SMED30007001

Overview
NameSMED30007001
Smed IDSMED30007001
Length (bp)545
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30007001 (SMED30007001) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30007001 (SMED30007001) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30007001 (SMED30007001) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30007001 (SMED30007001) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007001

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridial progenitor cellSMED30007001 SMED30007001smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30007001 dd_Smed_v4_537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30007001 dd_Smed_v4_537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007001 dd_Smed_v4_537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30007001 dd_Smed_v4_537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007001 dd_Smed_v4_537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007001 dd_Smed_v4_537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007001 dd_Smed_v4_537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007001 dd_Smed_v4_537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007001 dd_Smed_v4_537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007001 Contig35325newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007001 Contig35325uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30007001 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001776:58315..58957 -2605
Homology
BLAST of SMED30007001 vs. Ensembl Human
Match: LIMA1 (LIM domain and actin binding 1 [Source:HGNC Symbol;Acc:HGNC:24636])

HSP 1 Score: 67.3958 bits (163), Expect = 6.988e-13
Identity = 29/62 (46.77%), Postives = 38/62 (61.29%), Query Frame = -1
Query:   78 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 263
            E C  CQK+VY  ER+ A   ++H  CFRC+ C+  L L  YA   G +YCK HFN+L  +K
Sbjct:  389 ETCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSK 450          
BLAST of SMED30007001 vs. Ensembl Human
Match: LIMA1 (LIM domain and actin binding 1 [Source:HGNC Symbol;Acc:HGNC:24636])

HSP 1 Score: 67.3958 bits (163), Expect = 7.544e-13
Identity = 29/62 (46.77%), Postives = 38/62 (61.29%), Query Frame = -1
Query:   78 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 263
            E C  CQK+VY  ER+ A   ++H  CFRC+ C+  L L  YA   G +YCK HFN+L  +K
Sbjct:  229 ETCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSK 290          
BLAST of SMED30007001 vs. Ensembl Human
Match: LIMA1 (LIM domain and actin binding 1 [Source:HGNC Symbol;Acc:HGNC:24636])

HSP 1 Score: 67.0106 bits (162), Expect = 7.908e-13
Identity = 29/62 (46.77%), Postives = 38/62 (61.29%), Query Frame = -1
Query:   78 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 263
            E C  CQK+VY  ER+ A   ++H  CFRC+ C+  L L  YA   G +YCK HFN+L  +K
Sbjct:  227 ETCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSK 288          
BLAST of SMED30007001 vs. Ensembl Human
Match: LIMA1 (LIM domain and actin binding 1 [Source:HGNC Symbol;Acc:HGNC:24636])

HSP 1 Score: 67.3958 bits (163), Expect = 7.911e-13
Identity = 29/62 (46.77%), Postives = 38/62 (61.29%), Query Frame = -1
Query:   78 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 263
            E C  CQK+VY  ER+ A   ++H  CFRC+ C+  L L  YA   G +YCK HFN+L  +K
Sbjct:  388 ETCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSK 449          
BLAST of SMED30007001 vs. Ensembl Human
Match: LIMA1 (LIM domain and actin binding 1 [Source:HGNC Symbol;Acc:HGNC:24636])

HSP 1 Score: 67.0106 bits (162), Expect = 8.378e-13
Identity = 29/62 (46.77%), Postives = 38/62 (61.29%), Query Frame = -1
Query:   78 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 263
            E C  CQK+VY  ER+ A   ++H  CFRC+ C+  L L  YA   G +YCK HFN+L  +K
Sbjct:  228 ETCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSK 289          
BLAST of SMED30007001 vs. Ensembl Celegans
Match: mlp-1 (MLP/CRP family (Muscle LIM Protein/Cysteine-rich Protein) [Source:UniProtKB/TrEMBL;Acc:Q9GP96])

HSP 1 Score: 55.8398 bits (133), Expect = 1.134e-10
Identity = 27/61 (44.26%), Postives = 34/61 (55.74%), Query Frame = -1
Query:  105 MPFTST-NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKK 284
            MPF    + KC +C KSVYA E M AG   WH+ CF+C  C+  L     A  +  LYCK+
Sbjct:    1 MPFKPVEHPKCPKCGKSVYAAEEMSAGGYKWHKFCFKCNMCNKLLDSCTVAPHEAELYCKQ 61          
BLAST of SMED30007001 vs. Ensembl Celegans
Match: mlp-1 (MLP/CRP family (Muscle LIM Protein/Cysteine-rich Protein) [Source:UniProtKB/TrEMBL;Acc:Q9GP96])

HSP 1 Score: 55.8398 bits (133), Expect = 1.134e-10
Identity = 27/61 (44.26%), Postives = 34/61 (55.74%), Query Frame = -1
Query:  105 MPFTST-NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKK 284
            MPF    + KC +C KSVYA E M AG   WH+ CF+C  C+  L     A  +  LYCK+
Sbjct:    1 MPFKPVEHPKCPKCGKSVYAAEEMSAGGYKWHKFCFKCNMCNKLLDSCTVAPHEAELYCKQ 61          
BLAST of SMED30007001 vs. Ensembl Celegans
Match: mlp-1 (MLP/CRP family (Muscle LIM Protein/Cysteine-rich Protein) [Source:UniProtKB/TrEMBL;Acc:Q9GP96])

HSP 1 Score: 56.225 bits (134), Expect = 1.211e-10
Identity = 27/61 (44.26%), Postives = 34/61 (55.74%), Query Frame = -1
Query:  105 MPFTST-NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKK 284
            MPF    + KC +C KSVYA E M AG   WH+ CF+C  C+  L     A  +  LYCK+
Sbjct:    1 MPFKPVEHPKCPKCGKSVYAAEEMSAGGYKWHKFCFKCNMCNKLLDSCTVAPHEAELYCKQ 61          
BLAST of SMED30007001 vs. Ensembl Celegans
Match: mlp-1 (MLP/CRP family (Muscle LIM Protein/Cysteine-rich Protein) [Source:UniProtKB/TrEMBL;Acc:Q9GP96])

HSP 1 Score: 56.225 bits (134), Expect = 1.316e-10
Identity = 27/61 (44.26%), Postives = 34/61 (55.74%), Query Frame = -1
Query:  105 MPFTST-NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKK 284
            MPF    + KC +C KSVYA E M AG   WH+ CF+C  C+  L     A  +  LYCK+
Sbjct:    1 MPFKPVEHPKCPKCGKSVYAAEEMSAGGYKWHKFCFKCNMCNKLLDSCTVAPHEAELYCKQ 61          
BLAST of SMED30007001 vs. Ensembl Celegans
Match: mlp-1 (MLP/CRP family (Muscle LIM Protein/Cysteine-rich Protein) [Source:UniProtKB/TrEMBL;Acc:Q9GP96])

