slc25a-23

Overview
Nameslc25a-23 (AKN21591.1)
Smed IDSMED30006987
Length (bp)1016
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc25a-23 (SMED30006987) t-SNE clustered cells

Violin plots show distribution of expression levels for slc25a-23 (SMED30006987) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc25a-23 (SMED30006987) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc25a-23 (SMED30006987) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006987

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30006987SMESG000009142.1 dd_Smed_v4_1823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30006987SMESG000009142.1 dd_Smed_v4_1823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc25a-23 vs. Ensembl Human
Match: SLC25A20 (solute carrier family 25 member 20 [Source:HGNC Symbol;Acc:HGNC:1421])

HSP 1 Score: 361.303 bits (926), Expect = 8.788e-125
Identity = 187/291 (64.26%), Postives = 221/291 (75.95%), Query Frame = 2
Query:   77 KEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            K I PLK+ +AGG GG+C V VG PLDT+KVRLQ  P   PG+ P+Y    DCF +TL  EG  G Y+GMAAP+IGVTPMFAVCFFG+ LG+KLQ K     L+ PQ+FAAGMLSGVFTT IMTPGER+KCLLQ+Q ASSG  KY G  D  K+LY+E GIR IYKGT  TL+RD+PA+G YFM+YEWLK   TPEG   + LSA R L+AGG AG+ NW V IPPD LKSR QTAP GKYPNG R V RE++ +EG+  LY+G + V+IRAFPANAACFLG+E+A+K LN
Sbjct:    6 KPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQ-ASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLN 295          

HSP 2 Score: 64.6994 bits (156), Expect = 3.085e-11
Identity = 39/95 (41.05%), Postives = 54/95 (56.84%), Query Frame = 2
Query:  683 LSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPE---GKYP--NGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            +S  + L+AGGF G+C   V  P DT+K RLQT P    G+ P  +G    FR+ +  EG+ GLYRG++  +I   P  A CF G+ +  KL  K
Sbjct:    8 ISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQK 102          
BLAST of slc25a-23 vs. Ensembl Human
Match: SLC25A20 (solute carrier family 25 member 20 [Source:HGNC Symbol;Acc:HGNC:1421])

HSP 1 Score: 210.305 bits (534), Expect = 1.670e-66
Identity = 100/162 (61.73%), Postives = 120/162 (74.07%), Query Frame = 2
Query:  464 KCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            K L +   ASSG  KY G  D  K+LY+E GIR IYKGT  TL+RD+PA+G YFM+YEWLK   TPEG   + LSA R L+AGG AG+ NW V IPPD LKSR QTAP GKYPNG R V RE++ +EG+  LY+G + V+IRAFPANAACFLG+E+A+K LN
Sbjct:   61 KTLFREIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLN 222          

HSP 2 Score: 90.5077 bits (223), Expect = 1.131e-20
Identity = 72/214 (33.64%), Postives = 106/214 (49.53%), Query Frame = 2
Query:   77 KEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNE------------------------GPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKD--ENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKY-KGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYE 637
            K I PLK+ +AGG GG+C V VG PLDT+KVRLQ  P   PG+ P+Y    DCF +TL  E                        G  G YKG    L+   P   + F  Y   + +   +    + L+ P+I  AG ++G+F  A+  P + +K   Q    ++ P KY  G  DV+++L ++ G+ S+YKG  A ++R  PA    F+ +E
Sbjct:    6 KPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQ----TAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFE 215          

HSP 3 Score: 48.9062 bits (115), Expect = 3.451e-6
Identity = 34/111 (30.63%), Postives = 51/111 (45.95%), Query Frame = 2
Query:  683 LSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAP----------EGKYPNGLRSVFREMMANE-------------------GLIGLYRGVSPVLIRAFPANAACFLGYE 928
            +S  + L+AGGF G+C   V  P DT+K RLQT P           G +    +++FRE+ A+                    G+ G+Y+G    L+R  PA+   F+ YE
Sbjct:    8 ISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYE 118          
BLAST of slc25a-23 vs. Ensembl Human
Match: SLC25A45 (solute carrier family 25 member 45 [Source:HGNC Symbol;Acc:HGNC:27442])

HSP 1 Score: 153.295 bits (386), Expect = 1.388e-43
Identity = 98/295 (33.22%), Postives = 147/295 (49.83%), Query Frame = 2
Query:   89 PLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYN-----LGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGA-----SSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQ-TAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALK 940
            P++ F+AG + G   +V+G P DT+KVRLQ            Y+ + DC ++  ++E   GF+KGM+ P+  +  + +V F  Y+     L      +    P +   IF AG   G      + P + +K  LQ Q        S PP+Y+GP      +++E G R +++G  A  LRD P  G YF++YE L    TPEG +    S+   L+AGGFAG+ +W+   P D +KSR+Q      +   G+       +  EGL   +RGV+    RAFP NA  FL YE  L+
Sbjct:    2 PVEEFVAGWISGALGLVLGHPFDTVKVRLQTQTT--------YRGIVDCMVKIYRHESLLGFFKGMSFPIASIAVVNSVLFGVYSNTLLVLTATSHQERRAQPPSYMHIFLAGCTGGFLQAYCLAPFDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQNP---SSATVLVAGGFAGIASWVAATPLDMIKSRMQMDGLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYEYLLR 285          
BLAST of slc25a-23 vs. Ensembl Human
Match: SLC25A45 (solute carrier family 25 member 45 [Source:HGNC Symbol;Acc:HGNC:27442])

HSP 1 Score: 153.295 bits (386), Expect = 1.388e-43
Identity = 98/295 (33.22%), Postives = 147/295 (49.83%), Query Frame = 2
Query:   89 PLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYN-----LGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGA-----SSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQ-TAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALK 940
            P++ F+AG + G   +V+G P DT+KVRLQ            Y+ + DC ++  ++E   GF+KGM+ P+  +  + +V F  Y+     L      +    P +   IF AG   G      + P + +K  LQ Q        S PP+Y+GP      +++E G R +++G  A  LRD P  G YF++YE L    TPEG +    S+   L+AGGFAG+ +W+   P D +KSR+Q      +   G+       +  EGL   +RGV+    RAFP NA  FL YE  L+
Sbjct:    2 PVEEFVAGWISGALGLVLGHPFDTVKVRLQTQTT--------YRGIVDCMVKIYRHESLLGFFKGMSFPIASIAVVNSVLFGVYSNTLLVLTATSHQERRAQPPSYMHIFLAGCTGGFLQAYCLAPFDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQNP---SSATVLVAGGFAGIASWVAATPLDMIKSRMQMDGLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYEYLLR 285          
BLAST of slc25a-23 vs. Ensembl Human
Match: SLC25A29 (solute carrier family 25 member 29 [Source:HGNC Symbol;Acc:HGNC:20116])

HSP 1 Score: 153.295 bits (386), Expect = 1.677e-43
Identity = 97/260 (37.31%), Postives = 138/260 (53.08%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPK-YKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYP--NGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACF 916
             P DT+KVRLQ   + KP     Y+    CF   +K E   G YKG+ +PL+G+T + A+  FG   G  L+    ++PL +   F AG  +G     I  P E  K  LQ+Q A  GP + YKG  D + Q+Y   G+R + +G  +TLLR+ P+ G YF++Y+ L  +L  E GD+  L   + L+AGG +G+ +WL   P D +KSRLQ       P   G+     +    EG     RG++  L+RAFP NAA F
Sbjct:   20 HPFDTVKVRLQVQSVEKPQ----YRGTLHCFKSIIKQESVLGLYKGLGSPLMGLTFINAL-VFGVQ-GNTLRALGHDSPLNQ---FLAGAAAGAIQCVICCPMELAKTRLQLQDA--GPARTYKGSLDCLAQIYGHEGLRGVNRGMVSTLLRETPSFGVYFLTYDALTRALGCEPGDR--LLVPKLLLAGGTSGIVSWLSTYPVDVVKSRLQADGLRGAPRYRGILDCVHQSYRAEGWRVFTRGLASTLLRAFPVNAATF 266          

HSP 2 Score: 60.077 bits (144), Expect = 1.392e-9
Identity = 53/187 (28.34%), Postives = 81/187 (43.32%), Query Frame = 2
Query:  401 FAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMS---YEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEG--KYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLL 946
            F AG   GV    +  P + VK  LQVQ  S   P+Y+G     K + K+  +  +YKG  +      P  G  F++   +     +L   G    H S     +AG  AG    ++C P +  K+RLQ    G  +   G      ++  +EGL G+ RG+   L+R  P+    FL Y+   + L
Sbjct:    5 FLAGCAGGVAGVLVGHPFDTVKVRLQVQ--SVEKPQYRGTLHCFKSIIKQESVLGLYKGLGS------PLMGLTFINALVFGVQGNTLRALG----HDSPLNQFLAGAAAGAIQCVICCPMELAKTRLQLQDAGPARTYKGSLDCLAQIYGHEGLRGVNRGMVSTLLRETPSFGVYFLTYDALTRAL 179          
BLAST of slc25a-23 vs. Ensembl Celegans
Match: dif-1 (pep chromosome:WBcel235:IV:7551550:7553008:-1 gene:WBGene00000996.1 transcript:F49E8.5.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:dif-1)

