGWDEDFFEQLNLRDLKKDNWRKIGNDIRVPGDAIESGLSTKAAAELGLLKGTPVGASLIDAHAGGLGMIGCYASDVSPNFSKRLALICGTSTCHMIVNENKIFVNGVWGPYYSAMVPGFWLNEGGQSATGKLLDHVIDTHPATPGILMTLSGNKHIQQYLSELLHVMAEQKNLQNVS--------YLTKDIHVWPDFHGNRSPLADPTLKGMVSGLSLSVDQENLALLYLAAVQALTYGTKHIIEVLSAAGHNIESILVCGGLSQNPLFIQIQADVLALPVLCPVERESVLVGAAILGACATRKYSIHETIQRMAGSANIVKPTSECYKYHLRKYRVFKKMV 529          

HSP 2 Score: 84.7297 bits (208), Expect = 2.656e-13
Identity = 45/100 (45.00%), Postives = 63/100 (63.00%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQT 326
            +F+GVDVG+ SVR  L  +S        C  EI    F+   + YEQSSD+IW++VC   + +V  + I    +KGIGFDATCS+VA+D+ G P++VS T
Sbjct:    3 FFVGVDVGTGSVRAALVTSSGKIKRVATCPLEI----FQPAPNFYEQSSDNIWSAVCHVVKSVV--ADISAEDVKGIGFDATCSMVAIDEAGLPITVSPT 96          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. TrEMBL
Match: A0A195F9M8 (FGGY carbohydrate kinase domain-containing protein OS=Trachymyrmex septentrionalis OX=34720 GN=ALC56_08708 PE=4 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 9.898e-99
Identity = 176/440 (40.00%), Postives = 262/440 (59.55%), Query Frame = 3
Query:  966 QNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFD---SVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAI---------NMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSD------ISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNIL----HSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKII 2219
            Q  +NVI+WMD RA +E  FINS+    L  VGGK S+EMQ PK+LWLKKN+P   ++   LFDLPDFL ++AT S  RSLCS+ CKW +    +   GWD++F+++  L +L  +N+  IGN+   PG  I SGLS  AA ELGL     V  SLIDA+AG LG I         N   +L  I GTS CHMI+    I+++G+WGPY + +   +++ E GQ+  G LLD +++         ++++  + I Q + E+     E +++ N+S         L KDIH+ PDF GNR+P +D+ ++G I GL++   +  ++ LYLA +Q+L YG K I+++L      I+SI VCGGLS+N L+ ++ ADV GLPV+     E VL+GAA L       +SI    ++   +   ++P +   KYH +KY+++ K++
Sbjct:   98 QEKQNVILWMDHRAHEEADFINSVGHDVLQYVGGKVSLEMQTPKMLWLKKNLPASWNSAALLFDLPDFLTWKATESESRSLCSLVCKWNYSANPTGKNGWDEDFFEQLNLRDLKKDNWRKIGNDIRVPGDAIESGLSTKAAAELGLLKGTPVGTSLIDAHAGGLGMIGCYASDVSPNFSNRLALICGTSTCHMIVNENKIFVNGVWGPYYSAMVPGFWLNEGGQSATGKLLDHVIDTHPATPGILMTLSGNKHIQQYLSELLHVMAEQKNLQNVS--------YLTKDIHVWPDFHGNRSPLADSTLKGMISGLSLSVDQENLALLYLAAVQALTYGTKHIIEVLSAAGHNIESILVCGGLSQNPLFIQIQADVLGLPVLCPVERESVLVGAAILGACATRKYSIHETIQRMAGSANIVKPTSECYKYHFRKYRVFKKMV 529          

HSP 2 Score: 83.5741 bits (205), Expect = 6.897e-13
Identity = 45/100 (45.00%), Postives = 62/100 (62.00%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQT 326
            +F+GVDVG+ SVR  L  +S        C  EI    F    + YEQSSD+IW++VC   + +V  + I    +KGIGFDATCS+VA+D+ G P++VS T
Sbjct:    3 FFVGVDVGTGSVRAALVTSSGKIKKVATCPLEI----FHPAPNFYEQSSDNIWSAVCHVVKSVV--ADISAENVKGIGFDATCSMVAVDEAGLPITVSPT 96          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. TrEMBL
Match: A0A2C9JHG2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106062991 PE=4 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 1.550e-98
Identity = 183/451 (40.58%), Postives = 269/451 (59.65%), Query Frame = 3
Query:  954 INLD-QNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAF--DSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAI-----------NMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEM----NV-----LAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCV-EIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNILHS-----IQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKII 2219
            ++LD +  +N+IMWMD RA+ +  FIN+     LNTVGG  S+EMQPPKLLWLK+N+P+   NIG LFDLPDFL +RATG   RSLCS+ CKW +  D+ +  WD EF    GLS+L  +  S+IGN   NPGS   +GLS  AAKELGL     V AS+IDA+AG LG +           N+   L+ IAGTS CH+I + KPI + G+WGPY +VI  + +V E GQ+  G+L++ ++       T+ +    + +E N++    +D+Y   + +  +M    N+     L  D  + PDF GNR+P +D  ++G I GL + +S   ++ LYLA +QSL YG K I+   +KNC  +I  + +CGGL+KNSLY +  ADV GLPV+L   E+ +LLG+A L    S     +Q            +  + +++ +H +K++++  ++
Sbjct:   96 VSLDGEAEQNIIMWMDHRAQSQADFINATQHSVLNTVGGVMSLEMQPPKLLWLKQNLPDTWQNIGHLFDLPDFLTWRATGCLTRSLCSLVCKWGYQADAGSMSWDDEFLACIGLSDLSHDEHSVIGNKVNNPGSPCGAGLSAEAAKELGLLAGTPVAASMIDAHAGALGCLGCKPREPSWQYNLENILVMIAGTSTCHIICSKKPIPVPGVWGPYYSVILPEMWVNEGGQSAAGHLIEFLI-------TNHKAYSLVKEEANKSA---QDVYEYLNTYLQKMADQRNIEHLAKLTHDFQVWPDFHGNRSPLADASLKGMISGLTLSNSADDLAVLYLAAVQSLAYGTKHIVS-EMKNCGHKISLVYICGGLAKNSLYVQTHADVLGLPVVLPNAEQSILLGSAMLGACASGHFPNLQAALASMGGQGTVLSANQNISSFHEKKFQVFLAMV 535          