HSP 1 Score: 53.9138 bits (128), Expect = 9.508e-10
Identity = 25/61 (40.98%), Postives = 36/61 (59.02%), Query Frame = -1
Query:  105 MPFTST-NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKK 284
            MPF    + KC +C KSVYA E M AG   WH+ CF+C+ C+  L   +  + +  L+CK+
Sbjct:    1 MPFKPVEHPKCPKCGKSVYAAEEMSAGGYKWHKFCFKCSMCNKLLDSMSCCEHQAQLFCKQ 61          
BLAST of SMED30007001 vs. Ensembl Fly
Match: Lasp (gene:FBgn0063485 transcript:FBtr0306151)

HSP 1 Score: 56.225 bits (134), Expect = 2.044e-9
Identity = 23/68 (33.82%), Postives = 34/68 (50.00%), Query Frame = -1
Query:   63 NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKNTQTP 266
            N+ C RCQK VY  E ++     WH+ CF+C +C M+L +  Y     + YC+ H  +        TP
Sbjct:    2 NKTCARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYCEAHIPKAKATAIADTP 69          
BLAST of SMED30007001 vs. Ensembl Fly
Match: Mical (gene:FBgn0053208 transcript:FBtr0082208)

HSP 1 Score: 56.6102 bits (135), Expect = 2.073e-9
Identity = 23/62 (37.10%), Postives = 36/62 (58.06%), Query Frame = -1
Query:   99 STNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDK----GVLYCKKHF 272
            + +EKC+ C+++VY  E+     L+ HR C +C  C  +L+L  YA D+    G  YC +HF
Sbjct:  801 AASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHF 862          
BLAST of SMED30007001 vs. Ensembl Fly
Match: Mical (gene:FBgn0053208 transcript:FBtr0347214)

HSP 1 Score: 56.6102 bits (135), Expect = 2.081e-9
Identity = 23/62 (37.10%), Postives = 36/62 (58.06%), Query Frame = -1
Query:   99 STNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDK----GVLYCKKHF 272
            + +EKC+ C+++VY  E+     L+ HR C +C  C  +L+L  YA D+    G  YC +HF
Sbjct: 1069 AASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHF 1130          
BLAST of SMED30007001 vs. Ensembl Fly
Match: Mical (gene:FBgn0053208 transcript:FBtr0082207)

HSP 1 Score: 56.6102 bits (135), Expect = 2.081e-9
Identity = 23/62 (37.10%), Postives = 36/62 (58.06%), Query Frame = -1
Query:   99 STNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDK----GVLYCKKHF 272
            + +EKC+ C+++VY  E+     L+ HR C +C  C  +L+L  YA D+    G  YC +HF
Sbjct: 1069 AASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHF 1130          
BLAST of SMED30007001 vs. Ensembl Fly
Match: Mical (gene:FBgn0053208 transcript:FBtr0347211)

HSP 1 Score: 56.6102 bits (135), Expect = 2.082e-9
Identity = 23/62 (37.10%), Postives = 36/62 (58.06%), Query Frame = -1
Query:   99 STNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDK----GVLYCKKHF 272
            + +EKC+ C+++VY  E+     L+ HR C +C  C  +L+L  YA D+    G  YC +HF
Sbjct: 1069 AASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHF 1130          
BLAST of SMED30007001 vs. Ensembl Zebrafish
Match: limd2 (LIM domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-120906-1])

HSP 1 Score: 63.1586 bits (152), Expect = 5.537e-13
Identity = 29/68 (42.65%), Postives = 40/68 (58.82%), Query Frame = -1
Query:   75 FTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKN 278
            F +  E C  C+K+VY  ER+ A +LI+H  CF C  C+  L L +YA  +G  YCK HF +L  +K 
Sbjct:   20 FKTQKETCASCEKTVYPMERLVANNLIFHAACFCCKHCNTKLSLGSYAALQGEFYCKPHFQQLFKSKG 87          
BLAST of SMED30007001 vs. Ensembl Zebrafish
Match: xirp2a (xin actin binding repeat containing 2a [Source:ZFIN;Acc:ZDB-GENE-040108-7])

HSP 1 Score: 63.5438 bits (153), Expect = 1.123e-11
Identity = 27/63 (42.86%), Postives = 37/63 (58.73%), Query Frame = -1
Query:   78 NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 266
            +E CQ C+K VY  E + A    +H+ CFRCA C+  L L  YA   G +YCK H+ +L  +K
Sbjct:  263 SELCQVCRKRVYPMESLIADKQNFHKTCFRCAHCNSQLSLGTYASLHGRMYCKPHYKQLFKSK 325          
BLAST of SMED30007001 vs. Ensembl Zebrafish
Match: lima1a (LIM domain and actin binding 1a [Source:ZFIN;Acc:ZDB-GENE-001120-1])

HSP 1 Score: 62.003 bits (149), Expect = 2.741e-11
Identity = 28/62 (45.16%), Postives = 36/62 (58.06%), Query Frame = -1
Query:   78 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 263
            E C  C K+VY  E++ A   I+H  CFRCA C+  L L NYA     +YCK H+ +L  AK
Sbjct:  244 ETCVTCLKTVYPLEKLVANQQIYHNTCFRCAYCNTKLSLVNYASLHNNVYCKPHYCQLFKAK 305          
BLAST of SMED30007001 vs. Ensembl Zebrafish
Match: mical2b (microtubule associated monooxygenase, calponin and LIM domain containing 2b [Source:NCBI gene;Acc:569564])

HSP 1 Score: 57.3806 bits (137), Expect = 1.426e-9
Identity = 26/60 (43.33%), Postives = 35/60 (58.33%), Query Frame = -1
Query:   93 NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQD--KGVLYCKKHFNE 266
            ++ C  CQK VY  ER+ A    +HR CFRC  C  SL+L  +  D  +G  YCK HF++
Sbjct:  744 SDTCVFCQKRVYIMERLSAEGFFFHRECFRCHICGCSLRLGAHTFDSQQGTFYCKMHFSQ 803          
BLAST of SMED30007001 vs. Ensembl Zebrafish
Match: mical2b (microtubule associated monooxygenase, calponin and LIM domain containing 2b [Source:NCBI gene;Acc:569564])