HSP 1 Score: 308.531 bits (789), Expect = 3.182e-104
Identity = 168/284 (59.15%), Postives = 205/284 (72.18%), Query Frame = 2
Query:   92 LKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPP--KYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMAL 937
            L +FIAGGVGG CTV+VG P DT+KVR+Q MP+PKPGE P +    DC  +T+  EG F  YKGMAAPL+GV+P+FAV F G  +G+ LQ  D +  +T  Q   AG L+GVFTT +M PGER+KCLLQVQ A S      Y GP DVVK+LYK+GGI SIY+GT ATLLRDIPA+  Y   YE+LK+  + EG  +  LS G TL+AGG AG+ NW VCIP D LKSRLQTAPEGKYP+G+R V RE++  EG   L++G  PV++RAFPANAACF G E+ L
Sbjct:    5 LLNFIAGGVGGSCTVIVGHPFDTVKVRIQTMPMPKPGEKPQFTGALDCVKRTVSKEGFFALYKGMAAPLVGVSPLFAVFFGGCAVGKWLQQTDPSQEMTFIQNANAGALAGVFTTIVMVPGERIKCLLQVQQAGSAGSGVHYDGPLDVVKKLYKQGGISSIYRGTGATLLRDIPASAAYLSVYEYLKKKFSGEGAQRT-LSPGATLMAGGLAGIANWGVCIPADVLKSRLQTAPEGKYPDGIRGVLREVLREEGPRALFKGFWPVMLRAFPANAACFFGLELTL 287          
BLAST of slc25a-23 vs. Ensembl Celegans
Match: dif-1 (pep chromosome:WBcel235:IV:7551550:7552874:-1 gene:WBGene00000996.1 transcript:F49E8.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:dif-1)

HSP 1 Score: 308.531 bits (789), Expect = 3.182e-104
Identity = 168/284 (59.15%), Postives = 205/284 (72.18%), Query Frame = 2
Query:   92 LKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPP--KYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMAL 937
            L +FIAGGVGG CTV+VG P DT+KVR+Q MP+PKPGE P +    DC  +T+  EG F  YKGMAAPL+GV+P+FAV F G  +G+ LQ  D +  +T  Q   AG L+GVFTT +M PGER+KCLLQVQ A S      Y GP DVVK+LYK+GGI SIY+GT ATLLRDIPA+  Y   YE+LK+  + EG  +  LS G TL+AGG AG+ NW VCIP D LKSRLQTAPEGKYP+G+R V RE++  EG   L++G  PV++RAFPANAACF G E+ L
Sbjct:    5 LLNFIAGGVGGSCTVIVGHPFDTVKVRIQTMPMPKPGEKPQFTGALDCVKRTVSKEGFFALYKGMAAPLVGVSPLFAVFFGGCAVGKWLQQTDPSQEMTFIQNANAGALAGVFTTIVMVPGERIKCLLQVQQAGSAGSGVHYDGPLDVVKKLYKQGGISSIYRGTGATLLRDIPASAAYLSVYEYLKKKFSGEGAQRT-LSPGATLMAGGLAGIANWGVCIPADVLKSRLQTAPEGKYPDGIRGVLREVLREEGPRALFKGFWPVMLRAFPANAACFFGLELTL 287          
BLAST of slc25a-23 vs. Ensembl Celegans
Match: dif-1 (pep chromosome:WBcel235:IV:7551657:7552874:-1 gene:WBGene00000996.1 transcript:F49E8.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:dif-1)

HSP 1 Score: 308.531 bits (789), Expect = 3.182e-104
Identity = 168/284 (59.15%), Postives = 205/284 (72.18%), Query Frame = 2
Query:   92 LKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPP--KYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMAL 937
            L +FIAGGVGG CTV+VG P DT+KVR+Q MP+PKPGE P +    DC  +T+  EG F  YKGMAAPL+GV+P+FAV F G  +G+ LQ  D +  +T  Q   AG L+GVFTT +M PGER+KCLLQVQ A S      Y GP DVVK+LYK+GGI SIY+GT ATLLRDIPA+  Y   YE+LK+  + EG  +  LS G TL+AGG AG+ NW VCIP D LKSRLQTAPEGKYP+G+R V RE++  EG   L++G  PV++RAFPANAACF G E+ L
Sbjct:    5 LLNFIAGGVGGSCTVIVGHPFDTVKVRIQTMPMPKPGEKPQFTGALDCVKRTVSKEGFFALYKGMAAPLVGVSPLFAVFFGGCAVGKWLQQTDPSQEMTFIQNANAGALAGVFTTIVMVPGERIKCLLQVQQAGSAGSGVHYDGPLDVVKKLYKQGGISSIYRGTGATLLRDIPASAAYLSVYEYLKKKFSGEGAQRT-LSPGATLMAGGLAGIANWGVCIPADVLKSRLQTAPEGKYPDGIRGVLREVLREEGPRALFKGFWPVMLRAFPANAACFFGLELTL 287          
BLAST of slc25a-23 vs. Ensembl Celegans
Match: slc-25A29 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q18844])

HSP 1 Score: 174.096 bits (440), Expect = 7.227e-52
Identity = 100/267 (37.45%), Postives = 149/267 (55.81%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLL 946
             PLDT+KVRLQ     + G  P Y+    CF   ++ EG  G YKGM++PL+ ++ + A+ F G + G   Q++D   P +    F  G  +G+  + I  P ER+K LLQ+Q       K+ GP D  KQL +  G++S+ +G  AT+ RD PA G YF SYEW+  S+  + G+ + LS+G+ L AGG AGM +WL     D +KSR Q   +  Y + +  + ++     G  G + G++  LIRAFP+NAA F   E   ++L
Sbjct:   22 HPLDTVKVRLQT----QSGPTPQYRGTFHCFKLIVQKEGFRGLYKGMSSPLLSLSAINAIVF-GVHGGTCRQMED---PDSITSHFVGGCAAGMAQSVIAAPTERIKLLLQIQD-DKAHTKFNGPIDATKQLLRTHGLKSLTRGFLATVARDAPAFGVYFASYEWMARSMCKD-GETSTLSSGQLLFAGGTAGMLSWLFNYQTDIIKSRFQ--ADNSYKSYMHCI-KQTYLERGYRGFFVGLNSALIRAFPSNAATFFTVEWTYRIL 275          
BLAST of slc25a-23 vs. Ensembl Celegans
Match: slc-25A29 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q18844])

HSP 1 Score: 174.481 bits (441), Expect = 1.342e-51
Identity = 100/267 (37.45%), Postives = 149/267 (55.81%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLL 946
             PLDT+KVRLQ     + G  P Y+    CF   ++ EG  G YKGM++PL+ ++ + A+ F G + G   Q++D   P +    F  G  +G+  + I  P ER+K LLQ+Q       K+ GP D  KQL +  G++S+ +G  AT+ RD PA G YF SYEW+  S+  + G+ + LS+G+ L AGG AGM +WL     D +KSR Q   +  Y + +  + ++     G  G + G++  LIRAFP+NAA F   E   ++L
Sbjct:   22 HPLDTVKVRLQT----QSGPTPQYRGTFHCFKLIVQKEGFRGLYKGMSSPLLSLSAINAIVF-GVHGGTCRQMED---PDSITSHFVGGCAAGMAQSVIAAPTERIKLLLQIQD-DKAHTKFNGPIDATKQLLRTHGLKSLTRGFLATVARDAPAFGVYFASYEWMARSMCKD-GETSTLSSGQLLFAGGTAGMLSWLFNYQTDIIKSRFQ--ADNSYKSYMHCI-KQTYLERGYRGFFVGLNSALIRAFPSNAATFFTVEWTYRIL 275          
BLAST of slc25a-23 vs. Ensembl Fly
Match: colt (gene:FBgn0019830 transcript:FBtr0077731)

HSP 1 Score: 322.398 bits (825), Expect = 1.071e-109
Identity = 161/298 (54.03%), Postives = 213/298 (71.48%), Query Frame = 2
Query:   62 NNMSNKEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            N  + ++ +P+KSF+ GG GGIC V+ G PLDTIKVRLQ MP P PGE PLY+   DC  +T+KNEG  G YKGM+APL GV P+FA+CF GY LG++LQ + E+  LT PQIF AG  SG+F+T IM PGER+K LLQ Q    G  KY G  D   +LYKEGG+RS++KG+ AT+LRD+PA G YF+ YE L++ +     +   +S   T+ AGG AGM  W++ +P D LKSRLQ+APEG Y +G+RSVF++++  +G + LYRGV+P+++RAFPANAACF G E+A K  N +
Sbjct:    6 NVSTERKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQD-VAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIELANKFFNIV 302          
BLAST of slc25a-23 vs. Ensembl Fly
Match: colt (gene:FBgn0019830 transcript:FBtr0077734)

HSP 1 Score: 322.398 bits (825), Expect = 1.071e-109
Identity = 161/298 (54.03%), Postives = 213/298 (71.48%), Query Frame = 2
Query:   62 NNMSNKEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            N  + ++ +P+KSF+ GG GGIC V+ G PLDTIKVRLQ MP P PGE PLY+   DC  +T+KNEG  G YKGM+APL GV P+FA+CF GY LG++LQ + E+  LT PQIF AG  SG+F+T IM PGER+K LLQ Q    G  KY G  D   +LYKEGG+RS++KG+ AT+LRD+PA G YF+ YE L++ +     +   +S   T+ AGG AGM  W++ +P D LKSRLQ+APEG Y +G+RSVF++++  +G + LYRGV+P+++RAFPANAACF G E+A K  N +
Sbjct:    6 NVSTERKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQD-VAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIELANKFFNIV 302          
BLAST of slc25a-23 vs. Ensembl Fly
Match: MME1 (gene:FBgn0031881 transcript:FBtr0079389)

