SMED30006990

Overview
NameSMED30006990
Smed IDSMED30006990
Length (bp)4099
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30006990 (SMED30006990) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30006990 (SMED30006990) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30006990 (SMED30006990) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30006990 (SMED30006990) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006990

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30006990 dd_Smed_v4_9735_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30006990 dd_Smed_v4_9735_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006990 dd_Smed_v4_9735_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006990 dd_Smed_v4_9735_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30006990 dd_Smed_v4_9735_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30006990 dd_Smed_v4_9735_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30006990 dd_Smed_v6_9735_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30006990 dd_Smed_v6_9735_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30006990 vs. Planmine SMEST
Match: SMESG000072682.1 (SMESG000072682.1)

HSP 1 Score: 251.906 bits (642), Expect = 4.823e-71
Identity = 137/181 (75.69%), Postives = 158/181 (87.29%), Query Frame = -2
Query: 1789 DMQAKINLQERREENLRKFTTVKVNQLTKAQNALRKINEDKEQSDLQVEIEIQRLNYAERDVNRYKVMCEQSDIALHRQKALRESXXXXXXXXXXXVQTEIERLKTWENTTMLEAEVEDLLDQVIQLSYLLDKELCTSRTLEARINEFMNTPQMIWLPLLPI--TTTSRSHQATKGVEEFK 2325
            D+QAK+NLQER+EENLR  TT KVNQL K QNALRKINEDKE+SDLQVEIE QRLNYAERDVN YKVMCEQ D+ALHRQK+LRES+KEVFEVKVKE+QTEIERLK  ENTTMLE+EVEDL+DQV QLSYLLD+ELCTSRT++ RINEFM+TPQMIWLPL+P+     +  ++   G++E K
Sbjct:  125 DLQAKLNLQERKEENLRNVTTDKVNQLKKTQNALRKINEDKEKSDLQVEIERQRLNYAERDVNGYKVMCEQMDLALHRQKSLRESKKEVFEVKVKEMQTEIERLKIRENTTMLESEVEDLIDQVNQLSYLLDEELCTSRTIQVRINEFMSTPQMIWLPLVPMPQPQVTPGNEGCGGIQETK 305          

HSP 2 Score: 174.481 bits (441), Expect = 1.379e-58
Identity = 104/124 (83.87%), Postives = 114/124 (91.94%), Query Frame = -1
Query: 1211 KMNEQIDETTMEVETSETIDKKDVCIKPIKIEVENEDQIPRECKIXXXXXXXXXXXXXXXXNMRIAIEQQRQEIDRITNQWFQSRNLIKALKREFQLSDTKRRELKEENKSLNQKLKLNRKWEK 1582
            KMNEQ++ETTMEVETSET DKKDV IKPIKIEVENEDQIP+ECKIEE T+NEN EQEE IENM++ IEQQRQEID ITNQWFQSRNLIKALK EFQL+  KRRELKEEN+SLNQKLKLNR+WE+
Sbjct:  305 KMNEQMNETTMEVETSETTDKKDVRIKPIKIEVENEDQIPKECKIEELTDNENIEQEERIENMKMTIEQQRQEIDSITNQWFQSRNLIKALKTEFQLAAIKRRELKEENRSLNQKLKLNREWEQ 428          

HSP 3 Score: 73.559 bits (179), Expect = 1.379e-58
Identity = 47/57 (82.46%), Postives = 52/57 (91.23%), Query Frame = -3
Query: 1044 KNVNEFKGELANKWANHVLEDYWKKEAQXXXXXXXXXXXRNPAYKKLETHAVKQFQK 1214
            +NV+E KGELANKWANHVL+DY KKEAQRIKKKYYRIKR N  YKKLET+AVKQ+QK
Sbjct:  428 QNVDELKGELANKWANHVLKDYLKKEAQRIKKKYYRIKRLNREYKKLETYAVKQYQK 484          