HSP 2 Score: 77.0258 bits (188), Expect = 8.961e-11
Identity = 43/101 (42.57%), Postives = 59/101 (58.42%), Query Frame = 3
Query:   18 MYSYFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVS 320
            M  YFIGVDVG+ SVR  +      E  +L+  +   IK++  +   Y+QSS DIW ++  A +  V  + + P  I GIGFDATCS V L+K   PL+VS
Sbjct:    1 MKRYFIGVDVGTSSVRASIV----GEDGQLLSLSTSLIKIWNPKPDFYQQSSHDIWKNITNAVKVAVSKASVQPNEICGIGFDATCSTVVLNKEMQPLTVS 97          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. TrEMBL
Match: A0A026VSI6 (FGGY carbohydrate kinase domain-containing protein OS=Ooceraea biroi OX=2015173 GN=X777_03447 PE=4 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 4.614e-98
Identity = 180/445 (40.45%), Postives = 257/445 (57.75%), Query Frame = 3
Query:  966 QNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAF----DSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAI---------NMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDIS-------MTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNILHSIQLFQEKKFRTVRR-------IEPDNSLAKYHNQKYKIYSKII 2219
            Q  +NVI+WMD RA++E  FINS    AL  VGGK S+EMQ PK+LWLKKN+P    +   LFDLPDFL ++AT S  RSLCS+ CKW +    D  N GWD+ F+++  L EL  +N+  IGN+   PG  I  GLS  AA ELGL     V  SLIDA+AG LG I         N   +L  I GTS CHMI+  K I+++G+WGPY N +   +++ E GQ+  G LLD I+     +       +T  + I Q + E+     E  ++ N+S         L +D+H+ PDF GNR+P +D  ++G + GL++   + +++ LYLAT+Q+L YG K I++ L      I+ I VCGGLS+N L+ +  ADV  LPV+    +E VL+GAA   IL +    +     T++R       ++P +   KYH +KY ++ K++
Sbjct:   98 QEKQNVILWMDHRAQEEADFINSTGHDALQYVGGKVSLEMQTPKMLWLKKNLPASWSSAALLFDLPDFLTWKATESESRSLCSLVCKWNYTANLDGKN-GWDESFFEQLNLRELKKDNWKKIGNDVRVPGDAIEPGLSAKAAAELGLLEGTPVGTSLIDAHAGGLGMIGCYAPDVSPNFSNRLALICGTSTCHMIVNEKKIFVNGVWGPYYNAMISGFWLNEGGQSATGKLLDHIIGTHPATPGIIMKHLTGNKHIQQYLSELLHVMAEQRNLQNVS--------YLTRDLHVWPDFHGNRSPLADPSLKGMVSGLSLSVDEEHLALLYLATVQALTYGTKYIIETLTAAGHNIEGILVCGGLSRNRLFIQTQADVLSLPVLCPVEQESVLVGAA---ILGACATKKYSMHETIKRMAGTANIVKPASDCYKYHLRKYHVFKKMV 530          

HSP 2 Score: 84.7297 bits (208), Expect = 3.496e-13
Identity = 46/100 (46.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQT 326
            +F+GVDVG+ S R  L   +        C  EI    F    + YEQSSD+IW++VC   + +V G  I    +KGIGFDATCSLVALD  G P++VS T
Sbjct:    3 FFVGVDVGTGSARAALVAANGKVRKVAACPLEI----FHPAPNFYEQSSDNIWSAVCHVVKSVVAG--ISAENVKGIGFDATCSLVALDNTGSPVTVSIT 96          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Cavefish
Match: fggy (FGGY carbohydrate kinase domain containing [Source:NCBI gene;Acc:103042840])

HSP 1 Score: 297.36 bits (760), Expect = 3.302e-91
Identity = 171/463 (36.93%), Postives = 264/463 (57.02%), Query Frame = 3
Query:  951 FINLDQNY------------RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIP-NFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAI-------NMP--KQLIT-----IAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEM-------NVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIID 2222
             + LDQN+            RNV+MWMD RA D+   I +   + LN+VGG  S EMQPPKLLWLK+N+  +   +    FDLPDFL +++TGS  RSLC++ CKW +   + GWD  FW   GL +L +NN S IG     PG  +  GL+  AA +LGL     V ASLIDA+AG LG I       ++P   Q IT     I GTS+CHM ++ KP+++ G+WGPY + +  + ++ E GQ+  G L+D +++             QL Q+  +    +E +Y+  + +  EM       + L+  +H+ PDF GNR+P +D  ++G ++GL++  +   ++ LYLAT+Q++  G + IL ++ +   +I ++ +CGGLSKN L+ ++ A+ +GLPV+L    E VL+GAA L         SIQ   EK  R  + I+P+  L  ++ +KY ++ ++ D
Sbjct:   88 LVVLDQNFQPVAVNKNGVEERNVVMWMDHRALDQASRITATKHRVLNSVGGVMSPEMQPPKLLWLKENLKQSCWKDAAHFFDLPDFLSWKSTGSLVRSLCTLVCKWTYAPPD-GWDDGFWTTIGLEDLLENNHSRIGEQTCCPGCPVGEGLTPEAAADLGLNPGTAVGASLIDAHAGGLGVIGADVSGHHLPCENQPITCRAALICGTSSCHMAVSQKPLFVPGVWGPYLSAMVPELWLNEGGQSATGGLIDHVVK-------GHAAFPQLKQQTEK---RDEHVYSFLNRYLEEMSKDQKHLDQLSASLHVWPDFHGNRSPLADQSLKGMVVGLSLSQTLDDLALLYLATVQAIALGTRHILSVMKEAGHDITTLFLCGGLSKNPLFVQIHANTTGLPVVLAAEREAVLVGAAVLGACASGDCSSIQEAMEKMARIGKVIQPNLELESFYRRKYAVFLRLYD 539          