HSP 1 Score: 269.626 bits (688), Expect = 5.857e-89
Identity = 152/293 (51.88%), Postives = 206/293 (70.31%), Query Frame = 2
Query:   71 SNKEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            + K+ +P+KSFIAGGVGG+C V+VG PLDTIKVRLQ MP P PG+ P YK + DC  +T + EG  GFY+G++APL+GVTP++AV F  Y  G++L   D++  LT PQIFAAG L+GV +  +  P +R+K LLQ Q  S+GP  Y G  D   +LY++GGIRS++KGT A +LRD P TG YF++YE+L+E L  +      +S   T+++GG AG+  W + +P D LKSRLQ+APEG Y +G+RSVFR +MA EG   L+RG+ P+L+RAFP+ AA F G E+   LL 
Sbjct:    8 TEKKSNPVKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSP-TGFYFVTYEFLQE-LARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRSVFRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVELTNDLLK 298          
BLAST of slc25a-23 vs. Ensembl Fly
Match: CG4995 (gene:FBgn0032219 transcript:FBtr0079991)

HSP 1 Score: 149.058 bits (375), Expect = 1.372e-41
Identity = 95/271 (35.06%), Postives = 135/271 (49.82%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEG---KYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
             P DT+KV LQ    P+    P YK    CF   ++ +   G Y+G+++P+ G+  + A+ F  Y   ++L     N P +    F AG ++GV    +  P E  K  LQ+        K+ GP   +K + K  GIR  +KG  AT+LRDIP   +YF+S+E+L   +   G          TL+AGG AGM +WL C P D +K+ +Q    G   KY NG      +   NEG    +RG++  LIRAFP NAACF      L + N
Sbjct:   20 HPFDTVKVHLQTDD-PRN---PKYKGTFHCFRTIVQRDKFIGLYRGISSPMGGIGLVNAIVFGVYGNVQRL----SNDPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQVETPG-------VAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKY-NGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACFFVVSWVLDICN 274          
BLAST of slc25a-23 vs. Ensembl Fly
Match: CG4995 (gene:FBgn0032219 transcript:FBtr0331665)

HSP 1 Score: 149.058 bits (375), Expect = 1.372e-41
Identity = 95/271 (35.06%), Postives = 135/271 (49.82%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEG---KYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
             P DT+KV LQ    P+    P YK    CF   ++ +   G Y+G+++P+ G+  + A+ F  Y   ++L     N P +    F AG ++GV    +  P E  K  LQ+        K+ GP   +K + K  GIR  +KG  AT+LRDIP   +YF+S+E+L   +   G          TL+AGG AGM +WL C P D +K+ +Q    G   KY NG      +   NEG    +RG++  LIRAFP NAACF      L + N
Sbjct:   20 HPFDTVKVHLQTDD-PRN---PKYKGTFHCFRTIVQRDKFIGLYRGISSPMGGIGLVNAIVFGVYGNVQRL----SNDPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQVETPG-------VAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKY-NGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACFFVVSWVLDICN 274          
BLAST of slc25a-23 vs. Ensembl Zebrafish
Match: slc25a20 (solute carrier family 25 member 20 [Source:ZFIN;Acc:ZDB-GENE-040426-1869])

HSP 1 Score: 376.326 bits (965), Expect = 7.797e-131
Identity = 194/297 (65.32%), Postives = 228/297 (76.77%), Query Frame = 2
Query:   68 MSNKE-IHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            MS ++ I P+K+F AGG GG+C V  G PLDTIKVRLQ  P P+PGE+  Y    DCF +TL  EG  G YKGMAAP+IGVTPMFAVCFFG+ LG+KLQ K  +  LT PQ+FAAGMLSGVFTTAIM PGER+KCLLQ+Q A+SG  KY GP D VKQLY+E GIR IYKGTA TL+RD+PA+G YFM+YEWLK +LTPEG   + LS    L AGG AG+ NW V IPPD LKSR QTAPEGKYPNG R V RE++  EG+  LY+G + V++RAFPANAACFLG+E+A+K LN I
Sbjct:    1 MSKQQPISPMKNFFAGGFGGVCLVFAGHPLDTIKVRLQTQPKPRPGEVAQYAGTFDCFKKTLAKEGVRGLYKGMAAPIIGVTPMFAVCFFGFGLGKKLQQKTPDDILTYPQLFAAGMLSGVFTTAIMAPGERIKCLLQIQ-AASGQVKYAGPMDCVKQLYRESGIRGIYKGTALTLMRDVPASGMYFMTYEWLKHALTPEGKSPSELSVPSILFAGGMAGIFNWAVAIPPDVLKSRFQTAPEGKYPNGFRDVLRELVREEGVRSLYKGFNAVMLRAFPANAACFLGFEVAMKFLNWI 296          
BLAST of slc25a-23 vs. Ensembl Zebrafish
Match: si:dkey-150i13.2 (si:dkey-150i13.2 [Source:ZFIN;Acc:ZDB-GENE-090312-157])

HSP 1 Score: 304.679 bits (779), Expect = 9.624e-103
Identity = 160/295 (54.24%), Postives = 207/295 (70.17%), Query Frame = 2
Query:   71 SNKEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            S++ + PLK+F+AGG GGIC ++ G PLDTIKVRLQ        +  +YK   DCF +T+  EG FG YKGM APL GVTPM A+ FFG+ LG++L  +D   P T  QI+ AGML+GV TT I+ PGER+KCLLQ+    +G  KY GP D   +LYK+ GI S+YKGT  TL+RD+P+ G YF++Y++LK  LTP+G    HLS  R L+AGG AGM NWL+ +P D LKS  Q+A +G+Y  G+R V R ++  EG  GLY+G S V++RAFPANAACFLG+E+ALK LN I
Sbjct:    6 SDRRVSPLKNFVAGGFGGICLLLAGHPLDTIKVRLQTQ------DCAVYKGTFDCFRKTVSKEGIFGLYKGMGAPLAGVTPMMALNFFGFGLGKELLQRDPTVPATYTQIYLAGMLAGVCTTVIVAPGERIKCLLQIL-PLAGRMKYTGPLDCAVRLYKQQGICSVYKGTILTLIRDVPSNGVYFLTYDYLKHYLTPDGECVHHLSTSRVLLAGGIAGMINWLIALPADVLKSNYQSATDGRY-QGVRHVLRTLLKEEGAQGLYKGFSAVMLRAFPANAACFLGFEVALKYLNYI 292          
BLAST of slc25a-23 vs. Ensembl Zebrafish
Match: SLC25A29 (solute carrier family 25 member 29 [Source:NCBI gene;Acc:100329459])

HSP 1 Score: 152.91 bits (385), Expect = 1.550e-43
Identity = 91/263 (34.60%), Postives = 140/263 (53.23%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGA---SSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEG---KYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACF 916
             P DT+KVRLQ   + KP    LY+    CF   ++ E   G YKG+ +PL+G+T + A+  FG   G  +++   +TPL +   F AG  +G+  + I  P E  K  +Q+QG    S     Y+   D + ++Y+  G R I +G  +T++R+ P  G YF++Y+ L  SL  E GD+      + L+AGG +G+ +W+   P D +KSRLQ    G   +Y +G+   F +    EG     RG++  L+RAFP NA  F
Sbjct:   20 HPFDTVKVRLQVQSVDKP----LYRGTIHCFQSIIRQESMLGLYKGIGSPLMGLTFINAI-VFGVQ-GNAMRMLGSDTPLHQ---FMAGAAAGLIQSVICCPMELAKTRMQMQGTGEKSLSRRLYRNSLDCLIRIYRRQGFRGINRGMVSTVIRETPGFGIYFLTYDTLTRSLGCEAGDR--FIVLKLLLAGGASGIASWISTYPVDVIKSRLQADGVGGDCRY-SGMLDCFAQSWQREGWRAFTRGLTSTLLRAFPVNATTF 270          
BLAST of slc25a-23 vs. Ensembl Zebrafish
Match: slc25a29 (solute carrier family 25 member 29 [Source:ZFIN;Acc:ZDB-GENE-050913-70])

HSP 1 Score: 152.14 bits (383), Expect = 3.334e-43
Identity = 94/263 (35.74%), Postives = 138/263 (52.47%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGA----SSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQT-APEGKYP-NGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACF 916
             P DT+KVRLQ   + KP    LY+    CF   ++ E   G YKG+ +P++G+T + A+  FG   G  ++   E+TPL +   F AG  +G     I  P E  K  +Q+QG     SS    YK   D + ++Y+  G+R + +G   TL+R+ P  G YF++Y+ L  SL  E  D   +   + L AGG +G+ +WL   P D +KSRLQ     GKY  + +    R+ +  EG     RG++  L+RAFP NAA F
Sbjct:   18 HPFDTVKVRLQVQSVDKP----LYRGTFHCFQSIIRQESVLGLYKGIGSPMMGLTFINAI-VFGVQ-GNAMRRLGEDTPLNQ---FLAGAAAGSIQCVICCPMELAKTRMQMQGTGEKKSSSRKVYKNSLDCLARIYQREGLRGVNRGMVTTLIRETPGFGVYFLAYDLLTRSLGCEPDDPYMIP--KLLFAGGMSGIASWLSTYPVDVIKSRLQADGVGGKYQYSSIMDCTRKSIQREGFRVFTRGLTSTLLRAFPVNAATF 269          