HSP 1 Score: 57.3806 bits (137), Expect = 1.441e-9
Identity = 26/60 (43.33%), Postives = 35/60 (58.33%), Query Frame = -1
Query:   93 NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQD--KGVLYCKKHFNE 266
            ++ C  CQK VY  ER+ A    +HR CFRC  C  SL+L  +  D  +G  YCK HF++
Sbjct:  744 SDTCVFCQKRVYIMERLSAEGFFFHRECFRCHICGCSLRLGAHTFDSQQGTFYCKMHFSQ 803          
BLAST of SMED30007001 vs. Ensembl Xenopus
Match: lima1 (LIM domain and actin binding 1 [Source:NCBI gene;Acc:779798])

HSP 1 Score: 67.781 bits (164), Expect = 5.128e-13
Identity = 28/62 (45.16%), Postives = 38/62 (61.29%), Query Frame = -1
Query:   78 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 263
            E C  CQK+VY  ER+ A + ++H  CFRC+ C   L L  +A   G +YCK HFN+L  +K
Sbjct:  354 EVCFSCQKTVYPMERLFANNQVYHNGCFRCSHCSTKLSLGTFASLHGTVYCKPHFNQLFKSK 415          
BLAST of SMED30007001 vs. Ensembl Xenopus
Match: pde9a (phosphodiesterase 9A [Source:Xenbase;Acc:XB-GENE-5917012])

HSP 1 Score: 63.5438 bits (153), Expect = 2.419e-12
Identity = 28/55 (50.91%), Postives = 32/55 (58.18%), Query Frame = -1
Query:  108 STNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCK 272
               EKC RCQKSVYA ER+  G   WH+ CFRCA C  SL      +  G +YCK
Sbjct:  115 GATEKCPRCQKSVYAAERVMGGGQPWHKTCFRCAFCGKSLDSTTVTEKDGEIYCK 169          
BLAST of SMED30007001 vs. Ensembl Xenopus
Match: ENSXETT00000049904.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:64558417:64561350:-1 gene:ENSXETG00000020789.1 transcript:ENSXETT00000049904.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 2.151e-10
Identity = 28/66 (42.42%), Postives = 35/66 (53.03%), Query Frame = -1
Query:   75 STNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKN 272
               + C  CQK VY  E + A   I+H  CFRC+ C   L L NYA   G +YCK HF +L  +K 
Sbjct:    5 PPQDTCIICQKKVYPMECLVADKQIFHNSCFRCSHCSNKLSLGNYASLHGQIYCKAHFKQLFKSKG 70          
BLAST of SMED30007001 vs. Ensembl Xenopus
Match: limd2 (uncharacterized loc100145002 [Source:Xenbase;Acc:XB-GENE-5749128])

HSP 1 Score: 57.7658 bits (138), Expect = 3.087e-10
Identity = 28/67 (41.79%), Postives = 34/67 (50.75%), Query Frame = -1
Query:   75 TSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKN 275
             +  E C  CQK+VY  ER+ A   I+H  CF C  C   L L  YA   G  YCK HF +L  +K 
Sbjct:   82 PAVRELCSSCQKTVYPMERLVADKHIFHNSCFCCKHCSAKLSLGTYAALHGEFYCKPHFQQLFKSKG 148          
BLAST of SMED30007001 vs. Ensembl Xenopus
Match: csrp2 (cysteine and glycine rich protein 2 [Source:NCBI gene;Acc:549369])

HSP 1 Score: 56.6102 bits (135), Expect = 1.178e-9
Identity = 24/52 (46.15%), Postives = 33/52 (63.46%), Query Frame = -1
Query:  108 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCK 263
            EKC RC +SVYA E++      WH+ CFRCA+C  SL+     + +G +YCK
Sbjct:  120 EKCPRCNESVYAAEKIMGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCK 171          
BLAST of SMED30007001 vs. Ensembl Mouse
Match: Lima1 (LIM domain and actin binding 1 [Source:MGI Symbol;Acc:MGI:1920992])

HSP 1 Score: 67.3958 bits (163), Expect = 4.654e-13
Identity = 29/62 (46.77%), Postives = 38/62 (61.29%), Query Frame = -1
Query:   78 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 263
            E C  CQK+VY  ER+ A   ++H  CFRC+ C+  L L  YA   G +YCK HFN+L  +K
Sbjct:  386 ESCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSK 447          
BLAST of SMED30007001 vs. Ensembl Mouse
Match: Lima1 (LIM domain and actin binding 1 [Source:MGI Symbol;Acc:MGI:1920992])

HSP 1 Score: 67.0106 bits (162), Expect = 6.498e-13
Identity = 29/62 (46.77%), Postives = 38/62 (61.29%), Query Frame = -1
Query:   78 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 263
            E C  CQK+VY  ER+ A   ++H  CFRC+ C+  L L  YA   G +YCK HFN+L  +K
Sbjct:  226 ESCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSK 287          
BLAST of SMED30007001 vs. Ensembl Mouse
Match: Csrp3 (cysteine and glycine-rich protein 3 [Source:MGI Symbol;Acc:MGI:1330824])

HSP 1 Score: 62.3882 bits (150), Expect = 5.118e-12
Identity = 28/53 (52.83%), Postives = 33/53 (62.26%), Query Frame = -1
Query:  108 NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCK 266
            +EKC RC KSVYA E++  G   WH+ CFRCA C  SL+  N     G LYCK
Sbjct:  117 SEKCPRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKDGELYCK 169          
BLAST of SMED30007001 vs. Ensembl Mouse
Match: Csrp3 (cysteine and glycine-rich protein 3 [Source:MGI Symbol;Acc:MGI:1330824])

HSP 1 Score: 62.3882 bits (150), Expect = 5.118e-12
Identity = 28/53 (52.83%), Postives = 33/53 (62.26%), Query Frame = -1
Query:  108 NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCK 266
            +EKC RC KSVYA E++  G   WH+ CFRCA C  SL+  N     G LYCK
Sbjct:  117 SEKCPRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKDGELYCK 169          
BLAST of SMED30007001 vs. Ensembl Mouse
Match: Limd2 (LIM domain containing 2 [Source:MGI Symbol;Acc:MGI:1915053])

HSP 1 Score: 60.077 bits (144), Expect = 1.259e-11
Identity = 28/63 (44.44%), Postives = 35/63 (55.56%), Query Frame = -1
Query:   75 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKN 263
            E C  CQK+VY  ER+ A  LI+H  CF C  C   L L +YA   G  YC+ HF +L  +K 
Sbjct:   39 ETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAAMHGEFYCRPHFQQLFKSKG 101          
BLAST of SMED30007001 vs. UniProt/SwissProt
Match: sp|O04193|WLI2A_ARATH (LIM domain-containing protein WLIM2a OS=Arabidopsis thaliana OX=3702 GN=WLIN2A PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.331e-15
Identity = 32/79 (40.51%), Postives = 51/79 (64.56%), Query Frame = -1
Query:   63 MPFTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELI-----VAKNTQTP 284
            M FT T +KC+ C+K+VY  E + A  + +H+ CF+C+ C   L+L+NY+  +GV+YC+ HF +L       +KN Q+P
Sbjct:    1 MSFTGTQQKCRACEKTVYPVELLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYCRPHFEQLFKESGSFSKNFQSP 79          