HSP 2 Score: 77.411 bits (189), Expect = 2.627e-14
Identity = 42/102 (41.18%), Postives = 61/102 (59.80%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQTSM 332
            Y++GVDVGS SVR  L  T D     +    E +I V+  +   YEQSS+DIW   C   + +  G  ++   ++GIGFDATCSLV LD+N  P++V++  +
Sbjct:   10 YYVGVDVGSGSVRAALV-TRDGR---VKATAEESITVWTPQPDYYEQSSEDIWRKCCNTVKKVTEG--VEKDRVRGIGFDATCSLVVLDQNFQPVAVNKNGV 105          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Cavefish
Match: fggy (FGGY carbohydrate kinase domain containing [Source:NCBI gene;Acc:103042840])

HSP 1 Score: 285.804 bits (730), Expect = 5.289e-87
Identity = 168/449 (37.42%), Postives = 255/449 (56.79%), Query Frame = 3
Query:  951 FINLDQNY------------RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIP-NFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAI-------NMP--KQLIT-----IAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEM-------NVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAK 2180
             + LDQN+            RNV+MWMD RA D+   I +   + LN+VGG  S EMQPPKLLWLK+N+  +   +    FDLPDFL +++TGS  RSLC++ CKW +   + GWD  FW   GL +L +NN S IG     PG  +  GL+  AA +LGL     V ASLIDA+AG LG I       ++P   Q IT     I GTS+CHM ++ KP+++ G+WGPY + +  + ++ E GQ+  G L+D +++             QL Q+  +    +E +Y+  + +  EM       + L+  +H+ PDF GNR+P +D  ++G ++GL++  +   ++ LYLAT+Q++  G + IL ++ +   +I ++ +CGGLSKN L+ ++ A+ +GLPV+L    E VL+GAA L         SIQ   EK  R  + I+P+  L +
Sbjct:   92 LVVLDQNFQPVAVNKNGVEERNVVMWMDHRALDQASRITATKHRVLNSVGGVMSPEMQPPKLLWLKENLKQSCWKDAAHFFDLPDFLSWKSTGSLVRSLCTLVCKWTYAPPD-GWDDGFWTTIGLEDLLENNHSRIGEQTCCPGCPVGEGLTPEAAADLGLNPGTAVGASLIDAHAGGLGVIGADVSGHHLPCENQPITCRAALICGTSSCHMAVSFKPLFVPGVWGPYLSAMVPELWLNEGGQSATGGLIDHVVK-------GHAAFPQLKQQTEK---RDEHVYSFLNRYLEEMSKDQKHLDQLSASLHVWPDFHGNRSPLADQSLKGMVVGLSLSQTLDDLALLYLATVQAIALGTRHILSVMKEAGHDITTLFLCGGLSKNPLFVQIHANTTGLPVVLAAEREAVLVGAAVLGACASGDCSSIQEAMEKMARIGKVIQPNLELER 529          

HSP 2 Score: 80.4925 bits (197), Expect = 2.633e-15
Identity = 44/108 (40.74%), Postives = 64/108 (59.26%), Query Frame = 3
Query:    9 KSYMYSYFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQTSM 332
            +S  Y Y++GVDVGS SVR  L  T D     +    E +I V+  +   YEQSS+DIW   C   + +  G  ++   ++GIGFDATCSLV LD+N  P++V++  +
Sbjct:    8 RSPTYWYYVGVDVGSGSVRAALV-TRDGR---VKATAEESITVWTPQPDYYEQSSEDIWRKCCNTVKKVTEG--VEKDRVRGIGFDATCSLVVLDQNFQPVAVNKNGV 109          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: fggy (FGGY carbohydrate kinase domain containing [Source:NCBI gene;Acc:406567])

HSP 1 Score: 268.47 bits (685), Expect = 8.127e-83
Identity = 141/383 (36.81%), Postives = 220/383 (57.44%), Query Frame = 3
Query: 1116 NIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAIN--------------MPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNI-----LHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIY 2207
            N+P+        FDLPDFL ++ATGS  RSLC V CKW ++ V+ GWD+ FW + GLS++C   +S IG +FL PG  +S GL+  AA ELGL     V A+LIDA+AG +G I               +  +L  I GTS CHM ++ K +++ G+WGPY +V+    ++ E GQ+  G+L++ I+         +++ D   Q   E    N  + ++++        L  D+H+ PDF GNR+P +D+  +G +IGL++  +   + +LYLAT+Q+L  G + IL+ + ++   + +I +CGGLSKNSLY +  AD +GLPV+L    E V++GAA L         S+Q   +   R  + I PD ++  ++ +KYK+Y
Sbjct:    1 NLPDSWKKARHFFDLPDFLTWKATGSLTRSLCCVVCKWTYN-VDSGWDQSFWDEIGLSDICQEGYSRIGVDFLGPGQPLSGGLTMHAADELGLHPGTAVGAALIDAHAGTIGVIGGDVTGLGLACESQPITARLSMIGGTSTCHMALSDKALFVGGVWGPYYSVVLPGLWLNEGGQSATGSLIEHIVTGHPAYNELKKIADASGQSTYEWL--NRRVVSMAT-EGAAPATLTSDLHVCPDFHGNRSPLADSSRKGMVIGLDLSHTCDSLVQLYLATLQALALGTRHILNAMTQSGHNVSAIFMCGGLSKNSLYVQAHADATGLPVVLPAEAEAVVVGAAILGACASKDFTSMQEAMQHMVRVGKVIHPDPAVRSFYERKYKVY 379          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Yeast
Match: YDR109C_mRNA (Putative kinase [Source:SGD;Acc:S000002516])

HSP 1 Score: 249.98 bits (637), Expect = 8.066e-73
Identity = 157/463 (33.91%), Postives = 247/463 (53.35%), Query Frame = 3
Query:  951 FINLDQNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAF-----DSVNFGWDKEFWKKCGLSELCDNNFSIIGN------NFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAI---------------NMPK-------QLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRIL-------ELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQN-EELVLLGAAKLNILHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKI 2216
            F N DQN   +I+WMD RA  ET+ INS   K L  VGG+ SVEM+ PK+ WLK N+   +      FDLPD+L ++ATG  +RS CS  CK  F     +  + GW KEF    GLSEL  N+F  +G       NFL  G  IS  L + AA +LGL     V + +IDAYAG +G +               N  K       +L  +AGTS CH++++  PI++ G+WGPY++V+   ++  E GQ+  G LLD ++       ELS ++        + + +I ET  E   + ++ S        LAK +    D+ GNR+P +D ++R  IIG ++D+S   ++ +YL+  + +    ++I++++LK+  EI++I + GG  +NSL  R+LAD +GLP+++ +  +  V+ G+A L    S      ++ RT++  +   +  +  N  Y    K+
Sbjct:  136 FTNNDQN---IILWMDHRAMKETEEINSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGECISP-LDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVIS--------LAKHLFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFDYTREKRTLKGQKSSQTKTERFNDSYSSIQKL 586          