HSP 2 Score: 76.2554 bits (186), Expect = 3.137e-15
Identity = 57/201 (28.36%), Postives = 87/201 (43.28%), Query Frame = 2
Query:   80 EIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPI--PKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDK 676
            E  PL  F+AG   G    V+  P++  K R+Q       K     +YK+  DC  +  + EG  G  +GM   LI  TP F V F  Y+L  +    + + P   P++  AG +SG+ +     P + +K  LQ  G   G  +Y    D  ++  +  G R   +G  +TLLR  P     F +       + P+ G K
Sbjct:   87 EDTPLNQFLAGAAAGSIQCVICCPMELAKTRMQMQGTGEKKSSSRKVYKNSLDCLARIYQREGLRGVNRGMVTTLIRETPGFGVYFLAYDLLTRSLGCEPDDPYMIPKLLFAGGMSGIASWLSTYPVDVIKSRLQADGV-GGKYQYSSIMDCTRKSIQREGFRVFTRGLTSTLLRAFPVNAATFATVTLFLLYVRPDEGSK 286          

HSP 3 Score: 57.3806 bits (137), Expect = 5.779e-9
Identity = 49/191 (25.65%), Postives = 83/191 (43.46%), Query Frame = 2
Query:  401 FAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMS--YEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMM-------ANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLL 946
            F AG + G     +  P + VK  LQVQ  S   P Y+G     + + ++  +  +YKG  +      P  G  F++     ++ +     G+   L+     +AG  AG    ++C P +  K+R+Q    G+  +  R V++  +         EGL G+ RG+   LIR  P     FL Y++  + L
Sbjct:    3 FLAGCIGGAAGVLVGHPFDTVKVRLQVQ--SVDKPLYRGTFHCFQSIIRQESVLGLYKGIGS------PMMGLTFINAIVFGVQGNAMRRLGEDTPLN---QFLAGAAAGSIQCVICCPMELAKTRMQMQGTGEKKSSSRKVYKNSLDCLARIYQREGLRGVNRGMVTTLIRETPGFGVYFLAYDLLTRSL 182          
BLAST of slc25a-23 vs. Ensembl Zebrafish
Match: FO704822.1 (solute carrier family 25 member 45 [Source:NCBI gene;Acc:100329446])

HSP 1 Score: 147.902 bits (372), Expect = 9.749e-42
Identity = 90/271 (33.21%), Postives = 137/271 (50.55%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQ----IFAAGMLSGVFTTAIMTPGERVKCLLQVQGAS-SGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQ-TAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALK 940
             PLDT+KVRLQ   +        Y  + DC ++T   EG  GF+KGM+ P++ V    AV F  Y+       +  +   ++      +F AG  SG+    +  P + VK  LQ Q  S S   KY+GP   V  + +E G++ +++G  A  LRD+P  G YF+ YE+    +T +G    H +    L AGG AG+  W    P D +K+RLQ +   G+  +G+ +     +  EG+   ++G+    +RAFP NA  FL YEM L+
Sbjct:   31 HPLDTVKVRLQTQSV--------YGGILDCVIKTYTREGLHGFFKGMSFPVLSVAVSNAVAFGSYSNALDYLTQSHHNDHSQRSPLSYVFMAGCFSGLAQLFVTAPIDLVKVRLQNQTRSRSAGNKYRGPLHCVAVIVREDGLKGLFRGFWALALRDVPCYGLYFLPYEFTLRMMTEKGKQPGHCA---VLAAGGVAGVITWACATPMDVVKARLQMSGGGGRVYSGVLNCITVSVREEGIRVFFKGLLLNSVRAFPVNAVTFLSYEMILR 290          

HSP 2 Score: 60.4622 bits (145), Expect = 6.053e-10
Identity = 49/177 (27.68%), Postives = 79/177 (44.63%), Query Frame = 2
Query:  449 PGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTA----ATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPE-----GKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            P + VK  LQ Q        Y G  D V + Y   G+   +KG +    +  + +  A G+Y  + ++L +S   +   ++ LS     +AG F+G+    V  P D +K RLQ          KY   L  V   ++  +GL GL+RG   + +R  P     FL YE  L+++ +
Sbjct:   32 PLDTVKVRLQTQSV------YGGILDCVIKTYTREGLHGFFKGMSFPVLSVAVSNAVAFGSYSNALDYLTQSHHNDHSQRSPLS--YVFMAGCFSGLAQLFVTAPIDLVKVRLQNQTRSRSAGNKYRGPLHCV-AVIVREDGLKGLFRGFWALALRDVPCYGLYFLPYEFTLRMMTE 199          
BLAST of slc25a-23 vs. Ensembl Xenopus
Match: slc25a20 (solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 [Source:NCBI gene;Acc:394703])

HSP 1 Score: 367.466 bits (942), Expect = 3.774e-127
Identity = 190/289 (65.74%), Postives = 219/289 (75.78%), Query Frame = 2
Query:   83 IHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            I P+K+F AGG GGIC V  G PLDTIKVR+Q  P P PG  PLY    DCF +TL NEG  G YKGMAAP+IGVTPMFAVCFFG+ LG+KLQ K     LT PQ+FAAGMLSGVFTTAIM PGER+KCLLQ+Q A+SG  KY GP D  KQLY+E GIR IYKGT  TL+RD+PA+G YFM+YEWLK  LTPEG   + LS  + L AGG AG+ NW V IPPD LKSR QTAP GKYPNG R V RE++  EG+  LY+G + V++RAFPANAACFLG+E+A+K LN
Sbjct:    8 ISPMKNFFAGGFGGICLVFAGHPLDTIKVRIQTQPKPVPGIPPLYSGTFDCFKKTLVNEGLRGLYKGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDILTYPQLFAAGMLSGVFTTAIMAPGERIKCLLQIQ-AASGEVKYAGPMDCAKQLYREAGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNILTPEGHSVSELSVPKILFAGGMAGIFNWAVAIPPDVLKSRFQTAPAGKYPNGFRDVLRELIREEGIGSLYKGFTAVMLRAFPANAACFLGFEVAMKFLN 295          

HSP 2 Score: 61.2326 bits (147), Expect = 5.096e-10
Identity = 36/95 (37.89%), Postives = 52/95 (54.74%), Query Frame = 2
Query:  683 LSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPE---GKYP--NGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            +S  +   AGGF G+C      P DT+K R+QT P+   G  P  +G    F++ + NEGL GLY+G++  +I   P  A CF G+ +  KL  K
Sbjct:    8 ISPMKNFFAGGFGGICLVFAGHPLDTIKVRIQTQPKPVPGIPPLYSGTFDCFKKTLVNEGLRGLYKGMAAPIIGVTPMFAVCFFGFGLGKKLQQK 102          
BLAST of slc25a-23 vs. Ensembl Xenopus
Match: slc25a20 (solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 [Source:NCBI gene;Acc:394703])

HSP 1 Score: 314.694 bits (805), Expect = 1.084e-106
Identity = 174/290 (60.00%), Postives = 201/290 (69.31%), Query Frame = 2
Query:   83 IHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGD-KAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            I P+K+F AGG GGIC V  G PLDTIKVR+Q  P P PG  PLY    DCF +TL NEG  G YKGMAAP+IGVTPMFAVCFFG+ LG+KLQ K     LT PQ+FAAGMLSGVFTTAIM PGER+KCLLQ+Q A+SG  KY GP D  KQLY+E GIR IYKGT  TL+RD+PA+G YFM+YEWLK  LTPEG     HL+   T         C   V             AP GKYPNG R V RE++  EG+  LY+G + V++RAFPANAACFLG+E+A+K LN
Sbjct:    8 ISPMKNFFAGGFGGICLVFAGHPLDTIKVRIQTQPKPVPGIPPLYSGTFDCFKKTLVNEGLRGLYKGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDILTYPQLFAAGMLSGVFTTAIMAPGERIKCLLQIQ-AASGEVKYAGPMDCAKQLYREAGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNILTPEGHSVVVHLAMEMT--------NCGLFV--------FSFSIAPAGKYPNGFRDVLRELIREEGIGSLYKGFTAVMLRAFPANAACFLGFEVAMKFLN 280          

HSP 2 Score: 60.8474 bits (146), Expect = 5.322e-10
Identity = 36/95 (37.89%), Postives = 52/95 (54.74%), Query Frame = 2
Query:  683 LSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPE---GKYP--NGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            +S  +   AGGF G+C      P DT+K R+QT P+   G  P  +G    F++ + NEGL GLY+G++  +I   P  A CF G+ +  KL  K
Sbjct:    8 ISPMKNFFAGGFGGICLVFAGHPLDTIKVRIQTQPKPVPGIPPLYSGTFDCFKKTLVNEGLRGLYKGMAAPIIGVTPMFAVCFFGFGLGKKLQQK 102          
BLAST of slc25a-23 vs. Ensembl Xenopus
Match: ENSXETT00000016618.1 (solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 like [Source:NCBI gene;Acc:779503])