HSP 4 Score: 111.309 bits (277), Expect = 1.142e-24
Identity = 96/120 (80.00%), Postives = 106/120 (88.33%), Query Frame = -2
Query: 2893 MCEINQEQKWKTNYERXXXXXXXXXXXXXXXXXQKLSNRVAKEVWEGAKRQTAYNSEVIDAAYARCLTERERQKVRKLQTQVEEQGTEITHXXXXXX-XXXXXXXXXXXXXXXKIDYFGE 3249
            MCEI+Q+ KWKTNYERVLLELLNQNNNQ ENE+QKLSNRVAK       RQTAY+SEVIDAAY RCLTERE+QKVRKL+TQVE+QGTEITHE ++   LNKKVEELKDKL+EVKIDYFGE
Sbjct:    1 MCEIDQKLKWKTNYERVLLELLNQNNNQLENEIQKLSNRVAK-------RQTAYHSEVIDAAYVRCLTEREKQKVRKLKTQVEKQGTEITHEKVMVELLNKKVEELKDKLEEVKIDYFGE 113          
BLAST of SMED30006990 vs. Planmine SMEST
Match: SMESG000072682.1 (SMESG000072682.1)

HSP 1 Score: 251.521 bits (641), Expect = 5.537e-71
Identity = 137/181 (75.69%), Postives = 158/181 (87.29%), Query Frame = -2
Query: 1789 DMQAKINLQERREENLRKFTTVKVNQLTKAQNALRKINEDKEQSDLQVEIEIQRLNYAERDVNRYKVMCEQSDIALHRQKALRESXXXXXXXXXXXVQTEIERLKTWENTTMLEAEVEDLLDQVIQLSYLLDKELCTSRTLEARINEFMNTPQMIWLPLLPI--TTTSRSHQATKGVEEFK 2325
            D+QAK+NLQER+EENLR  TT KVNQL K QNALRKINEDKE+SDLQVEIE QRLNYAERDVN YKVMCEQ D+ALHRQK+LRES+KEVFEVKVKE+QTEIERLK  ENTTMLE+EVEDL+DQV QLSYLLD+ELCTSRT++ RINEFM+TPQMIWLPL+P+     +  ++   G++E K
Sbjct:  125 DLQAKLNLQERKEENLRNVTTDKVNQLKKTQNALRKINEDKEKSDLQVEIERQRLNYAERDVNGYKVMCEQMDLALHRQKSLRESKKEVFEVKVKEMQTEIERLKIRENTTMLESEVEDLIDQVNQLSYLLDEELCTSRTIQVRINEFMSTPQMIWLPLVPMPQPQVTPGNEGCGGIQETK 305          

HSP 2 Score: 174.481 bits (441), Expect = 1.273e-55
Identity = 104/124 (83.87%), Postives = 114/124 (91.94%), Query Frame = -1
Query: 1211 KMNEQIDETTMEVETSETIDKKDVCIKPIKIEVENEDQIPRECKIXXXXXXXXXXXXXXXXNMRIAIEQQRQEIDRITNQWFQSRNLIKALKREFQLSDTKRRELKEENKSLNQKLKLNRKWEK 1582
            KMNEQ++ETTMEVETSET DKKDV IKPIKIEVENEDQIP+ECKIEE T+NEN EQEE IENM++ IEQQRQEID ITNQWFQSRNLIKALK EFQL+  KRRELKEEN+SLNQKLKLNR+WE+
Sbjct:  305 KMNEQMNETTMEVETSETTDKKDVRIKPIKIEVENEDQIPKECKIEELTDNENIEQEERIENMKMTIEQQRQEIDSITNQWFQSRNLIKALKTEFQLAAIKRRELKEENRSLNQKLKLNREWEQ 428          

HSP 3 Score: 63.929 bits (154), Expect = 1.273e-55
Identity = 42/51 (82.35%), Postives = 46/51 (90.20%), Query Frame = -3
Query: 1062 KNVNEFKGELANKWANHVLEDYWKKEAQXXXXXXXXXXXRNPAYKKLETHA 1214
            +NV+E KGELANKWANHVL+DY KKEAQRIKKKYYRIKR N  YKKLET+A
Sbjct:  428 QNVDELKGELANKWANHVLKDYLKKEAQRIKKKYYRIKRLNREYKKLETYA 478          

HSP 4 Score: 111.309 bits (277), Expect = 1.152e-24
Identity = 96/120 (80.00%), Postives = 106/120 (88.33%), Query Frame = -2
Query: 2893 MCEINQEQKWKTNYERXXXXXXXXXXXXXXXXXQKLSNRVAKEVWEGAKRQTAYNSEVIDAAYARCLTERERQKVRKLQTQVEEQGTEITHXXXXXX-XXXXXXXXXXXXXXXKIDYFGE 3249
            MCEI+Q+ KWKTNYERVLLELLNQNNNQ ENE+QKLSNRVAK       RQTAY+SEVIDAAY RCLTERE+QKVRKL+TQVE+QGTEITHE ++   LNKKVEELKDKL+EVKIDYFGE
Sbjct:    1 MCEIDQKLKWKTNYERVLLELLNQNNNQLENEIQKLSNRVAK-------RQTAYHSEVIDAAYVRCLTEREKQKVRKLKTQVEKQGTEITHEKVMVELLNKKVEELKDKLEEVKIDYFGE 113          
BLAST of SMED30006990 vs. Planmine SMEST
Match: SMESG000003311.1 (SMESG000003311.1)