HSP 2 Score: 65.0846 bits (157), Expect = 2.629e-11
Identity = 35/88 (39.77%), Postives = 51/88 (57.95%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVAL 290
            +++GVDVG+ S R  +   S N    ++   E  IK  +   +   QSS +IW +VC   R +V  S +DP  ++GIGFDATCSLV +
Sbjct:   39 FYVGVDVGTGSARACVIDQSGN----MLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVEESGVDPERVRGIGFDATCSLVVV 122          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Yeast
Match: MPA43 (Protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000005193])

HSP 1 Score: 116.316 bits (290), Expect = 9.997e-28
Identity = 99/393 (25.19%), Postives = 181/393 (46.06%), Query Frame = 3
Query:  969 NYRNVIMWMDLRAKDETKFIN-SLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVN-----FGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAG--VLGAINMPKQLITIAGTSACHMIMTP-KPIYIDGIWGPYKNVI--KEDYYVLEAGQTMVGNLLDRILE--------LSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLL--KNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLG 2084
            N  NVI WMD  A +E +++N     + L+ +GGKF  EM  PKL +      +  D    +FDL  ++ Y  +   + ++  +  +   + +       GW   F+K                 N +N  S +S G + + A +     S  V  S ID+YA    + + ++   L  IAGTS+C+M  T      I G+WGP+  ++  + D+ V  AGQ+  G L++ + E        L D +  + QV++Q I++I +  G +             +++L KD+    D+ GNR P +D  I+G+ IG + D+S   ++  Y+  ++ L +  K I+D      + + I  + + G  +KN     +++ V+    ++   E + ++G
Sbjct:  104 NEDNVIFWMDSSAVNECQWLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQYIAYELSRLYEWNIEGLLGRENLNGIGNDGEVSGWSSSFYK-----------------NIINLPSNVSIGTTSLVANK---HISTTVVRSCIDSYASWFAVASPHLETSLFMIAGTSSCYMYGTTISDTRIPGVWGPFDTILDNRGDFSVYAAGQSCTGKLIEHLFESHPCARKILKDGADIY-QVLEQTIRDIEKNNGLS-------------IHILTKDMFFYGDYEGNRTPFADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHIKELRISGSQAKNERLLSLISLVNNGVAIIKPKENVDMMG 462          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO46944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNK8])

HSP 1 Score: 269.24 bits (687), Expect = 5.345e-81
Identity = 155/450 (34.44%), Postives = 251/450 (55.78%), Query Frame = 3
Query:  975 RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAF--------DSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAI------------NMP--KQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEMN---------VLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVL-----LGAAKLNILHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKI 2216
            +++IMW+D RA  +   IN  D   L  VGG  S E Q  K+LWLK+N+           DLP++L YRATGS  RS+CSV  K+ F           + GW + +W+  GL +L +  ++ +G++F +PGS+++ GLS  AA+E+GL   + V  S+IDAYAG LG I            N P   +L  + GTS CH+ ++ + +++ G+WGPY + +   +++ E GQT  G L+D ++E      TH    D+L +E  ET G +  +Y+L +    ++           L    H+ PDF GNR+P +D D+RG + GLN+ +S   ++  YLA+IQ+L +G + I+D +  +   + ++ +CGGL+KN+LY +V AD++G+P +L + E+ VL     LGA       S+Q   +        + PD  L K++ +K+K++ K+
Sbjct:  103 KDIIMWLDHRAISQAGAINQTDHYVLKYVGGLLSPEQQAAKMLWLKENLNETWKKAAKFLDLPEYLTYRATGSFQRSMCSVVSKFNFMGDESQRDKGSSSGWIESYWEAIGLQDLVEEGYTKLGSDFTHPGSVLNQGLSHDAAEEMGLLAGLPVGCSMIDAYAGGLGVIGADISGHSLPCKNQPITSRLALVCGTSTCHIALSEEALFVKGVWGPYFSNMVPGFWLNEGGQTATGKLIDHMIE------TH-PCYDKL-KEKAETSGIS--VYDLLNQQAEKLASERGLSSPAFLTCHFHMLPDFHGNRSPIADADMRGMVCGLNLSTSLDDLAIKYLASIQALAHGTRHIIDSMNVSGHHVSTLFMCGGLTKNTLYVQVHADITGMPCVLPREEDSVLVGSGILGACAARDFSSLQEAMKAMTAVGSIVRPDPRLQKFYEKKHKVFLKM 542          

HSP 2 Score: 78.9518 bits (193), Expect = 3.248e-15
Identity = 40/102 (39.22%), Postives = 62/102 (60.78%), Query Frame = 3
Query:   18 MYSYFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEES-IYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVS 320
            M  Y++GVDVG+ SVR GL          L+      +K++  + + +YEQS+ D+W  VC+  + +  G  +D +L++GIGFDATCSL  + ++G  LSVS
Sbjct:    1 MAGYYVGVDVGTASVRAGLLSRDG----RLLAHAGTPLKIWHPDGTEVYEQSTKDVWGGVCQVIKKVCSG--VDKSLVRGIGFDATCSLAVVGQDGRGLSVS 96          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO35639 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKX9])

HSP 1 Score: 51.6026 bits (122), Expect = 8.991e-7
Identity = 27/92 (29.35%), Postives = 57/92 (61.96%), Query Frame = 3
Query: 1776 IHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNC-VEIDSIAVCGGLSKNSLYCRVLADVSGLPV 2048
            ++  P F+G   P    D RG I+GL   +++++I++   AT++++ +  +E+LD + ++C + + S+ V GG++ N L  ++ AD+ G+ V
Sbjct:  357 VYFVPAFSGLYAPYWQMDARGVIVGLTQFTNRAHIAR---ATLEAVCFQTRELLDAMNEDCGIPLASLLVDGGMTVNRLLMQLQADILGISV 445          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO32028 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWA4])