HSP 1 Score: 253.062 bits (645), Expect = 3.577e-83
Identity = 121/231 (52.38%), Postives = 158/231 (68.40%), Query Frame = 2
Query:  257 EGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            +G  G Y+GM APL  VTP+ ++ F G+ LG+ LQ    ++ L   Q+F AGML+G+ +T +M PGER+KCLLQVQ  +     ++GP D  + LY+E GIR +Y+GT  TL+RD+P+TG YFMSYEW+KE +  E      L A   L+AGG AGMCNWLV IP D LKSR QTAPE  Y N L  V RE++ +EG  GLYRG +  ++RAFPANAACFLG+E ++  LN
Sbjct:    1 QGIRGLYRGMGAPLAVVTPIMSITFVGFGLGKSLQQTSPDSILRSWQVFVAGMLAGLSSTVLMAPGERIKCLLQVQSVTL-KKTFQGPLDCAQTLYRELGIRGLYRGTLLTLIRDVPSTGVYFMSYEWMKEKMRGERSSARELRATEILLAGGVAGMCNWLVAIPADVLKSRFQTAPENHYKNIL-EVLREVLHSEGPCGLYRGFTAAMLRAFPANAACFLGFEASMSFLN 229          

HSP 2 Score: 49.2914 bits (116), Expect = 2.803e-6
Identity = 50/191 (26.18%), Postives = 91/191 (47.64%), Query Frame = 2
Query:   83 IHPLKSFIAXXXXXXXXXXXXQPLDTIK--VRLQAMPIPKPGELPLYKSMADCFLQTLKNE-GPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTP---LTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYE 637
            +   + F+AG + G+ + V+  P + IK  +++Q++ + K  + PL     DC  QTL  E G  G Y+G    LI   P   V F  Y   ++ +++ E +    L   +I  AG ++G+    +  P + +K   Q    ++    YK   +V++++    G   +Y+G  A +LR  PA    F+ +E
Sbjct:   43 LRSWQVFVAGMLAGLSSTVLMAPGERIKCLLQVQSVTLKKTFQGPL-----DC-AQTLYRELGIRGLYRGTLLTLIRDVPSTGVYFMSYEWMKE-KMRGERSSARELRATEILLAGGVAGMCNWLVAIPADVLKSRFQ----TAPENHYKNILEVLREVLHSEGPCGLYRGFTAAMLRAFPANAACFLGFE 222          
BLAST of slc25a-23 vs. Ensembl Xenopus
Match: slc25a45 (solute carrier family 25 member 45 [Source:NCBI gene;Acc:100127755])

HSP 1 Score: 150.599 bits (379), Expect = 1.452e-42
Identity = 105/301 (34.88%), Postives = 148/301 (49.17%), Query Frame = 2
Query:   89 PLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLG----RKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSG--------PPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYE----WLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQ-TAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALK 940
            P   FIAG + G   +VVG P+DT+KVRLQ            Y+ + DC +QT +NE  FGF+KGM+ P+  V    ++ F  Y+         ++K+   P     +F AG  SG+   +   P + VK  LQ Q  S G          +Y+GP      +++E GI  +Y+G  A  LRDIP+ G YF++YE    W+ +SL          SA   L AGG AG   W    P D +K+RLQ     G    G+    R+ +  EG+    +G++   +RAFP NA  FL YEM LK
Sbjct:    2 PAAEFIAGWISGALGLVVGHPVDTVKVRLQTQS--------RYRGILDCVIQTYRNETIFGFFKGMSFPVGSVAISNSLAFGSYSNALLYLSDQEIKNWKNPPHNCHVFMAGCFSGIVQLSFSAPVDLVKVRLQNQTESFGNQARPGHLQARYQGPVHCAVCIFREEGIFGLYRGCLALALRDIPSMGLYFLTYEVLCKWMTKSLDEP-------SAWTMLFAGGCAGTVGWAFANPMDVIKARLQMDGMHGVQYLGMLDCIRKSIRQEGVKVFLKGLTINSLRAFPVNAVTFLSYEMLLK 287          

HSP 2 Score: 64.6994 bits (156), Expect = 2.614e-11
Identity = 56/203 (27.59%), Postives = 85/203 (41.87%), Query Frame = 2
Query:  401 FAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTA----ATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEG----KYPNGLRS-----------VFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            F AG +SG     +  P + VK  LQ Q       +Y+G  D V Q Y+   I   +KG +    +  + +  A G+Y  +  +L +       +  H       +AG F+G+       P D +K RLQ   E       P  L++           +FRE    EG+ GLYRG   + +R  P+    FL YE+  K + K
Sbjct:    6 FIAGWISGALGLVVGHPVDTVKVRLQTQ------SRYRGILDCVIQTYRNETIFGFFKGMSFPVGSVAISNSLAFGSYSNALLYLSDQEIKNWKNPPH--NCHVFMAGCFSGIVQLSFSAPVDLVKVRLQNQTESFGNQARPGHLQARYQGPVHCAVCIFRE----EGIFGLYRGCLALALRDIPSMGLYFLTYEVLCKWMTK 196          
BLAST of slc25a-23 vs. Ensembl Xenopus
Match: pofut2 (protein O-fucosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-1018927])

HSP 1 Score: 148.288 bits (373), Expect = 8.412e-42
Identity = 92/262 (35.11%), Postives = 134/262 (51.15%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGA---SSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEG--KYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACF 916
             P DT+KVRLQ   +  P     Y+    CF   +K E   G YKG+ +P++G+T + A+ F G   G  L+   ++TPL +   F AG  +G     I  P E  K  +Q+QG     S    YK   D + ++Y++ G+R I +G   T LR+ P+ G YF++Y++L   L  E  D   +   + L AGG +G+ +WL   P D +KSRLQ    G     NG+    R+    EG     RG++  L+RAFP NAA F
Sbjct:    9 HPFDTVKVRLQVQSVSNPK----YRGTIHCFQSIIKQESTLGLYKGIGSPMMGLTFINALVF-GVQ-GNTLRYLGKDTPLNQ---FLAGAAAGSIQCVICCPMELAKTRMQLQGTGEYKSRSKTYKNSLDCMVKIYRKEGVRGINRGMVTTFLRETPSFGFYFLTYDYLTRYLGCEINDTFIIP--KLLFAGGMSGIVSWLSTYPIDVIKSRLQADGIGGVNNYNGIMDCVRKSYKEEGWRVFSRGLTSTLLRAFPVNAATF 259          

HSP 2 Score: 50.8322 bits (120), Expect = 1.071e-6
Identity = 51/191 (26.70%), Postives = 82/191 (42.93%), Query Frame = 2
Query:  404 AAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMS---YEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYP-------NGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLL 946
            AAG+L G        P + VK  LQVQ  S+  PKY+G     + + K+     +YKG  +      P  G  F++   +     +L   G D    +     +AG  AG    ++C P +  K+R+Q    G+Y        N L  + + +   EG+ G+ RG+    +R  P+    FL Y+   + L
Sbjct:    2 AAGVLVG-------HPFDTVKVRLQVQSVSN--PKYRGTIHCFQSIIKQESTLGLYKGIGS------PMMGLTFINALVFGVQGNTLRYLGKD----TPLNQFLAGAAAGSIQCVICCPMELAKTRMQLQGTGEYKSRSKTYKNSLDCMVK-IYRKEGVRGINRGMVTTFLRETPSFGFYFLTYDYLTRYL 172          
BLAST of slc25a-23 vs. Ensembl Mouse
Match: Slc25a20 (solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20 [Source:MGI Symbol;Acc:MGI:1928738])

HSP 1 Score: 357.066 bits (915), Expect = 3.144e-123
Identity = 184/293 (62.80%), Postives = 217/293 (74.06%), Query Frame = 2
Query:   77 KEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            K I P K+ +AGG GG+C V VG PLDT+KVRLQ  P    G+ P+Y    DCF +TL  EG  G Y+GMAAP+IGVTPMFAVCFFG+ LG+KLQ K     L+ PQ+F AGMLSGVFTT IMTPGER+KCLLQ+Q ASSG  KY G  D  K+LY+E GIR  YKGT  TL+RD+PA+G YFM+YEWLK   TPEG   + LS  R L+AGGFAG+ NW V IPPD LKSR QTAP GKYPNG R V RE++  EG+  LY+G + V+IRAFPANAACFLG+E+A+K LN I
Sbjct:    6 KPISPFKNLLAGGFGGMCLVFVGHPLDTVKVRLQTQPPSLSGQPPMYSGTLDCFRKTLMREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKSPEDELSYPQLFTAGMLSGVFTTGIMTPGERIKCLLQIQ-ASSGENKYSGTLDCAKKLYQEFGIRGFYKGTVLTLMRDVPASGMYFMTYEWLKNLFTPEGKSVSDLSVPRILVAGGFAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIREEGVTSLYKGFNAVMIRAFPANAACFLGFEIAMKFLNWI 297          
BLAST of slc25a-23 vs. Ensembl Mouse
Match: Slc25a45 (solute carrier family 25, member 45 [Source:MGI Symbol;Acc:MGI:2147731])