HSP 1 Score: 111.309 bits (277), Expect = 1.779e-26
Identity = 70/146 (47.95%), Postives = 99/146 (67.81%), Query Frame = -2
Query: 1885 MQAKINLQERREENLRKFTTVKVNQLTKAQNALRKINEDKEQSDLQVEIEIQRLNYAERDVNRYKVMCEQSDIALHRQKALRESXXXXXXXXXXXVQTEIERLKTWENTTMLEAEVEDLLDQVIQLSYLLDKELCTSRTLEARINE 2322
            MQ ++   + REE+ +    ++ N++T AQ   RK++   EQ+ LQVEIE  RL +AERDV  YK MCE+ DI L RQKA  E++KE  + KV+ +++++ERLK  ENTTML+ EVEDL  +V QLSY+LD E+ T++ L    NE
Sbjct:    1 MQKQLKKAKEREEDSKLILAIRENEITVAQRTFRKLSGLNEQNQLQVEIEHSRLEHAERDVVGYKDMCEKRDITLQRQKAQWENKKEALKTKVRNLESDVERLKAHENTTMLKKEVEDLTGKVNQLSYMLDGEMATTQELRENENE 146          
BLAST of SMED30006990 vs. Planmine SMEST
Match: SMESG000002488.1 (SMESG000002488.1)

HSP 1 Score: 115.546 bits (288), Expect = 8.641e-26
Identity = 61/145 (42.07%), Postives = 102/145 (70.34%), Query Frame = -2
Query: 3265 MNIKEMSIEVRTDLPVMMMMQIMNDKTSKAILIKNEEMETINRIEVETRKCEMMWSQIHEGRENQEDL-NAKQNNNIMCRIKEIYEEGIKEFEKLVTKKLEQGIREEKRRYVLQQTAIIQKTETEKFQEKAEWWEKKTHEKDEQL 3696
            MN ++M I+VR D+P +M++++MN++ ++AILIKN+  ETINRI++E  + ++M  Q+ E  +N  +    K ++   C  K+IY++ + E ++++  K E  +   K+RY+LQQT+ +QK ETE ++ +AEWWEKKT EKDEQ+
Sbjct:    1 MNTEQMIIDVRVDIPTLMVIKLMNNEGNRAILIKNDATETINRIKIEMGRHKVMMKQLRERTKNIYNHQTIKLHDRANC--KKIYKKDMAEMKEMIESKTENDVGAAKKRYILQQTSTVQKAETENYKWQAEWWEKKTKEKDEQV 143          
BLAST of SMED30006990 vs. Planmine SMEST
Match: SMESG000009758.1 (SMESG000009758.1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.098e-18
Identity = 68/133 (51.13%), Postives = 92/133 (69.17%), Query Frame = -1
Query: 1187 IDETTMEVETSETIDKKDVCIKPIKIEVENEDQIPRECKIXXXXXXXXXXXXXXX------XNMRIAIEQQRQEIDRITNQWFQSRNLIKALKREFQLSDTKRRELKEENKSLNQKLKLNRKWEKM*MNLKAN 1567
            I+ TT+EVE+ ET   +   IKP+K+EVENE  I  +CKIEES E E+  + E        +NM+IA+EQQ QEID +TNQWFQSRNLIKALKRE  +   +R+E+++ENK L Q +++N+ WE+    LK N
Sbjct:  496 IELTTIEVESGETTINEG--IKPLKMEVENEFPISMKCKIEESMEVESSMEVESSEQEEMIKNMKIAMEQQIQEIDCMTNQWFQSRNLIKALKRERDVLKRQRKEVEDENKWLKQNIEVNKGWEEGIEELKPN 626          