HSP 1 Score: 49.6766 bits (117), Expect = 3.674e-6
Identity = 95/390 (24.36%), Postives = 159/390 (40.77%), Query Frame = 3
Query:  954 INLD-QNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCK--WAFDSVNFGWDKEFWKKCGLSELCDNNFSI-IGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAINMPKQLITIAGTSACHMIMTP--KPIYIDGIWGPYKNVIKEDYYV---LEAGQTMVGNLLDRILELSDISMTHRQVIDQL-IQEINETCGENEDIYNLSSAHWHEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCG-GLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAA 2090
            I+LD ++  ++I W D R  D   F++SL   + N      S       + WL +N P F+D       + DF+V           CS+ C    + ++V++G+     K+  L  L    F + +  N   PG+++  GL  +     G+     V A+L D +  +          +   GTS+   I+ P    + +D      +N   E + +    +  Q MV   L     ++  + T +  +++L IQEI  T    E IY    A    M  LA    I P   G R+    T++ G +   NI S  + +  +  A  Q ++    E+L         +  I   G  L +N L   ++  V GLP++L + E    LGAA
Sbjct:  109 IHLDKESVSSLITWEDRRCTD--GFLSSLPNPSTNI---PISTGYGCASIFWLTRNKPGFLDKFDCSGTVMDFVV-------SMFCCSLRCGIMSSHNAVSWGYYDNLNKRWELESLQAAEFPVHLLPNVYEPGTIV--GL--LFTDYCGIPKGTPVGAALGDFHCSMYACQQNKTDAVLNIGTSSQFAILAPVNHQLSVD------ENESCEAWQMWPYFKGDQVMVAASLHGGNVITHFAETVKSWMEELKIQEIPNT----ETIYKNLLASADSMTTLA----IRPTIWGERH---STNLTGMVS--NILSGNTSLGDITAAICQGMLANLHEMLPGERSRRCGVKRIVGTGRALVQNDLMQELVKQVWGLPLVLCK-ENDASLGAA 462          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Medaka
Match: fggy (FGGY carbohydrate kinase domain containing [Source:NCBI gene;Acc:101172765])

HSP 1 Score: 294.278 bits (752), Expect = 5.156e-90
Identity = 169/451 (37.47%), Postives = 258/451 (57.21%), Query Frame = 3
Query:  954 INLDQN-YRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIP-NFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAI--------------NMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEM-------NVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNILHS-----IQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIID 2222
            +N D +  RN++MWMD RA ++   I +   + L  VGG  S EMQPPKLLWLK+N+  +  D     FDLPDFL ++ATG   RSLC++ CKW +   + GWD  FW   GL EL +NNFS IG+    PGS +  GL+  AA +LGL     V ASLIDA+AG LG I              ++  ++  I GTS CHM ++  P ++ G+WGPY + +    ++ E GQ+  G L+D +++      T  Q+  Q+ Q +  T G   +IY+  ++H  +M       ++L   +H+ PDF GNR+P +D  ++G + GL++  +   ++ LYLATIQ+L  G   ILD + K   +I ++ +CGGLSKN L+ +  A+ +GLPV+L    E VL+GAA L    S     +Q   EK  +  + ++P+  L  ++ +KYK++ +++ 
Sbjct:   95 VNQDGDAQRNIVMWMDHRAAEQATRITNSSHEVLRRVGGVMSQEMQPPKLLWLKENLKESCWDKAAHFFDLPDFLSWKATGLLTRSLCTLVCKWTYCPPD-GWDATFWTSIGLEELLENNFSKIGSETSPPGSSLGKGLTMEAAGDLGLNPGTAVGASLIDAHAGGLGVIGADVKGFSLPCEHRSISSRMAMICGTSTCHMAISETPRFVPGVWGPYLSAMVPGLWLNEGGQSATGRLIDHVVK-GHAGFT--QLEAQVQQSVPFTGG---NIYSYLNSHLGQMTKSGSPVDLLTSSLHVWPDFHGNRSPLADPTLKGMVTGLSLSQTLDDLALLYLATIQALALGTLHILDAMKKAGHDISALFLCGGLSKNVLFVQTHANATGLPVVLPDQTEAVLVGAAVLGACASRDYSTLQEAMEKMAKVGKVVQPERELQSFYERKYKVFLRLVS 538          

HSP 2 Score: 72.7886 bits (177), Expect = 6.632e-13
Identity = 40/99 (40.40%), Postives = 57/99 (57.58%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQ 323
            +++GVDVG+ SVR  L  T D     L C  E  I +++ +   + QSS +IW   C   + +  G  +    ++GIGFDATCSLV LDK+  PL V+Q
Sbjct:    5 FYVGVDVGTGSVRAALV-TGDGR---LRCTAEEPITIWEPQPEHFVQSSTEIWHKCCAVVKKVTEG--VQSEQVRGIGFDATCSLVVLDKSFQPLPVNQ 97          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Medaka
Match: fggy (FGGY carbohydrate kinase domain containing [Source:NCBI gene;Acc:101172765])