HSP 1 Score: 155.221 bits (391), Expect = 1.282e-44
Identity = 99/296 (33.45%), Postives = 153/296 (51.69%), Query Frame = 2
Query:   89 PLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYN-----LGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGA-----SSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQ-TAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKL 943
            P++ F+AG + G   +V+G P DT+KVRLQ            Y+ + DC ++T ++E   GF+KGM+ P+  V  + +V F  Y+     L      +    P +   IF AG   G+     + P + +K  LQ Q       SS  P+Y+GP      + +E G + +++G+ A +LRD P  G YF++YE L    TPEG +    S+   L+AGGFAG+ +W+   P D +KSR+Q    +G+   G+          EG+   ++G++    RAFP NAA FL YE  L+L
Sbjct:    2 PVEEFVAGWISGAVGLVLGHPFDTVKVRLQTQST--------YQGIVDCVVKTYRHESVLGFFKGMSFPIASVALVNSVLFGVYSNTLLALTATSHQERRAQPPSYTNIFIAGCTGGLLQAYCLAPFDLIKVRLQNQTEPRMQISSSMPRYRGPVHCAASILREEGPQGLFRGSWALVLRDTPTLGMYFVTYEGLCRQYTPEGQNP---SSATVLVAGGFAGIASWITATPFDVIKSRMQMDGLKGRKYGGMLDCMASSFRQEGIGVFFKGMTLNSARAFPVNAATFLSYEYLLRL 286          
BLAST of slc25a-23 vs. Ensembl Mouse
Match: Slc25a45 (solute carrier family 25, member 45 [Source:MGI Symbol;Acc:MGI:2147731])

HSP 1 Score: 155.221 bits (391), Expect = 1.282e-44
Identity = 99/296 (33.45%), Postives = 153/296 (51.69%), Query Frame = 2
Query:   89 PLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYN-----LGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGA-----SSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQ-TAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKL 943
            P++ F+AG + G   +V+G P DT+KVRLQ            Y+ + DC ++T ++E   GF+KGM+ P+  V  + +V F  Y+     L      +    P +   IF AG   G+     + P + +K  LQ Q       SS  P+Y+GP      + +E G + +++G+ A +LRD P  G YF++YE L    TPEG +    S+   L+AGGFAG+ +W+   P D +KSR+Q    +G+   G+          EG+   ++G++    RAFP NAA FL YE  L+L
Sbjct:    2 PVEEFVAGWISGAVGLVLGHPFDTVKVRLQTQST--------YQGIVDCVVKTYRHESVLGFFKGMSFPIASVALVNSVLFGVYSNTLLALTATSHQERRAQPPSYTNIFIAGCTGGLLQAYCLAPFDLIKVRLQNQTEPRMQISSSMPRYRGPVHCAASILREEGPQGLFRGSWALVLRDTPTLGMYFVTYEGLCRQYTPEGQNP---SSATVLVAGGFAGIASWITATPFDVIKSRMQMDGLKGRKYGGMLDCMASSFRQEGIGVFFKGMTLNSARAFPVNAATFLSYEYLLRL 286          
BLAST of slc25a-23 vs. Ensembl Mouse
Match: Slc25a29 (solute carrier family 25 (mitochondrial carrier, palmitoylcarnitine transporter), member 29 [Source:MGI Symbol;Acc:MGI:2444911])

HSP 1 Score: 152.14 bits (383), Expect = 3.688e-43
Identity = 95/260 (36.54%), Postives = 138/260 (53.08%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPK-YKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYP--NGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACF 916
             P D +KVRLQ     KP     Y+    CF   +K E   G YKG+ +PL+G+T + A+  FG   G  L+   +++PL +   F AG  +G     I  P E  K  LQ+Q    GP + YKG  D + Q+Y+  G+R I +G  +TLLR+ P+ G YF++Y+ +  ++  E GD+  L   + L+AGG +G+ +WL   P D +KSRLQ       P   G+    R+    EG     RG++  L+RAFP NAA F
Sbjct:   20 HPFDIVKVRLQVQSTEKPQ----YRGTLHCFQSIIKQESVLGLYKGLGSPLMGLTFINAL-VFGVQ-GNTLRALGQDSPLNQ---FLAGAAAGAIQCVICCPMELAKTRLQLQAV--GPARTYKGSLDCLVQIYRHEGLRGINRGMVSTLLRETPSFGVYFLTYDVMTRAMGCEPGDR--LLVPKLLLAGGTSGITSWLSTYPMDVVKSRLQADGLQGTPRYRGIVDCMRQSYQAEGWQVFTRGLASTLLRAFPVNAATF 266          

HSP 2 Score: 85.5001 bits (210), Expect = 1.534e-18
Identity = 62/201 (30.85%), Postives = 96/201 (47.76%), Query Frame = 2
Query:   89 PLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSA 691
            PL  F+AG   G    V+  P++  K RLQ   +   G    YK   DC +Q  ++EG  G  +GM + L+  TP F V F  Y++  +    +    L  P++  AG  SG+ +     P + VK  LQ  G   G P+Y+G  D ++Q Y+  G +   +G A+TLLR  P     F +   +   LT   G++A + +
Sbjct:   92 PLNQFLAGAAAGAIQCVICCPMELAKTRLQLQAV---GPARTYKGSLDCLVQIYRHEGLRGINRGMVSTLLRETPSFGVYFLTYDVMTRAMGCEPGDRLLVPKLLLAGGTSGITSWLSTYPMDVVKSRLQADGL-QGTPRYRGIVDCMRQSYQAEGWQVFTRGLASTLLRAFPVNAATFATVTVV---LTYTRGEEAQVDS 285          

HSP 3 Score: 58.5362 bits (140), Expect = 2.674e-9
Identity = 52/183 (28.42%), Postives = 82/183 (44.81%), Query Frame = 2
Query:  401 FAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMS---YEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQ---TAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEM 931
            F AG   GV    +  P + VK  LQVQ  S+  P+Y+G     + + K+  +  +YKG  +      P  G  F++   +     +L   G D    S     +AG  AG    ++C P +  K+RLQ     P   Y   L  +  ++  +EGL G+ RG+   L+R  P+    FL Y++
Sbjct:    5 FLAGCAGGVAGVIVGHPFDIVKVRLQVQ--STEKPQYRGTLHCFQSIIKQESVLGLYKGLGS------PLMGLTFINALVFGVQGNTLRALGQD----SPLNQFLAGAAAGAIQCVICCPMELAKTRLQLQAVGPARTYKGSLDCLV-QIYRHEGLRGINRGMVSTLLRETPSFGVYFLTYDV 174          
BLAST of slc25a-23 vs. Ensembl Mouse
Match: Slc25a15 (solute carrier family 25 (mitochondrial carrier ornithine transporter), member 15 [Source:MGI Symbol;Acc:MGI:1342274])

HSP 1 Score: 149.828 bits (377), Expect = 2.431e-42
Identity = 98/275 (35.64%), Postives = 137/275 (49.82%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGY----NLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPAD----VVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLL 946
            QP DT+KV++Q  P        LY+ + DC L+T    G  GFYKG +  LI      +V F  Y     + RK+   D+   L+  Q  AAG  +  F   ++ P E VKC LQ         K     +    VVK+++++ G    Y G ++TLLR++P    +F  YE L  S    G  K  L     +++GGF G+C WL   P D +KSR+Q         GL   F  ++ NEG+  LY G+ P +IRAFPAN A FL YE + KL+
Sbjct:   28 QPFDTMKVKMQTFP-------DLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVVGLDQQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAASQNTVWSVVKEIFRKDGPLGFYHGLSSTLLREVPGYFFFFGGYE-LSRSFFASGRSKDELGPVPLMLSGGFGGICLWLAVYPVDCIKSRIQVLSMTGKQTGLVRTFLSIVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLM 294          
BLAST of slc25a-23 vs. UniProt/SwissProt
Match: sp|O43772|MCAT_HUMAN (Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens OX=9606 GN=SLC25A20 PE=1 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 4.220e-124
Identity = 187/291 (64.26%), Postives = 221/291 (75.95%), Query Frame = 2
Query:   77 KEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            K I PLK+ +AGG GG+C V VG PLDT+KVRLQ  P   PG+ P+Y    DCF +TL  EG  G Y+GMAAP+IGVTPMFAVCFFG+ LG+KLQ K     L+ PQ+FAAGMLSGVFTT IMTPGER+KCLLQ+Q ASSG  KY G  D  K+LY+E GIR IYKGT  TL+RD+PA+G YFM+YEWLK   TPEG   + LSA R L+AGG AG+ NW V IPPD LKSR QTAP GKYPNG R V RE++ +EG+  LY+G + V+IRAFPANAACFLG+E+A+K LN
Sbjct:    6 KPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQ-ASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLN 295          