HSP 2 Score: 61.2326 bits (147), Expect = 1.122e-10
Identity = 26/69 (37.68%), Postives = 41/69 (59.42%), Query Frame = -1
Query:   72 FTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKNT 278
            F+ T +KC  C K+VY  E++   S  +H+ CF+C+     +  +NYA  +G+LYCK HF +L   K +
Sbjct:  102 FSGTQDKCATCTKTVYPIEKVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGS 170          
BLAST of SMED30007001 vs. UniProt/SwissProt
Match: sp|Q9M047|WLI2B_ARATH (LIM domain-containing protein WLIM2b OS=Arabidopsis thaliana OX=3702 GN=WLIM2B PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.645e-15
Identity = 34/79 (43.04%), Postives = 50/79 (63.29%), Query Frame = -1
Query:   63 MPFTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELI-----VAKNTQTP 284
            M FT T +KC+ C+K+VYA E + A  + +H+ CF+C  C   L+L++Y+  +GVLYCK HF +L        KN Q+P
Sbjct:    1 MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPHFEQLFKESGSFNKNFQSP 79          

HSP 2 Score: 63.1586 bits (152), Expect = 1.982e-11
Identity = 27/69 (39.13%), Postives = 41/69 (59.42%), Query Frame = -1
Query:   72 FTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKNT 278
            F+ T EKC  C K+VY  E++   S  +H+ CF+C+     +  +NYA  +G+LYCK HF +L   K +
Sbjct:  101 FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGS 169          
BLAST of SMED30007001 vs. UniProt/SwissProt
Match: sp|Q94JX5|WLIM1_ARATH (LIM domain-containing protein WLIM1 OS=Arabidopsis thaliana OX=3702 GN=WLIM1 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.059e-13
Identity = 28/64 (43.75%), Postives = 43/64 (67.19%), Query Frame = -1
Query:   93 MPFTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNE 284
            M F  T +KC  C K+VY  +++ A + ++H+ CFRC  C  +LKL+NY   +GVLYC+ HF++
Sbjct:    1 MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHFDQ 64          

HSP 2 Score: 56.6102 bits (135), Expect = 4.389e-9
Identity = 25/68 (36.76%), Postives = 37/68 (54.41%), Query Frame = -1
Query:   75 FTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKN 278
            F  T EKC  C K+VY  E++     ++H+ CF+C     ++  +NY   +G LYCK H  +LI  K 
Sbjct:  103 FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKG 170          
BLAST of SMED30007001 vs. UniProt/SwissProt
Match: sp|P29675|SF3_HELAN (Pollen-specific protein SF3 OS=Helianthus annuus OX=4232 GN=SF3 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.462e-13
Identity = 27/64 (42.19%), Postives = 44/64 (68.75%), Query Frame = -1
Query:   87 FTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELI 278
            FT T +KC  C+K+VY  +++ A   ++H+ CFRC  C+ +LKL+N+    GV+YC+ HF++L 
Sbjct:    4 FTGTTQKCTVCEKTVYLVDKLVANQRVYHKACFRCHHCNSTLKLSNFNSFDGVVYCRHHFDQLF 67          

HSP 2 Score: 52.7582 bits (125), Expect = 1.716e-7
Identity = 25/67 (37.31%), Postives = 35/67 (52.24%), Query Frame = -1
Query:   78 FTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 278
            F  T +KC  C K VY  ER++     +HR CF+C     ++  +NY   +G LYCK H  +L   K
Sbjct:  103 FEGTRDKCNACAKIVYPIERVKVDGTAYHRACFKCCHGGCTISPSNYIAHEGRLYCKHHHIQLFKKK 169          
BLAST of SMED30007001 vs. UniProt/SwissProt
Match: sp|Q500W4|PLI2C_ARATH (LIM domain-containing protein PLIM2c OS=Arabidopsis thaliana OX=3702 GN=PLIM2C PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.374e-13
Identity = 32/76 (42.11%), Postives = 46/76 (60.53%), Query Frame = -1
Query:   66 FTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELI-----VAKNTQT 278
            FT T +KC+ C K+VY  + M    + +H+ CFRC+ C+ +L + NY+   GVLYCK HF +L       +KN QT
Sbjct:    4 FTGTTDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYCKTHFEQLFKESGNFSKNFQT 79          