HSP 2 Score: 83.9593 bits (206), Expect = 3.794e-16
Identity = 56/117 (47.86%), Postives = 77/117 (65.81%), Query Frame = -2
Query: 1954 LQERREENLRKFTTVKVNQLTKAQNALRKINEDKEQSDLQVEIEIQRLNYAERDVNRYKVMCEQSDIALHRQKALRESXXXXXXXXXXXVQTEIERLKTWENTTMLEAEVEDLLDQV 2304
            L+E REE+ +    ++ N++T AQ   RK +   EQ+ LQVEIE     +AERD+  YK MCE+ DI L RQKA  E++ E  E KV+ +++E+ERLK  ENTTML+ EVEDL   +
Sbjct:  380 LKEEREEDSKLILAIQENEITVAQRTFRKRSGLNEQNQLQVEIEQLHPEHAERDLIGYKDMCEKRDIGLQRQKAQWENKNEALETKVRNLESEVERLKAHENTTMLKKEVEDLTGTI 496          
The following BLAST results are available for this feature:
BLAST of SMED30006990 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006990 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006990 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006990 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006990 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006990 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006990 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006990 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006990 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006990 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006990 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006990 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006990 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006990 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072682.14.823e-7175.69SMESG000072682.1[more]
SMESG000072682.15.537e-7175.69SMESG000072682.1[more]
SMESG000003311.11.779e-2647.95SMESG000003311.1[more]
SMESG000002488.18.641e-2642.07SMESG000002488.1[more]
SMESG000009758.11.098e-1851.13SMESG000009758.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006990 ID=SMED30006990|Name=SMED30006990|organism=Schmidtea mediterranea sexual|type=transcript|length=4099bp
TTTGGCCGACACATTCATATACTTATAACACACAAAAAATATTTCTTTTA
TACATTAATATGACAGAGTGAGGTTAATTTACAAATTAAGGAAGGACATC
ACATAAGGTGATTTGTCTTATTTACATCATCATTTTTTTTTACATAATTG
TTTTCATCATATCATTGTAGTTATTATCAGTTGTTCACATATGTATATAC
ATATCTGAATTCGATGTTAATGGCTTGGATCACGAATGTCATCTTGATTT
GGTTGCTTTGGTAGATTTTTGATTGTTTTTTTTGATTGGGGGGGGGTTGA
TTTCTGGTAGGTTGAAGTAATGAAGATTTTTTGTTTGAGTTCTCGTAAAC
TTGATGGTTTGGTTTGGGTTTTGTCTTGCATGGTGCTTTCTTTGTCTTTT
TGACTTTCGATAGATTTTTATGATTAGGGTGATTATTATTATTATTAAGA
TTGCACTGGTCTCGACGACTGCCAGGCTTATTAGGAATATTTCGAAGTTG
CTTGGTTTCGGATTTTCTGTGATTTGGTGGGGTGGAGAAGTTGTTATTGT
CAAGAGTTCTTCGAGATGACTCAGCTGGATTATTTTCTGTAATAGTTGAT
GATTAATGTCTTTGCAAGAAGGTTTCATGAGGTTTTGATTTCGGGTTAGT
CTTAATTCGATCTTCATTATTTTTATTCTTCTAAGGGCTTCTGTTTGATC
TCGCATCTGCCTTCGGTTGTCTCTCAATGAGGTTATCTTTGGGTGTAAGA
TTGAATTGATGACAAGGGGGATTGTTATAATGGATATGATTCTGAGCCAT
TGTATCATCCTTCTATACATTCATTCATTCGATTAGTATCTTTATACAGT
TTTATTTACAAGAGGAGTTTTCGCTTTAGTTTTTATCCTCTATCTCAGGC
ATGCTTATTATCAGCGTTTCTGCTCTCATGAGACTTCTTATTTCGGGAAT
TATCGCAATGATTTTATCTTTCCCCTCTACTACGTCTTTCTGTTTTTCGT
TGATTTCTCCAAACGCTTGTATTTGTTGTTCGTGGTATTGCACCTTTTGG
AATTGTTTTACTGCGTGTGTTTCGAGTTTCTTATACGCTGGGTTTCGTCT
TTTTATTCTATAATACTTCTTTTTGATTCTTTGGGCTTCTTTTTTCCAGT