HSP 2 Score: 64.6994 bits (156), Expect = 1.481e-10
Identity = 39/95 (41.05%), Postives = 54/95 (56.84%), Query Frame = 2
Query:  683 LSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPE---GKYP--NGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            +S  + L+AGGF G+C   V  P DT+K RLQT P    G+ P  +G    FR+ +  EG+ GLYRG++  +I   P  A CF G+ +  KL  K
Sbjct:    8 ISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQK 102          
BLAST of slc25a-23 vs. UniProt/SwissProt
Match: sp|Q8HXY2|MCAT_MACFA (Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis OX=9541 GN=SLC25A20 PE=2 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 5.090e-123
Identity = 184/291 (63.23%), Postives = 220/291 (75.60%), Query Frame = 2
Query:   77 KEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            K I PLK+ +AGG GG+C V VG PLDT+KVRLQ  P   PG+ P+Y    DCF +TL  EG  G Y+GMAAP+IGVTPMFAVCFFG+ LG+KLQ K     L+ PQ+FAAGMLSG+FTT IMTPGER+KCLLQ+Q ASSG  KY G  D  K+LY+E GIR IYKGT  TL+RD+PA+G YFM+YEW+K   TPEG   + LS  R L+AGG AG+ NW V IPPD LKSR QTAP GKYPNG R V RE++ +EG+  LY+G + V+IRAFPANAACFLG+E+A+K LN
Sbjct:    6 KPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGIRGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGIFTTGIMTPGERIKCLLQIQ-ASSGETKYTGTLDCAKKLYQEFGIRGIYKGTVVTLMRDVPASGMYFMTYEWVKNIFTPEGKRVSELSVPRVLVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIPDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLN 295          

HSP 2 Score: 63.929 bits (154), Expect = 2.687e-10
Identity = 39/95 (41.05%), Postives = 54/95 (56.84%), Query Frame = 2
Query:  683 LSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPE---GKYP--NGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            +S  + L+AGGF G+C   V  P DT+K RLQT P    G+ P  +G    FR+ +  EG+ GLYRG++  +I   P  A CF G+ +  KL  K
Sbjct:    8 ISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGIRGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQK 102          
BLAST of slc25a-23 vs. UniProt/SwissProt
Match: sp|P97521|MCAT_RAT (Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus OX=10116 GN=Slc25a20 PE=1 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 1.656e-122
Identity = 184/293 (62.80%), Postives = 219/293 (74.74%), Query Frame = 2
Query:   77 KEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            K I PLK+ +AGG GG+C V VG PLDT+KVRLQ  P   PG+ P+Y    DCF +TL  EG  G Y+GMAAP+IGVTPMFAVCFFG+ LG++LQ K     LT PQ+F AGMLSGVFTT IMTPGER+KCLLQ+Q ASSG  KY G  D  K+LY+E GIR  YKGTA TL+RD+PA+G YFM+YEWLK   TP+G     LS  R L+AGGF G+ NW+V IPPD LKSR QTAP GKYPNG R V RE++  EG+  LY+G + V+IRAFPANAACFLG+E+ +K+LN I
Sbjct:    6 KPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTIDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKRLQQKSPEDELTYPQLFTAGMLSGVFTTGIMTPGERIKCLLQIQ-ASSGKNKYSGTLDCAKKLYQEFGIRGFYKGTALTLMRDVPASGMYFMTYEWLKNLFTPQGKSVHDLSVPRVLVAGGFRGIFNWVVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIREEGVTSLYKGFNAVMIRAFPANAACFLGFEIPMKILNWI 297          
BLAST of slc25a-23 vs. UniProt/SwissProt
Match: sp|Q9Z2Z6|MCAT_MOUSE (Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus OX=10090 GN=Slc25a20 PE=1 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 2.199e-122
Identity = 184/293 (62.80%), Postives = 217/293 (74.06%), Query Frame = 2
Query:   77 KEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            K I P K+ +AGG GG+C V VG PLDT+KVRLQ  P    G+ P+Y    DCF +TL  EG  G Y+GMAAP+IGVTPMFAVCFFG+ LG+KLQ K     L+ PQ+F AGMLSGVFTT IMTPGER+KCLLQ+Q ASSG  KY G  D  K+LY+E GIR  YKGT  TL+RD+PA+G YFM+YEWLK   TPEG   + LS  R L+AGGFAG+ NW V IPPD LKSR QTAP GKYPNG R V RE++  EG+  LY+G + V+IRAFPANAACFLG+E+A+K LN I
Sbjct:    6 KPISPFKNLLAGGFGGMCLVFVGHPLDTVKVRLQTQPPSLSGQPPMYSGTLDCFRKTLMREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKSPEDELSYPQLFTAGMLSGVFTTGIMTPGERIKCLLQIQ-ASSGENKYSGTLDCAKKLYQEFGIRGFYKGTVLTLMRDVPASGMYFMTYEWLKNLFTPEGKSVSDLSVPRILVAGGFAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIREEGVTSLYKGFNAVMIRAFPANAACFLGFEIAMKFLNWI 297          
BLAST of slc25a-23 vs. UniProt/SwissProt
Match: sp|Q9VQG4|COLT_DROME (Congested-like trachea protein OS=Drosophila melanogaster OX=7227 GN=colt PE=2 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 1.073e-108
Identity = 161/298 (54.03%), Postives = 213/298 (71.48%), Query Frame = 2
Query:   62 NNMSNKEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            N  + ++ +P+KSF+ GG GGIC V+ G PLDTIKVRLQ MP P PGE PLY+   DC  +T+KNEG  G YKGM+APL GV P+FA+CF GY LG++LQ + E+  LT PQIF AG  SG+F+T IM PGER+K LLQ Q    G  KY G  D   +LYKEGG+RS++KG+ AT+LRD+PA G YF+ YE L++ +     +   +S   T+ AGG AGM  W++ +P D LKSRLQ+APEG Y +G+RSVF++++  +G + LYRGV+P+++RAFPANAACF G E+A K  N +
Sbjct:    6 NVSTERKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQD-VAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIELANKFFNIV 302          
BLAST of slc25a-23 vs. TrEMBL
Match: A0A0H3YJ78 (Slc25a-23 OS=Schmidtea mediterranea OX=79327 GN=slc25a-23 PE=2 SV=1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 296/296 (100.00%), Postives = 296/296 (100.00%), Query Frame = 2
Query:   68 MSNKEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            MSNKEIHPLKSFIAGGVGGICTVVVGQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI
Sbjct:    1 MSNKEIHPLKSFIAGGVGGICTVVVGQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 296          
BLAST of slc25a-23 vs. TrEMBL
Match: A0A0P4WB87 (Uncharacterized protein OS=Scylla olivacea OX=85551 PE=3 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 6.212e-136
Identity = 202/291 (69.42%), Postives = 233/291 (80.07%), Query Frame = 2
Query:   83 IHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            + P+K F+AGG GG+C V  G PLDTIKVRLQ  P+P PG+ PLY    DC L+T++NEG FG YKGMAAPL+GVTPMFAVCF G+ +G+KLQ    +  LT  Q+F AGMLSGVFTTAIMTPGER+KCLLQVQ ASSGP  YKGP DVVK LY+EGGIRSIYKGT ATLLRD+PA+G YFMSYEWLK S+ P  G +  LS  RT++AGG AGM NWLV I PD LKSRLQTAPEGKYPNG+RSVF E+M NEG   L++G +PV+IRAFPANAACFLGYE+A+K LN I
Sbjct:    4 VSPIKDFLAGGFGGMCLVAAGHPLDTIKVRLQTQPLPAPGQKPLYAGTWDCALKTIRNEGFFGLYKGMAAPLVGVTPMFAVCFLGFGIGKKLQQTTPDQKLTAVQLFNAGMLSGVFTTAIMTPGERIKCLLQVQAASSGPKLYKGPIDVVKVLYREGGIRSIYKGTCATLLRDVPASGMYFMSYEWLKRSMAP-AGKEGELSPIRTVVAGGIAGMLNWLVAIGPDVLKSRLQTAPEGKYPNGIRSVFVEIMKNEGPQALFKGATPVMIRAFPANAACFLGYEVAIKFLNMI 293          
BLAST of slc25a-23 vs. TrEMBL
Match: V5H1M7 (Putative mitochondrial carnitine/acylcarnitine carrier protein OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 1.638e-134
Identity = 201/294 (68.37%), Postives = 233/294 (79.25%), Query Frame = 2
Query:   74 NKEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGAS--SGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
             K+I P+K  IAGG GG CTVV G PLDTIKVRLQ MP P PGELPLY    DC  +T+  EG  G YKGMAAPL GVTPMFAVCF G+ +G+KLQ K     LT PQ+FAAGMLSGVFTTAIM PGER+KCLLQVQ AS  S   ++ GP D  KQLY+EGGIRSIYKGTAATLLRD+PA+G YFMSYEWL+ +L PEGG ++ LS G+TL AGG AG+ NW+V IPPD LKSRLQTAPEG YPNG+R VFRE+M  +G+ G+Y+G +PV+IRAFPANAACF+GYE+A+K LN
Sbjct:    4 KKKISPVKDLIAGGFGGFCTVVSGHPLDTIKVRLQTMPRPAPGELPLYAGTFDCARKTVVREGFKGLYKGMAAPLTGVTPMFAVCFLGFGVGKKLQQKHPEDDLTLPQLFAAGMLSGVFTTAIMAPGERIKCLLQVQQASADSSKARFAGPVDCAKQLYREGGIRSIYKGTAATLLRDVPASGMYFMSYEWLQRALLPEGGSRSDLSVGKTLFAGGMAGIFNWMVAIPPDVLKSRLQTAPEGMYPNGIRDVFREVMRTDGIRGMYKGTAPVMIRAFPANAACFMGYEVAMKFLN 297          