HSP 2 Score: 63.929 bits (154), Expect = 1.467e-11
Identity = 29/68 (42.65%), Postives = 41/68 (60.29%), Query Frame = -1
Query:   75 FTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKN 278
            F+ T +KC  C+K+VY  E+M      +H+ CFRCA     L  ++YA   GVLYCK HF++L + K 
Sbjct:  100 FSGTQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALDGVLYCKVHFSQLFLEKG 167          
BLAST of SMED30007001 vs. TrEMBL
Match: A0A4S2KQY3 (LIM zinc-binding domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010787 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 5.020e-31
Identity = 55/76 (72.37%), Postives = 60/76 (78.95%), Query Frame = -1
Query:   60 MPFTST-NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKNTQTPI 284
            MPF     EKC RC KSVYANERMEAG  IWHRLCFRC+ CDMSL LNNYAQ   +LYCKKH+ E ++AKNTQTPI
Sbjct:    1 MPFVPPKTEKCVRCGKSVYANERMEAGDKIWHRLCFRCSVCDMSLNLNNYAQSDQILYCKKHYQENVLAKNTQTPI 76          
BLAST of SMED30007001 vs. TrEMBL
Match: G7Y2M9 (Cysteine and glycine-rich protein 3 OS=Clonorchis sinensis OX=79923 GN=Csrp3 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 5.020e-31
Identity = 55/76 (72.37%), Postives = 60/76 (78.95%), Query Frame = -1
Query:   60 MPFTST-NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKNTQTPI 284
            MPF     EKC RC KSVYANERMEAG  IWHRLCFRC+ CDMSL LNNYAQ   +LYCKKH+ E ++AKNTQTPI
Sbjct:    1 MPFVPPKTEKCVRCGKSVYANERMEAGDKIWHRLCFRCSVCDMSLNLNNYAQSDQILYCKKHYQENVLAKNTQTPI 76          
BLAST of SMED30007001 vs. TrEMBL
Match: A0A4E0RRF4 (Muscle LIM protein 1 OS=Fasciola hepatica OX=6192 GN=D915_000610 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.213e-30
Identity = 54/76 (71.05%), Postives = 60/76 (78.95%), Query Frame = -1
Query:   60 MPFTST-NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKNTQTPI 284
            MPF     EKC RC+KSVYANERMEAG  IWHRLCFRC+ CDM+L LNNY Q   VLYC KH+NE ++AKNTQTPI
Sbjct:    1 MPFVPPKTEKCVRCEKSVYANERMEAGDKIWHRLCFRCSVCDMALNLNNYKQSDQVLYCTKHYNENVLAKNTQTPI 76          
BLAST of SMED30007001 vs. TrEMBL
Match: A0A4S2KLP6 (LIM zinc-binding domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010787 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 3.187e-30
Identity = 55/75 (73.33%), Postives = 60/75 (80.00%), Query Frame = -1
Query:   60 MPFTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKNTQTPI 284
            MP T   EKC RC KSVYANERMEAG  IWHRLCFRC+ CDMSL LNNYAQ   +LYCKKH+ E ++AKNTQTPI
Sbjct:    1 MPKT---EKCVRCGKSVYANERMEAGDKIWHRLCFRCSVCDMSLNLNNYAQSDQILYCKKHYQENVLAKNTQTPI 72          
BLAST of SMED30007001 vs. TrEMBL
Match: A0A5J4P3I2 (LIM zinc-binding domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0004566 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.321e-28
Identity = 50/76 (65.79%), Postives = 60/76 (78.95%), Query Frame = -1
Query:   60 MPFTST-NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKNTQTPI 284
            MPF    +EKC RC KSVYANER+EAG  +WHRLCFRC+ C+MSL LNNY Q   +LYCKKH+ + ++AKNTQTPI
Sbjct:    1 MPFVPPKSEKCVRCSKSVYANERIEAGDKVWHRLCFRCSVCEMSLNLNNYNQSDQILYCKKHYQDHVLAKNTQTPI 76          
BLAST of SMED30007001 vs. Ensembl Cavefish
Match: limd2 (LIM domain containing 2 [Source:NCBI gene;Acc:103034267])

HSP 1 Score: 64.6994 bits (156), Expect = 1.280e-13
Identity = 29/68 (42.65%), Postives = 41/68 (60.29%), Query Frame = -1
Query:   75 FTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKN 278
            F + +E C  CQK+VY  ER+ A +LI+H +CF C  C+  L L  YA  +G  YCK H+ +L  +K 
Sbjct:   20 FKTPSETCAACQKTVYPMERLVANNLIFHTVCFCCKHCNAKLSLGTYAALQGEFYCKPHYQQLFKSKG 87          
BLAST of SMED30007001 vs. Ensembl Cavefish
Match: lima1a (LIM domain and actin binding 1a [Source:ZFIN;Acc:ZDB-GENE-001120-1])

HSP 1 Score: 66.6254 bits (161), Expect = 6.719e-13
Identity = 30/62 (48.39%), Postives = 36/62 (58.06%), Query Frame = -1
Query:   78 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 263
            E C  C K+VY  ER+ A   I+H  CFRCA C+  L L NYA     +YCK HF +L  AK
Sbjct:  311 ESCVMCLKTVYPLERLVANQQIYHNTCFRCAHCNTKLSLVNYASLHSTVYCKPHFCQLFKAK 372          
BLAST of SMED30007001 vs. Ensembl Cavefish
Match: mical2b (protein-methionine sulfoxide oxidase mical2b [Source:NCBI gene;Acc:103035944])

HSP 1 Score: 58.9214 bits (141), Expect = 3.061e-10
Identity = 26/65 (40.00%), Postives = 36/65 (55.38%), Query Frame = -1
Query:   93 PFTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYA--QDKGVLYCKKHFNE 281
            P    ++ C  C+K VY  ER+ A    +HR CFRC  C  +L+L  +A   D+G  YCK HF +
Sbjct:  780 PGVGGSDICHFCKKRVYVMERLSAEGYFFHRECFRCDVCSATLRLGGHAFDSDQGTFYCKLHFAQ 844          
BLAST of SMED30007001 vs. Ensembl Cavefish
Match: mical2b (protein-methionine sulfoxide oxidase mical2b [Source:NCBI gene;Acc:103035944])

HSP 1 Score: 58.9214 bits (141), Expect = 3.109e-10
Identity = 26/65 (40.00%), Postives = 36/65 (55.38%), Query Frame = -1
Query:   93 PFTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYA--QDKGVLYCKKHFNE 281
            P    ++ C  C+K VY  ER+ A    +HR CFRC  C  +L+L  +A   D+G  YCK HF +
Sbjct:  740 PGVGGSDICHFCKKRVYVMERLSAEGYFFHRECFRCDVCSATLRLGGHAFDSDQGTFYCKLHFAQ 804          
BLAST of SMED30007001 vs. Ensembl Cavefish
Match: mical2b (protein-methionine sulfoxide oxidase mical2b [Source:NCBI gene;Acc:103035944])

HSP 1 Score: 58.9214 bits (141), Expect = 3.115e-10
Identity = 26/65 (40.00%), Postives = 36/65 (55.38%), Query Frame = -1
Query:   93 PFTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYA--QDKGVLYCKKHFNE 281
            P    ++ C  C+K VY  ER+ A    +HR CFRC  C  +L+L  +A   D+G  YCK HF +
Sbjct:  751 PGVGGSDICHFCKKRVYVMERLSAEGYFFHRECFRCDVCSATLRLGGHAFDSDQGTFYCKLHFAQ 815          
BLAST of SMED30007001 vs. Ensembl Sea Lamprey
Match: csrp2 (cysteine and glycine-rich protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1863])

HSP 1 Score: 60.077 bits (144), Expect = 7.293e-12
Identity = 26/52 (50.00%), Postives = 31/52 (59.62%), Query Frame = -1
Query:  108 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCK 263
            EKC RC KSVYA ER+  G   WH+ CFRCA+C   L+        G +YCK
Sbjct:  121 EKCSRCDKSVYAAERVIGGGKPWHKQCFRCAKCGKGLESTTVTDKDGEIYCK 172          
BLAST of SMED30007001 vs. Ensembl Sea Lamprey
Match: csrp2 (cysteine and glycine-rich protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1863])