HSP 1 Score: 274.248 bits (700), Expect = 1.088e-82
Identity = 161/439 (36.67%), Postives = 245/439 (55.81%), Query Frame = 3
Query:  975 RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIP-NFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAI--------------NMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEM-------NVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNILHSIQLFQEKKFRTVR-RIEPDNSLAKYHNQKYKIYSKIID 2222
            RN++MWMD RA ++   I +   + L  VGG  S EMQPPKLLWLK+N+  +  D     FDLPDFL ++ATG   RSLC++ CKW +   + GWD  FW   GL EL +NNFS IG+    PGS +  GL+  AA +LGL     V ASLIDA+AG LG I              ++  ++  I GTS CHM ++  P ++ G+WGPY + +    ++ E GQ+  G L+D +++      T        ++ +  T G   +IY+  ++H  +M       ++L   +H+ PDF GNR+P +D  ++G + GL++  +   ++ LYLATIQ+L  G   ILD + K   +I ++ +CGGLSKN L+ +  A+ +GLPV+L    E VL+GAA L    S      + + T   +I        ++ +KYK++ +++ 
Sbjct:  103 RNIVMWMDHRAAEQATRITNSSHEVLRRVGGVMSQEMQPPKLLWLKENLKESCWDKAAHFFDLPDFLSWKATGLLTRSLCTLVCKWTYCPPD-GWDATFWTSIGLEELLENNFSKIGSETSPPGSSLGKGLTMEAAGDLGLNPGTAVGASLIDAHAGGLGVIGADVKGFSLPCEHRSISSRMAMICGTSTCHMAISETPRFVPGVWGPYLSAMVPGLWLNEGGQSATGRLIDHVVK-GHAGFTQ-------LEAVPFTGG---NIYSYLNSHLGQMTKSGSPVDLLTSSLHVWPDFHGNRSPLADPTLKGMVTGLSLSQTLDDLALLYLATIQALALGTLHILDAMKKAGHDISALFLCGGLSKNVLFVQTHANATGLPVVLPDQTEAVLVGAAVLGACAS------RDYNTTYLKIYTVFFFGSFYERKYKVFLRLVS 523          

HSP 2 Score: 72.4034 bits (176), Expect = 8.403e-13
Identity = 40/99 (40.40%), Postives = 57/99 (57.58%), Query Frame = 3
Query:   27 YFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQ 323
            +++GVDVG+ SVR  L  T D     L C  E  I +++ +   + QSS +IW   C   + +  G  +    ++GIGFDATCSLV LDK+  PL V+Q
Sbjct:    5 FYVGVDVGTGSVRAALV-TGDGR---LRCTAEEPITIWEPQPEHFVQSSTEIWHKCCAVVKKVTEG--VQSEQVRGIGFDATCSLVVLDKSFQPLPVNQ 97          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Medaka
Match: gk5 (glycerol kinase 5 [Source:NCBI gene;Acc:101157006])

HSP 1 Score: 51.9878 bits (123), Expect = 2.141e-6
Identity = 30/102 (29.41%), Postives = 60/102 (58.82%), Query Frame = 3
Query: 1788 PDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNC-VEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAA 2090
            P F+G + P +D     +++GL   S+KS++ +   A ++S+ +  K++ + +L+   + I +I V GG+S N    ++ AD+ G  ++ +Q+ E+  LGAA
Sbjct:  368 PSFSGLQAPLNDPKACASLMGLRPSSTKSHLIR---AILESVAFRNKQLYETMLRETNIPITNIRVDGGVSSNDFVMQLTADLFGRKLVRLQHREMSCLGAA 466          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000071130.1 (SMESG000071130.1)

HSP 1 Score: 456.833 bits (1174), Expect = 2.516e-155
Identity = 217/220 (98.64%), Postives = 219/220 (99.55%), Query Frame = 3
Query:  963 DQNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLL 1622
            +QN RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNL+
Sbjct:  142 NQNDRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLV 361          

HSP 2 Score: 212.231 bits (539), Expect = 1.228e-61
Identity = 101/103 (98.06%), Postives = 102/103 (99.03%), Query Frame = 3
Query:   21 YSYFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQTS 329
            YSYFIGVDVGSFSVRCGLFRT DNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQT+
Sbjct:   40 YSYFIGVDVGSFSVRCGLFRTCDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQTN 142          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000071130.1 (SMESG000071130.1)

HSP 1 Score: 456.447 bits (1173), Expect = 2.786e-155
Identity = 217/220 (98.64%), Postives = 219/220 (99.55%), Query Frame = 3
Query:  963 DQNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLL 1622
            +QN RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNL+
Sbjct:  132 NQNDRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLV 351          

HSP 2 Score: 212.231 bits (539), Expect = 1.168e-61
Identity = 101/103 (98.06%), Postives = 102/103 (99.03%), Query Frame = 3
Query:   21 YSYFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQTS 329
            YSYFIGVDVGSFSVRCGLFRT DNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQT+
Sbjct:   30 YSYFIGVDVGSFSVRCGLFRTCDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQTN 132          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000071130.1 (SMESG000071130.1)

HSP 1 Score: 456.447 bits (1173), Expect = 4.182e-155
Identity = 217/220 (98.64%), Postives = 219/220 (99.55%), Query Frame = 3
Query:  963 DQNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLL 1622
            +QN RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNL+
Sbjct:  138 NQNDRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLV 357          

HSP 2 Score: 211.846 bits (538), Expect = 1.832e-61
Identity = 101/103 (98.06%), Postives = 102/103 (99.03%), Query Frame = 3
Query:   21 YSYFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQTS 329
            YSYFIGVDVGSFSVRCGLFRT DNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQT+
Sbjct:   36 YSYFIGVDVGSFSVRCGLFRTCDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQTN 138          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000071130.1 (SMESG000071130.1)

HSP 1 Score: 454.907 bits (1169), Expect = 4.957e-155
Identity = 217/220 (98.64%), Postives = 219/220 (99.55%), Query Frame = 3
Query:  963 DQNYRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLL 1622
            +QN RNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNL+
Sbjct:  104 NQNDRNVIMWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMDNIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGLSELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAYAGVLGAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYVLEAGQTMVGNLV 323          

HSP 2 Score: 213.386 bits (542), Expect = 1.798e-62
Identity = 102/104 (98.08%), Postives = 103/104 (99.04%), Query Frame = 3
Query:   18 MYSYFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQTS 329
            MYSYFIGVDVGSFSVRCGLFRT DNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQT+
Sbjct:    1 MYSYFIGVDVGSFSVRCGLFRTCDNETLELICKNEINIKVFKCEESIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNGHPLSVSQTN 104          
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000071132.1 (SMESG000071132.1)