AATCCTCTAGCACGTGGTTTGCCCATTTGTTTGCTAATTCGCCTTTAAAT
TCATTCACATTTTTTCCCATTTCCGATTAAGTTTTAGTTTTTGGTTTAGG
GATTTATTTTCCTCTTTTAATTCTCGTCGTTTGGTATCTGATAATTGAAA
TTCCCTTTTCAGTGCCTTTATCAGGTTTCTCGACTGAAACCATTGATTTG
TGATACGGTCTATCTCCTGACGTTGTTGTTCTATTGCTATTCTCATATTT
TCTATCATCTCCTCTTGCTCTTTATTTTCATTTTCTGTCGACTCTTCGAT
TTTACATTCTCTGGGTATTTGATCCTCGTTTTCCACCTCAATTTTTATTG
GTTTTATACATACATCTTTCTTATCGATGGTCTCGCTGGTTTCTACCTCC
ATTGTTGTTTCGTCGATTTGTTCATTCATTTTCTACAATTTTATATACAT
TACTTTTTGTTATTTTTATTGTTTTGATTTTTATGGTTTTTCGTTCGTTT
TATCTTTTTATGGGTTTTTTGGTTTTCTTAATTTTTTAGTTTTTCTGTTT
ACATAGTATTAGTTTTTTATTTACACTTTTTATTCACAGTTTTTTTATTT
ACACATTACATCCCCTCCTTTTCTTTATACATAGGTTTCTTGAATTCCTC
CACACCCTTCGTTGCCTGGTGTGACCTTGAGGTTGTAGTAATAGGGAGTA
ATGGTAACCATATCATTTGAGGTGTGTTCATAAACTCGTTGATTCTCGCT
TCTAGCGTTCTTGAGGTGCACAGTTCCTTATCCAGTAAATATGATAATTG
GATGACTTGATCTAGTAGATCTTCCACCTCTGCTTCCAGCATCGTCGTAT
TCTCCCAGGTTTTTAACCTCTCGATTTCCGTTTGCACCTCCTTTACTTTA
ACTTCAAAGACTTCCTTTTCACTTTCTCGTAGCGCTTTCTGACGATGTAG
TGCGATATCGCTTTGTTCGCACATAACTTTATATCTATTCACATCTCGTT
CAGCGTAATTTAGCCTTTGTATTTCTATTTCGACTTGTAAGTCACTTTGC
TCTTTATCCTCGTTTATTTTCCTTAGTGCGTTTTGTGCTTTCGTTAGCTG
GTTGACTTTTACGGTGGTGAATTTTCTGAGGTTCTCTTCCCTCCTTTCTT
GTAGGTTTATTTTTGCTTGCATATCTCTGATTTCCTCTCGTTGTTCCTCT
ATCTGCTCCCACATCTTCCAATCGTCAAGAGGTGTCCATTTCTGTGGTAG
CTTTTTTAGTTCTTTAGCCACTATTTGGTAGTTTTACTTCCAGGTTTTTG
CCTGTTTCTTTAGCCCGTTAATCATTTTTTCACATCTACCCATCGTGTTT
GACCATTCGGTTACTTGTAGGATTTGTTCTTTCTTTGTGTGTTCTAGTTC
CTCTCGAACTCTTACTTGTACACTTCCTACCTGTTCGATTTGGGCTTTGA
GTTCCTCGTTTCGTCTTCGAGCACCTTCGGCTCGACATTGATAGTACGCG
GTCTTTGTCACTTGGCTAAGGTATTTCACGCGCATTTTCTCTAATTCCTC
CATCTTTCCCAAAAATCGTTGGTTTAATTCTTTTACTTCCTCCTCTAGCC
GACTATTCTTTTGGCTATTTAGTTCCAACATAACTTTTCCGAAGGTCGTT
TTTATCTTTTGTTCTTCACAGCTGGCGTGGAATTCTCCCCTTTTTCGAAT
TGCTCTGTCTGTTAGACTTCGTTGATAGGCCGCGTCTATTACCTCTCCGA
AGTAGTCTATCTTTACTTCTTTCAACTTGTCTTTTAGTTCTTCCACCTTT
TTGTTTAATAACTCCACCATCACCTCGTGAGTTATCTCTGTTCCTTGTTC
TTCTACTTGGGTTTGGAGTTTTCTTACTTTTTGCCTTTCCCTCTCCGTTA
GGCATCTTGCATATGCGGCATCTATGACTTCACTGTTGTATGCGGTTTGT
CTTTTTGCACCTTCCCACACTTCTTTTGCCACTCTGTTACTTAACTTTTG
TACTTCATTTTCAAATTGATTGTTGTTTTGGTTCAGCAATTCCAACAGTA
CTCTCTCATAGTTTGTCTTCCATTTTTGTTCCTGGTTAATTTCACACATT
TGCTTTAGTTGCTTTAATTGTTCGTCTTTTTCGTGGGTTTTCTTTTCCCA
CCATTCTGCTTTTTCTTGGAATTTTTCGGTCTCAGTCTTTTGGATTATCG
CTGTTTGTTGTAGTACATATCTTCGCTTCTCTTCTCGGATACCTTGTTCT
AGTTTTTTAGTTACCAGCTTTTCGAATTCCTTTATTCCTTCTTCGTATAT
TTCTTTTATACGACACATTATGTTATTATTTTGCTTCGCGTTTAAATCTT
CTTGGTTTTCTCGTCCCTCATGTATCTGAGACCACATCATTTCGCACTTT
CTTGTTTCGACTTCTATTCTGTTTATTGTTTCCATTTCTTCGTTTTTTAT
TAGTATCGCTTTGCTCGTCTTGTCGTTCATTATTTGCATCATCATCATTA
CTGGAAGATCGGTTCTCACTTCAATGCTCATTTCTTTGATATTCATTTTT
CTACAATTACAATTTACAATTAACTTCGGTTGTTCACGGTGGTTATCGTT
TTTTAATTTTACGCATCTGTATTTTAGTGTTTTATGGGTTGCTGAGAATT
TGGTTAGTTTGTTCCCTTAGCCCCCATGTAGTTTAGTAACTTGGAGAATG
GATTCAAAATTTGAGTCTTTTCTCCAAGTAACAACAATAATTAAAATTAA
GGCCGGGAAAAAGAAAAATAGAATTTGCGAAAAAATAAAAATGAAAAAAA
AGACTTTATTTTGGAGATTGGGTTTTTTTTGTAATTTAAAAGACAATACT
TTAAAATAATTGTTAATTAAAAATTGGTTTGTTTAAAATTTTAATGTAAA
TGGTAGAAATTTGAATGGATTAAAAAATTTGAATAAATTCCTCAAAATG
back to top