HSP 1 Score: 55.8398 bits (133), Expect = 2.319e-10
Identity = 24/52 (46.15%), Postives = 31/52 (59.62%), Query Frame = -1
Query:  108 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCK 263
            +KC RC +SVYA E++      WHR CFRC QC  SL+      + G +YCK
Sbjct:  118 DKCPRCSQSVYAAEKVMGAGKPWHRSCFRCKQCGKSLESTTLNDNDGEIYCK 169          
BLAST of SMED30007001 vs. Ensembl Sea Lamprey
Match: csrp2 (cysteine and glycine-rich protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1863])

HSP 1 Score: 55.8398 bits (133), Expect = 2.445e-10
Identity = 24/52 (46.15%), Postives = 31/52 (59.62%), Query Frame = -1
Query:  108 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCK 263
            +KC RC +SVYA E++      WHR CFRC QC  SL+      + G +YCK
Sbjct:  119 DKCPRCSQSVYAAEKVMGAGKPWHRSCFRCKQCGKSLESTTLNDNDGEIYCK 170          
BLAST of SMED30007001 vs. Ensembl Sea Lamprey
Match: csrp2 (cysteine and glycine-rich protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1863])

HSP 1 Score: 55.0694 bits (131), Expect = 5.029e-10
Identity = 24/69 (34.78%), Postives = 32/69 (46.38%), Query Frame = -1
Query:   72 FTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKNT 278
            F    + C RC K VYA E++      WH+ CFRCA+C   L+        G LYCK  + +    K  
Sbjct:  112 FGGAADACSRCTKPVYAAEKIVGAGKPWHKSCFRCAKCGKGLESTTVTDRDGELYCKGCYAKYFGPKGV 180          
BLAST of SMED30007001 vs. Ensembl Sea Lamprey
Match: mical3b (Danio rerio microtubule associated monooxygenase, calponin and LIM domain containing 3b (mical3b), mRNA. [Source:RefSeq mRNA;Acc:NM_001353875])

HSP 1 Score: 54.299 bits (129), Expect = 2.539e-9
Identity = 23/58 (39.66%), Postives = 34/58 (58.62%), Query Frame = -1
Query:   99 NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQD--KGVLYCKKHF 266
            ++ C  C + VY  ER+ A    +HR CF+C  CD++L+L  +A D   G  YCK H+
Sbjct:  758 SDTCYFCGRRVYVMERLSAEGKFFHRGCFKCNYCDVTLRLGAFAFDVEDGKFYCKPHY 815          
BLAST of SMED30007001 vs. Ensembl Nematostella
Match: EDO50008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF11])

HSP 1 Score: 67.3958 bits (163), Expect = 3.292e-15
Identity = 28/63 (44.44%), Postives = 42/63 (66.67%), Query Frame = -1
Query:   75 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKN 263
            EKC+ C K+VY  ER+ A   ++H+ CF+C +C+ +L+L NYA  +G +YCK HF +L   K 
Sbjct:   20 EKCEVCNKTVYPMERLAADKKVYHKFCFKCNECNNTLRLGNYAALQGKVYCKPHFKQLFKVKG 82          
BLAST of SMED30007001 vs. Ensembl Nematostella
Match: EDO28129 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7C3])

HSP 1 Score: 51.2174 bits (121), Expect = 1.615e-9
Identity = 21/52 (40.38%), Postives = 31/52 (59.62%), Query Frame = -1
Query:  111 NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYC 266
            N +C +C K+VY+ E++     IWH+ CFRC  C+M+L + NY       YC
Sbjct:    2 NPQCTKCAKTVYSQEKLNCLDKIWHKTCFRCVVCNMALNMKNYKGYNKNPYC 53          
BLAST of SMED30007001 vs. Ensembl Nematostella
Match: LASP3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI32])

HSP 1 Score: 54.299 bits (129), Expect = 1.920e-9
Identity = 22/56 (39.29%), Postives = 33/56 (58.93%), Query Frame = -1
Query:   99 NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHF 266
            N +C +C K+VY+ E++     IWH+ CFRC  C+M+L + NY       YC  H+
Sbjct:    2 NPQCTKCAKTVYSQEKLNCLDKIWHKTCFRCVVCNMALNMKNYKGYNKNPYCNAHY 57          
BLAST of SMED30007001 vs. Ensembl Nematostella
Match: LASP1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI30])

HSP 1 Score: 51.6026 bits (122), Expect = 1.709e-8
Identity = 20/56 (35.71%), Postives = 32/56 (57.14%), Query Frame = -1
Query:   99 NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHF 266
            N  C RC+K+VY  E++     +WH+ CF+C  C M+L +  Y   + + YC  H+
Sbjct:    2 NPPCARCRKTVYPVEKLSCLDKVWHKGCFKCESCGMTLNMKTYKGYQKLPYCDAHY 57          
BLAST of SMED30007001 vs. Ensembl Nematostella
Match: EDO32616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUJ7])

HSP 1 Score: 46.9802 bits (110), Expect = 9.606e-8
Identity = 19/50 (38.00%), Postives = 29/50 (58.00%), Query Frame = -1
Query:  111 KCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYC 260
            KC +C K VY  E++ +    WHR C RC +C+ +L   ++A+  G  YC
Sbjct:    3 KCPKCSKEVYFAEKVTSLGKDWHRPCLRCQKCNKTLSPGSHAEHGGKPYC 52          
BLAST of SMED30007001 vs. Ensembl Medaka
Match: lima1a (LIM domain and actin-binding protein 1 [Source:NCBI gene;Acc:101156656])

HSP 1 Score: 69.3218 bits (168), Expect = 8.572e-14
Identity = 30/62 (48.39%), Postives = 38/62 (61.29%), Query Frame = -1
Query:   78 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 263
            E C  CQK+VY  ER+ A   ++H  CFRC+ C+  L L NYA    V+YCK HF +L  AK
Sbjct:  269 ETCVTCQKTVYPLERLVANQHVYHSSCFRCSHCNTKLSLVNYASLHNVVYCKPHFCQLFKAK 330          
BLAST of SMED30007001 vs. Ensembl Medaka
Match: lima1a (LIM domain and actin-binding protein 1 [Source:NCBI gene;Acc:101156656])

HSP 1 Score: 68.9366 bits (167), Expect = 1.086e-13
Identity = 30/62 (48.39%), Postives = 38/62 (61.29%), Query Frame = -1
Query:   78 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 263
            E C  CQK+VY  ER+ A   ++H  CFRC+ C+  L L NYA    V+YCK HF +L  AK
Sbjct:  292 ETCVTCQKTVYPLERLVANQHVYHSSCFRCSHCNTKLSLVNYASLHNVVYCKPHFCQLFKAK 353          
BLAST of SMED30007001 vs. Ensembl Medaka
Match: lima1a (LIM domain and actin-binding protein 1 [Source:NCBI gene;Acc:101156656])