HSP 1 Score: 362.844 bits (930), Expect = 1.614e-121
Identity = 180/191 (94.24%), Postives = 180/191 (94.24%), Query Frame = 3
Query: 1653 MTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVSGLPVMLMQNEELVLLGAAKLNILHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIIDF 2225
            MTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEMNVL KDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVS          ELVLLGAAKLNILHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIIDF
Sbjct:    1 MTHRQVIDQLIQEINETCGENEDIYNLSSAHWHEMNVLTKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISKLYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVS----------ELVLLGAAKLNILHSIQLFQEKKFRTVRRIEPDNSLAKYHNQKYKIYSKIIDF 181          
The following BLAST results are available for this feature:
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FGGY1.726e-9237.16FGGY carbohydrate kinase domain containing [Source... [more]
FGGY1.575e-8838.10FGGY carbohydrate kinase domain containing [Source... [more]
FGGY2.311e-8839.05FGGY carbohydrate kinase domain containing [Source... [more]
FGGY3.366e-8735.26FGGY carbohydrate kinase domain containing [Source... [more]
FGGY1.396e-7435.31FGGY carbohydrate kinase domain containing [Source... [more]
back to top
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG115941.315e-9237.78gene:FBgn0035484 transcript:FBtr0310046[more]
CG115941.315e-9237.78gene:FBgn0035484 transcript:FBtr0073283[more]
CG115941.315e-9237.78gene:FBgn0035484 transcript:FBtr0073284[more]
CG115941.315e-9237.78gene:FBgn0035484 transcript:FBtr0309791[more]
Gk11.843e-829.91gene:FBgn0025592 transcript:FBtr0072529[more]
back to top
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fggy1.751e-6934.52FGGY carbohydrate kinase domain containing [Source... [more]
back to top
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fggy1.676e-9738.15FGGY carbohydrate kinase domain containing [Source... [more]
fggy2.565e-9738.15FGGY carbohydrate kinase domain containing [Source... [more]
fggy2.837e-9738.15FGGY carbohydrate kinase domain containing [Source... [more]
fggy1.459e-9439.09FGGY carbohydrate kinase domain containing [Source... [more]
fggy1.776e-9440.10FGGY carbohydrate kinase domain containing [Source... [more]
back to top
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fggy3.896e-9537.10FGGY carbohydrate kinase domain containing [Source... [more]
Fggy1.695e-7735.05FGGY carbohydrate kinase domain containing [Source... [more]
Fggy8.547e-6245.76FGGY carbohydrate kinase domain containing [Source... [more]
Fggy7.651e-2454.35FGGY carbohydrate kinase domain containing [Source... [more]
Fggy1.806e-1928.57FGGY carbohydrate kinase domain containing [Source... [more]
back to top
BLAST of FGGY carbohydrate kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DCD1|FGGY_XENLA7.492e-9939.05FGGY carbohydrate kinase domain-containing protein... [more]
sp|A2AJL3|FGGY_MOUSE2.725e-9437.10FGGY carbohydrate kinase domain-containing protein... [more]
sp|Q96C11|FGGY_HUMAN8.287e-9237.16FGGY carbohydrate kinase domain-containing protein... [more]
sp|Q6NUW9|FGGY_DANRE3.398e-8636.96FGGY carbohydrate kinase domain-containing protein... [more]
sp|Q04585|YDR09_YEAST5.601e-7133.91Uncharacterized sugar kinase YDR109C OS=Saccharomy... [more]
back to top
BLAST of FGGY carbohydrate kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A218UXQ95.465e-9938.51FGGY carbohydrate kinase domain-containing protein... [more]
A0A195EM239.489e-9940.00FGGY carbohydrate kinase domain-containing protein... [more]
A0A195F9M89.898e-9940.00FGGY carbohydrate kinase domain-containing protein... [more]
A0A2C9JHG21.550e-9840.58Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A026VSI64.614e-9840.45FGGY carbohydrate kinase domain-containing protein... [more]
back to top
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fggy3.302e-9136.93FGGY carbohydrate kinase domain containing [Source... [more]
fggy5.289e-8737.42FGGY carbohydrate kinase domain containing [Source... [more]
back to top
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fggy8.127e-8336.81FGGY carbohydrate kinase domain containing [Source... [more]
back to top
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YDR109C_mRNA8.066e-7333.91Putative kinase [Source:SGD;Acc:S000002516][more]
MPA439.997e-2825.19Protein of unknown function; the authentic, non-ta... [more]
back to top
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO469445.345e-8134.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356398.991e-729.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320283.674e-624.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
fggy5.156e-9037.47FGGY carbohydrate kinase domain containing [Source... [more]
fggy1.088e-8236.67FGGY carbohydrate kinase domain containing [Source... [more]
gk52.141e-629.41glycerol kinase 5 [Source:NCBI gene;Acc:101157006][more]
back to top
BLAST of FGGY carbohydrate kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071130.12.516e-15598.64SMESG000071130.1[more]
SMESG000071130.12.786e-15598.64SMESG000071130.1[more]
SMESG000071130.14.182e-15598.64SMESG000071130.1[more]
SMESG000071130.14.957e-15598.64SMESG000071130.1[more]
SMESG000071132.11.614e-12194.24SMESG000071132.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007003 ID=SMED30007003|Name=FGGY carbohydrate kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2329bp
ATCTATATAAATCTTATATGTATTCATATTTTATCGGTGTTGATGTTGGT
AGCTTTAGTGTTAGATGTGGTCTTTTCCGAACCAGTGACAATGAAACTCT
AGAATTGATTTGTAAAAATGAAATCAATATCAAAGTTTTTAAATGTGAAG
AAAGTATTTATGAACAATCAAGTGACGATATTTGGACTTCAGTATGTAAA
GCAACTCGACATTTGGTTTTAGGATCTTATATTGATCCTGCTTTGATTAA
AGGTATTGGTTTTGATGCTACATGTTCATTGGTAGCTCTGGACAAGAACG
GGCATCCTTTATCTGTTTCTCAAACAAGTATGTAAAATGTTTAAATAAAA
AGAAATTACGACAGAAAGTCTTTAGGCGTAATTAAGCTGTAGGTCAAAAA
AATAATTGATGTATCTCGTTTGAAATAATTCAATATATATTACTAAAAAA
ATTAATTTTAATGTTTGTCTTCTCTTAAAAAAACATTTCTTACATTGTCA
TTTCTCAAATCGAAATTACTAACAACACTATGAAATATGAAATTTGTAGA
AACGCAAAACCTTGATATCGAATGCTCCGTGATCAACTGGAATTGAATAC
AAAGTTCAGTCGATCAAATATATTTTTGATGTTATTGTTGTGTTCTCACA
AACATGTTATTTAAAAACGGGAACGACACAGGGTTTTATGTGGTCCCACT
TGCACTGATTCTTTTTATCAATCATAATTTTCTTTTTCCATCTTTTCAAG
CAAGCATATTGTAGAAATTTTAGTGCGCATCACTGTTCGATCTTTTAAAT
TGCATTACTAAAATTGGTAAAGGGCGTAAAGTACTCAGAAATCCCTACTA
AAAGTCATTATTGCCGCTTTAAAGATTCAAATGCACTGTTTTATCTATAA
TTTTATACTTCCTTATAAATGTTTTCAAAGCTTTATTGTTTTTACAATGT
TTTATAAATCTAGATCAAAATTATAGGAACGTTATTATGTGGATGGATTT
AAGAGCCAAGGATGAAACAAAATTTATTAATAGTTTAGATTTAAAAGCAT
TAAATACGGTTGGTGGAAAATTCTCTGTCGAAATGCAGCCTCCGAAATTG
CTTTGGCTTAAAAAGAATATACCAAATTTCATGGACAATATTGGTTTTTT
ATTTGATCTACCCGATTTTTTAGTATATCGAGCAACTGGATCCAATGATA
GATCACTTTGTTCTGTAACTTGTAAATGGGCTTTTGATTCCGTAAATTTT
GGTTGGGATAAAGAATTTTGGAAAAAATGCGGTTTATCGGAATTATGCGA
CAATAATTTTTCTATCATTGGTAATAATTTCCTCAATCCTGGAAGTTTAA
TTAGCTCTGGATTATCTGAAATAGCTGCCAAGGAACTCGGCCTTGAGCAT
TCAATTTATGTGCCTGCATCTTTAATTGATGCTTATGCAGGTGTGCTGGG
CGCCATCAATATGCCAAAACAACTAATAACAATTGCAGGGACGTCTGCAT
GTCATATGATTATGACCCCGAAACCAATTTACATAGACGGGATTTGGGGA
CCATATAAAAATGTGATAAAAGAGGATTATTATGTTCTTGAAGCTGGACA
AACAATGGTTGGTAATTTGCTTGATCGAATATTAGAACTCTCGGATATTT
CTATGACTCATAGGCAAGTAATTGATCAATTGATACAAGAAATTAACGAA
ACATGCGGGGAAAATGAGGATATTTATAACCTTTCTTCTGCACATTGGCA
TGAAATGAATGTCCTGGCGAAAGACATTCATATCAATCCTGATTTTGCTG
GGAATCGAAATCCCAGATCTGATACTGACATTAGGGGAGCGATAATTGGA
CTAAATATCGATTCTTCCAAAAGTTATATTTCTAAATTATATTTGGCAAC
AATTCAGTCATTAATGTACGGATTTAAAGAAATTCTTGATCTGTTATTGA
AAAATTGTGTTGAAATAGATTCTATTGCTGTATGTGGAGGACTATCAAAA
AATTCTCTTTATTGTCGAGTTTTGGCTGATGTTTCTGGGTTGCCTGTTAT
GCTTATGCAAAATGAAGAACTTGTGTTACTTGGAGCAGCAAAGTTAAATA
TTTTACATTCTATTCAATTATTTCAAGAAAAGAAGTTTCGGACTGTAAGG
CGAATCGAACCTGATAATTCTCTTGCCAAATATCACAACCAAAAATATAA
AATTTATTCAAAAATTATTGATTTCCAAAGCGAATTGCAGAAACTGAAAT
CGAATTAATTACAATGAAAATATTAATATTTTAGTTTTCAAATATTTAGT
TGCCATATACATTTGAGTTACAATAACTA
back to top