protein sequence of SMED30006990-orf-1

>SMED30006990-orf-1 ID=SMED30006990-orf-1|Name=SMED30006990-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=203bp
MWEQIEEQREEIRDMQAKINLQERREENLRKFTTVKVNQLTKAQNALRKI
NEDKEQSDLQVEIEIQRLNYAERDVNRYKVMCEQSDIALHRQKALRESEK
EVFEVKVKEVQTEIERLKTWENTTMLEAEVEDLLDQVIQLSYLLDKELCT
SRTLEARINEFMNTPQMIWLPLLPITTTSRSHQATKGVEEFKKPMYKEKE
GM*
back to top

protein sequence of SMED30006990-orf-2

>SMED30006990-orf-2 ID=SMED30006990-orf-2|Name=SMED30006990-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
MNEQIDETTMEVETSETIDKKDVCIKPIKIEVENEDQIPRECKIEESTEN
ENKEQEEMIENMRIAIEQQRQEIDRITNQWFQSRNLIKALKREFQLSDTK
RRELKEENKSLNQKLKLNRKWEKM*
back to top

protein sequence of SMED30006990-orf-3

>SMED30006990-orf-3 ID=SMED30006990-orf-3|Name=SMED30006990-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=115bp
MGKNVNEFKGELANKWANHVLEDYWKKEAQRIKKKYYRIKRRNPAYKKLE
THAVKQFQKVQYHEQQIQAFGEINEKQKDVVEGKDKIIAIIPEIRSLMRA
ETLIISMPEIEDKN*
back to top

protein sequence of SMED30006990-orf-4

>SMED30006990-orf-4 ID=SMED30006990-orf-4|Name=SMED30006990-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=421bp
MNIKEMSIEVRTDLPVMMMMQIMNDKTSKAILIKNEEMETINRIEVETRK
CEMMWSQIHEGRENQEDLNAKQNNNIMCRIKEIYEEGIKEFEKLVTKKLE
QGIREEKRRYVLQQTAIIQKTETEKFQEKAEWWEKKTHEKDEQLKQLKQM
CEINQEQKWKTNYERVLLELLNQNNNQFENEVQKLSNRVAKEVWEGAKRQ
TAYNSEVIDAAYARCLTERERQKVRKLQTQVEEQGTEITHEVMVELLNKK
VEELKDKLKEVKIDYFGEVIDAAYQRSLTDRAIRKRGEFHASCEEQKIKT
TFGKVMLELNSQKNSRLEEEVKELNQRFLGKMEELEKMRVKYLSQVTKTA
YYQCRAEGARRRNEELKAQIEQVGSVQVRVREELEHTKKEQILQVTEWSN
TMGRCEKMINGLKKQAKTWK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000463cholinergic neuron