HSP 1 Score: 68.5514 bits (166), Expect = 1.338e-13
Identity = 30/62 (48.39%), Postives = 38/62 (61.29%), Query Frame = -1
Query:   78 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 263
            E C  CQK+VY  ER+ A   ++H  CFRC+ C+  L L NYA    V+YCK HF +L  AK
Sbjct:  354 ETCVTCQKTVYPLERLVANQHVYHSSCFRCSHCNTKLSLVNYASLHNVVYCKPHFCQLFKAK 415          
BLAST of SMED30007001 vs. Ensembl Medaka
Match: ENSORLT00000019196.2 (LIM domain and actin-binding protein 1 [Source:NCBI gene;Acc:101163320])

HSP 1 Score: 63.5438 bits (153), Expect = 8.390e-12
Identity = 28/62 (45.16%), Postives = 38/62 (61.29%), Query Frame = -1
Query:   78 EKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAK 263
            E C  CQK+V+  ER+ +   ++H+ CFRC  C+  L L NYA   G  YCK HF++L  AK
Sbjct:  285 EVCVVCQKTVFQLERLMSHQHVYHKHCFRCFHCNTKLSLMNYASLHGNNYCKPHFSQLFKAK 346          
BLAST of SMED30007001 vs. Ensembl Medaka
Match: limd2 (LIM domain containing 2 [Source:NCBI gene;Acc:101173786])

HSP 1 Score: 57.3806 bits (137), Expect = 8.549e-11
Identity = 26/68 (38.24%), Postives = 37/68 (54.41%), Query Frame = -1
Query:   75 FTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKN 278
            F +  E C  C+K+VY  ER+ A   ++H  CF C  C+  L L  +A  +G  YCK HF +L  +K 
Sbjct:   21 FKTQKEVCTSCEKTVYPMERLVANDQVFHLSCFCCKHCNAKLSLGTFAALQGEFYCKPHFQQLFKSKG 88          
BLAST of SMED30007001 vs. Planmine SMEST
Match: SMESG000072162.1 (SMESG000072162.1)

HSP 1 Score: 160.999 bits (406), Expect = 6.456e-52
Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = -1
Query:   60 MPFTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKNTQTPI 284
            MPFTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKNTQTPI
Sbjct:    1 MPFTSTNEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKNTQTPI 75          
BLAST of SMED30007001 vs. Planmine SMEST
Match: SMESG000002154.1 (SMESG000002154.1)

HSP 1 Score: 58.5362 bits (140), Expect = 9.802e-11
Identity = 25/68 (36.76%), Postives = 36/68 (52.94%), Query Frame = -1
Query:   63 NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELIVAKNTQTP 266
            N  C RC K+VY  E++      WH++CF+C QCD++L + NY     + YC  H+        T TP
Sbjct:    2 NPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTP 69          
BLAST of SMED30007001 vs. Planmine SMEST
Match: SMESG000026096.1 (SMESG000026096.1)

HSP 1 Score: 58.5362 bits (140), Expect = 2.598e-10
Identity = 25/57 (43.86%), Postives = 36/57 (63.16%), Query Frame = -1
Query:   87 CQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELI 257
            C  C + VY  E++   +L++HR CF+C +C   L +NN+A + G LYCK HF EL 
Sbjct:  205 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELF 261          
BLAST of SMED30007001 vs. Planmine SMEST
Match: SMESG000049512.1 (SMESG000049512.1)

HSP 1 Score: 48.1358 bits (113), Expect = 4.746e-7
Identity = 20/54 (37.04%), Postives = 33/54 (61.11%), Query Frame = -1
Query:  105 NEKCQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKK 266
            +E C +C+K+VYA E+  A + +WH +C +C  C+  L     A+ +  LYCK+
Sbjct:    2 SEICPKCKKAVYAAEKKLAANKVWHSMCLKCGMCNKMLDSTTVAEHENELYCKQ 55          
BLAST of SMED30007001 vs. Planmine SMEST
Match: SMESG000001219.1 (SMESG000001219.1)