protein sequence of SMED30007003-orf-1

>SMED30007003-orf-1 ID=SMED30007003-orf-1|Name=SMED30007003-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
LYKSYMYSYFIGVDVGSFSVRCGLFRTSDNETLELICKNEINIKVFKCEE
SIYEQSSDDIWTSVCKATRHLVLGSYIDPALIKGIGFDATCSLVALDKNG
HPLSVSQTSM*
back to top

protein sequence of SMED30007003-orf-2

>SMED30007003-orf-2 ID=SMED30007003-orf-2|Name=SMED30007003-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=424bp
MWMDLRAKDETKFINSLDLKALNTVGGKFSVEMQPPKLLWLKKNIPNFMD
NIGFLFDLPDFLVYRATGSNDRSLCSVTCKWAFDSVNFGWDKEFWKKCGL
SELCDNNFSIIGNNFLNPGSLISSGLSEIAAKELGLEHSIYVPASLIDAY
AGVLGAINMPKQLITIAGTSACHMIMTPKPIYIDGIWGPYKNVIKEDYYV
LEAGQTMVGNLLDRILELSDISMTHRQVIDQLIQEINETCGENEDIYNLS
SAHWHEMNVLAKDIHINPDFAGNRNPRSDTDIRGAIIGLNIDSSKSYISK
LYLATIQSLMYGFKEILDLLLKNCVEIDSIAVCGGLSKNSLYCRVLADVS
GLPVMLMQNEELVLLGAAKLNILHSIQLFQEKKFRTVRRIEPDNSLAKYH
NQKYKIYSKIIDFQSELQKLKSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR018484Carb_kinase_FGGY_N
IPR000577Carb_kinase_FGGY
IPR018485Carb_kinase_FGGY_C
Vocabulary: molecular function
TermDefinition
GO:0016773phosphotransferase activity, alcohol group as acceptor
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000577Carbohydrate kinase, FGGYPIRSFPIRSF000538GlpKcoord: 1..423
e-value: 2.5E-40
score: 135.9
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 157..421
e-value: 7.9E-56
score: 191.4
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 1..154
e-value: 6.7E-35
score: 123.0
NoneNo IPR availablePANTHERPTHR43435FAMILY NOT NAMEDcoord: 1..418
NoneNo IPR availablePANTHERPTHR43435:SF4FGGY CARBOHYDRATE KINASE DOMAIN-CONTAINING PROTEINcoord: 1..418
IPR018485Carbohydrate kinase, FGGY, C-terminalPFAMPF02782FGGY_Ccoord: 165..370
e-value: 1.8E-37
score: 129.0
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 160..416
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 1..156