HSP 1 Score: 48.1358 bits (113), Expect = 9.578e-7
Identity = 19/56 (33.93%), Postives = 31/56 (55.36%), Query Frame = -1
Query:   90 CQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNEL 257
            C  C+  +Y  E++     ++H+ CFRC++C   L + N+      +YCK HF EL
Sbjct:   92 CLICESKIYPMEKLTVDGRLYHKGCFRCSKCKTVLSVTNFNLSNNSIYCKIHFMEL 147          
The following BLAST results are available for this feature:
BLAST of SMED30007001 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LIMA16.988e-1346.77LIM domain and actin binding 1 [Source:HGNC Symbol... [more]
LIMA17.544e-1346.77LIM domain and actin binding 1 [Source:HGNC Symbol... [more]
LIMA17.908e-1346.77LIM domain and actin binding 1 [Source:HGNC Symbol... [more]
LIMA17.911e-1346.77LIM domain and actin binding 1 [Source:HGNC Symbol... [more]
LIMA18.378e-1346.77LIM domain and actin binding 1 [Source:HGNC Symbol... [more]
back to top
BLAST of SMED30007001 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mlp-11.134e-1044.26MLP/CRP family (Muscle LIM Protein/Cysteine-rich P... [more]
mlp-11.134e-1044.26MLP/CRP family (Muscle LIM Protein/Cysteine-rich P... [more]
mlp-11.211e-1044.26MLP/CRP family (Muscle LIM Protein/Cysteine-rich P... [more]
mlp-11.316e-1044.26MLP/CRP family (Muscle LIM Protein/Cysteine-rich P... [more]
mlp-19.508e-1040.98MLP/CRP family (Muscle LIM Protein/Cysteine-rich P... [more]
back to top
BLAST of SMED30007001 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lasp2.044e-933.82gene:FBgn0063485 transcript:FBtr0306151[more]
Mical2.073e-937.10gene:FBgn0053208 transcript:FBtr0082208[more]
Mical2.081e-937.10gene:FBgn0053208 transcript:FBtr0347214[more]
Mical2.081e-937.10gene:FBgn0053208 transcript:FBtr0082207[more]
Mical2.082e-937.10gene:FBgn0053208 transcript:FBtr0347211[more]
back to top
BLAST of SMED30007001 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
limd25.537e-1342.65LIM domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
xirp2a1.123e-1142.86xin actin binding repeat containing 2a [Source:ZFI... [more]
lima1a2.741e-1145.16LIM domain and actin binding 1a [Source:ZFIN;Acc:Z... [more]
mical2b1.426e-943.33microtubule associated monooxygenase, calponin and... [more]
mical2b1.441e-943.33microtubule associated monooxygenase, calponin and... [more]
back to top
BLAST of SMED30007001 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lima15.128e-1345.16LIM domain and actin binding 1 [Source:NCBI gene;A... [more]
pde9a2.419e-1250.91phosphodiesterase 9A [Source:Xenbase;Acc:XB-GENE-5... [more]
ENSXETT00000049904.12.151e-1042.42pep primary_assembly:Xenopus_tropicalis_v9.1:9:645... [more]
limd23.087e-1041.79uncharacterized loc100145002 [Source:Xenbase;Acc:X... [more]
csrp21.178e-946.15cysteine and glycine rich protein 2 [Source:NCBI g... [more]
back to top
BLAST of SMED30007001 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lima14.654e-1346.77LIM domain and actin binding 1 [Source:MGI Symbol;... [more]
Lima16.498e-1346.77LIM domain and actin binding 1 [Source:MGI Symbol;... [more]
Csrp35.118e-1252.83cysteine and glycine-rich protein 3 [Source:MGI Sy... [more]
Csrp35.118e-1252.83cysteine and glycine-rich protein 3 [Source:MGI Sy... [more]
Limd21.259e-1144.44LIM domain containing 2 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of SMED30007001 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O04193|WLI2A_ARATH1.331e-1540.51LIM domain-containing protein WLIM2a OS=Arabidopsi... [more]
sp|Q9M047|WLI2B_ARATH1.645e-1543.04LIM domain-containing protein WLIM2b OS=Arabidopsi... [more]
sp|Q94JX5|WLIM1_ARATH1.059e-1343.75LIM domain-containing protein WLIM1 OS=Arabidopsis... [more]
sp|P29675|SF3_HELAN3.462e-1342.19Pollen-specific protein SF3 OS=Helianthus annuus O... [more]
sp|Q500W4|PLI2C_ARATH6.374e-1342.11LIM domain-containing protein PLIM2c OS=Arabidopsi... [more]
back to top
BLAST of SMED30007001 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2KQY35.020e-3172.37LIM zinc-binding domain-containing protein OS=Opis... [more]
G7Y2M95.020e-3172.37Cysteine and glycine-rich protein 3 OS=Clonorchis ... [more]
A0A4E0RRF41.213e-3071.05Muscle LIM protein 1 OS=Fasciola hepatica OX=6192 ... [more]
A0A4S2KLP63.187e-3073.33LIM zinc-binding domain-containing protein OS=Opis... [more]
A0A5J4P3I21.321e-2865.79LIM zinc-binding domain-containing protein OS=Para... [more]
back to top
BLAST of SMED30007001 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
limd21.280e-1342.65LIM domain containing 2 [Source:NCBI gene;Acc:1030... [more]
lima1a6.719e-1348.39LIM domain and actin binding 1a [Source:ZFIN;Acc:Z... [more]
mical2b3.061e-1040.00protein-methionine sulfoxide oxidase mical2b [Sour... [more]
mical2b3.109e-1040.00protein-methionine sulfoxide oxidase mical2b [Sour... [more]
mical2b3.115e-1040.00protein-methionine sulfoxide oxidase mical2b [Sour... [more]
back to top
BLAST of SMED30007001 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csrp27.293e-1250.00cysteine and glycine-rich protein 2 [Source:ZFIN;A... [more]
csrp22.319e-1046.15cysteine and glycine-rich protein 2 [Source:ZFIN;A... [more]
csrp22.445e-1046.15cysteine and glycine-rich protein 2 [Source:ZFIN;A... [more]
csrp25.029e-1034.78cysteine and glycine-rich protein 2 [Source:ZFIN;A... [more]
mical3b2.539e-939.66Danio rerio microtubule associated monooxygenase, ... [more]
back to top
BLAST of SMED30007001 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30007001 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO500083.292e-1544.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281291.615e-940.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LASP31.920e-939.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LASP11.709e-835.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326169.606e-838.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30007001 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lima1a8.572e-1448.39LIM domain and actin-binding protein 1 [Source:NCB... [more]
lima1a1.086e-1348.39LIM domain and actin-binding protein 1 [Source:NCB... [more]
lima1a1.338e-1348.39LIM domain and actin-binding protein 1 [Source:NCB... [more]
ENSORLT00000019196.28.390e-1245.16LIM domain and actin-binding protein 1 [Source:NCB... [more]
limd28.549e-1138.24LIM domain containing 2 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of SMED30007001 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072162.16.456e-52100.00SMESG000072162.1[more]
SMESG000002154.19.802e-1136.76SMESG000002154.1[more]
SMESG000026096.12.598e-1043.86SMESG000026096.1[more]
SMESG000049512.14.746e-737.04SMESG000049512.1[more]
SMESG000001219.19.578e-733.93SMESG000001219.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007001 ID=SMED30007001|Name=SMED30007001|organism=Schmidtea mediterranea sexual|type=transcript|length=545bp
TNTTTTTGACAATAGATATTTTATATTAAAAACCACATTTAGTAGCATCT
AATCAATTAAATCGGTGTTTGTGTATTTTTAGCAACTATCAATTCATTGA
AATGTTTCTTGCAATATAAAACTCCCTTGTCCTGGGCGTAATTATTCAGT
TTCAATGACATGTCACATTGAGCACATCGAAAACAAAGTCTGTGCCAAAT
TAAACTCCCAGCTTCCATTCTTTCATTAGCATAGACAGATTTCTGGCATC
TTTGACATTTCTCGTTGGTTGATGTAAACGGCATTGAGATTGTACTTGAG
ACTGTAATTGATCGAACTGAAGGAAATTCGACATTTTGAAGTAGTTATAC
TTGTAATTCAATGCTGACTCACAACATGATTTTCTGCATAATGATTGGAT
AATACGTGTTTGTNCGTGTGCGCATGTCTACATTTACGCTTGCAGTCTCT
TTCACAGGCCGACTATGTGCACTCCTTTCCAATACAATTACTGTGTAATT
TTTGTTTACAAATATTAGTTCAAAATAAATTCGGTTCATACGGAG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000011protonephridial progenitor cell
PLANA:0000020protonephridia
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR001781Znf_LIM
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 9..61
e-value: 4.8E-13
score: 59.3
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 10..64
e-value: 7.7E-13
score: 48.5
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 10..44
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 8..68
score: 13.434
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 3..69
e-value: 3.8E-20
score: 73.4
NoneNo IPR availablePANTHERPTHR24206FAMILY NOT NAMEDcoord: 3..68
NoneNo IPR availableCDDcd09358LIM_Mical_likecoord: 10..62
e-value: 1.7911E-19
score: 71.5309
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 3..35
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 36..70