HSP 2 Score: 61.2326 bits (147), Expect = 7.668e-7
Identity = 39/98 (39.80%), Postives = 51/98 (52.04%), Query Frame = 2
Query:  674 KAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPE---GKYP--NGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            K  +S  + LIAGGF G C  +   P DT+K RLQT P    G+ P   G     R+ +  EG  GLY+G++  L    P  A CFLG+ +  KL  K
Sbjct:    4 KKKISPVKDLIAGGFGGFCTVVSGHPLDTIKVRLQTMPRPAPGELPLYAGTFDCARKTVVREGFKGLYKGMAAPLTGVTPMFAVCFLGFGVGKKLQQK 101          
BLAST of slc25a-23 vs. TrEMBL
Match: A0A131Y3C4 (Putative mitochondrial ornithine transporter OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 1.994e-134
Identity = 201/297 (67.68%), Postives = 235/297 (79.12%), Query Frame = 2
Query:   68 MSNK-EIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGAS--SGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            MS K +I P+K F AGG GGIC +  G PLDTIKVRLQ MP P PGELPLY    DC  +T+  EG  G YKGMAAPL GVTPMFAVCF G+ +G+KLQ K+    LT PQ+FAAGMLSGVFTTAIM PGER+KCLLQVQ AS  S   ++ GP D  KQLY+EGGIRSIYKGTAATLLRD+PA+G YFMSYEWL+ +L PEGG ++ LS G+TL AGG AG+ NW+V IPPD LKSRLQTAPEG YPNG+R VFRE+M  +G+ G+Y+G +PV+IRAFPANAACF+GYE+A+K LN
Sbjct:    1 MSEKPKISPIKDFFAGGFGGICLIFTGHPLDTIKVRLQTMPRPAPGELPLYAGTFDCARKTVVREGFKGLYKGMAAPLTGVTPMFAVCFLGFGVGKKLQQKNPEDDLTLPQLFAAGMLSGVFTTAIMAPGERIKCLLQVQQASADSSKARFAGPVDCAKQLYREGGIRSIYKGTAATLLRDVPASGMYFMSYEWLQRALLPEGGSRSDLSVGKTLFAGGMAGIFNWMVAIPPDVLKSRLQTAPEGMYPNGIRDVFREVMRTDGIRGMYKGTAPVMIRAFPANAACFMGYEVAMKFLN 297          

HSP 2 Score: 58.151 bits (139), Expect = 8.235e-6
Identity = 37/99 (37.37%), Postives = 50/99 (50.51%), Query Frame = 2
Query:  671 DKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPE---GKYP--NGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            +K  +S  +   AGGF G+C      P DT+K RLQT P    G+ P   G     R+ +  EG  GLY+G++  L    P  A CFLG+ +  KL  K
Sbjct:    3 EKPKISPIKDFFAGGFGGICLIFTGHPLDTIKVRLQTMPRPAPGELPLYAGTFDCARKTVVREGFKGLYKGMAAPLTGVTPMFAVCFLGFGVGKKLQQK 101          
BLAST of slc25a-23 vs. TrEMBL
Match: A0A0K8REX4 (Putative mitochondrial carnitine-acylcarnitine carrier protein OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 3.560e-134
Identity = 201/297 (67.68%), Postives = 234/297 (78.79%), Query Frame = 2
Query:   68 MSNK-EIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGAS--SGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            MS K +I P+K F AGG GGIC +  G PLDTIKVRLQ MP P PGELPLY    DC  +T+  EG  G YKGMAAPL GVTPMFAVCF G+ +G+KLQ K     LT PQ+FAAGMLSGVFTTAIM PGER+KCLLQVQ AS  S   ++ GP D  KQLY+EGGIRSIYKGTAATLLRD+PA+G YFMSYEWL+ +L PEGG ++ LS G+TL AGG AG+ NW+V IPPD LKSRLQTAPEG YPNG+R VFRE+M  +G+ G+Y+G +PV+IRAFPANAACF+GYE+A+K LN
Sbjct:    1 MSEKPKISPIKDFFAGGFGGICLIFTGHPLDTIKVRLQTMPRPAPGELPLYAGTFDCARKTVVREGFKGLYKGMAAPLTGVTPMFAVCFLGFGVGKKLQQKHPEDDLTLPQLFAAGMLSGVFTTAIMAPGERIKCLLQVQQASADSSKARFAGPVDCAKQLYREGGIRSIYKGTAATLLRDVPASGMYFMSYEWLQRALLPEGGSRSDLSVGKTLFAGGMAGIFNWMVAIPPDVLKSRLQTAPEGMYPNGIRDVFREVMRTDGIRGMYKGTAPVMIRAFPANAACFMGYEVAMKFLN 297          

HSP 2 Score: 58.151 bits (139), Expect = 7.514e-6
Identity = 37/99 (37.37%), Postives = 50/99 (50.51%), Query Frame = 2
Query:  671 DKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPE---GKYP--NGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            +K  +S  +   AGGF G+C      P DT+K RLQT P    G+ P   G     R+ +  EG  GLY+G++  L    P  A CFLG+ +  KL  K
Sbjct:    3 EKPKISPIKDFFAGGFGGICLIFTGHPLDTIKVRLQTMPRPAPGELPLYAGTFDCARKTVVREGFKGLYKGMAAPLTGVTPMFAVCFLGFGVGKKLQQK 101          
BLAST of slc25a-23 vs. Ensembl Cavefish
Match: slc25a20 (solute carrier family 25 member 20 [Source:NCBI gene;Acc:103039532])

HSP 1 Score: 370.163 bits (949), Expect = 1.860e-128
Identity = 190/291 (65.29%), Postives = 221/291 (75.95%), Query Frame = 2
Query:   83 IHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            I P+K+F AGG GG+C V  G PLDTIKVRLQ  P P PG+ PLY    DC  +TL  EG  G YKGMAAP+IGVTPMFAVCFFG+ LG+KLQ K  +  L+ PQ+FAAGMLSGVFTTAIM PGER+KCLLQ+Q A+SG  KY GP D VKQ+Y+E GIR IYKGTA TL+RD+PA+G YFM+YEWLK  LTPEG     LS    L AGG AG+ NW V IPPD LKSR QTAPEGKYPNG R V RE++  EG+  LY+G + V++RAFPANAACFLG+E+A+K LN I
Sbjct:    8 ISPVKNFFAGGFGGVCLVFAGHPLDTIKVRLQTQPKPGPGQTPLYAGTFDCCKKTLAKEGVRGLYKGMAAPIIGVTPMFAVCFFGFGLGKKLQQKSPDDILSYPQLFAAGMLSGVFTTAIMAPGERIKCLLQIQ-AASGEVKYAGPMDCVKQIYRESGIRGIYKGTALTLMRDVPASGMYFMTYEWLKNLLTPEGKSPNELSVPSVLFAGGMAGIFNWAVAIPPDVLKSRFQTAPEGKYPNGFRDVLRELIREEGVASLYKGFNAVMLRAFPANAACFLGFELAMKFLNYI 297          
BLAST of slc25a-23 vs. Ensembl Cavefish
Match: si:dkey-150i13.2 (mitochondrial carnitine/acylcarnitine carrier protein-like [Source:NCBI gene;Acc:103035997])

HSP 1 Score: 311.227 bits (796), Expect = 2.604e-105
Identity = 161/292 (55.14%), Postives = 205/292 (70.21%), Query Frame = 2
Query:   74 NKEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
             + + PLK+F+AGGVGG C +  G PLDTIKVRLQ  P     +  +Y    DC  +T+  EG  G YKGM APL GV PM A+ FFG+ LG++L   D + P T  QI+ AGML+GVFTT I+ PGER+KCLLQVQ +S+G  KY GP D   +LYKE GIRS+YKGT  TL+RD+P++G YF++YE+LK  LTPEG     LS  R L+AGG AG+ NW++ +PPD LKS  QTA +G+Y  GL  V R ++  EG   LY+G+S V++RAFPANAACFLG+E+ALK LN
Sbjct:    8 ERRVSPLKNFVAGGVGGACLLFAGHPLDTIKVRLQTQPKASGPQYVIYTGTYDCLRKTVSREGVLGLYKGMGAPLAGVAPMMAISFFGFGLGKQLLQSDPSVPHTYTQIYLAGMLAGVFTTVIVAPGERIKCLLQVQ-SSAGQLKYAGPMDCAVRLYKEQGIRSVYKGTVLTLIRDVPSSGLYFLTYEYLKHVLTPEGQSVQQLSTPRILLAGGTAGILNWVIALPPDVLKSNFQTAADGRY-KGLVDVLRTLIREEGAKALYKGLSAVMLRAFPANAACFLGFEVALKCLN 297          
BLAST of slc25a-23 vs. Ensembl Cavefish
Match: slc25a29 (solute carrier family 25 member 29 [Source:NCBI gene;Acc:103030089])

HSP 1 Score: 152.14 bits (383), Expect = 2.642e-43
Identity = 96/263 (36.50%), Postives = 140/263 (53.23%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGA----SSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQT-APEGKYP-NGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACF 916
             P DT+KVRLQ     KP    LYK    CF   ++ E   G YKG+ +P++G+T + A+  FG   G  +++  ++TPL +   F AG  +G   + I  P E  K  +Q+QG     SS    YK   D + ++Y+  G+R I +G   TL+R+ P  G YF++Y+ L  SL  E  D   +   + L AGG +G+ +WL   P D +KSRLQ     GKY  + +    R+ +  EGL    RG++  L+RAFP NAA F
Sbjct:   18 HPFDTVKVRLQVQSADKP----LYKGTIHCFQSIIRQESLLGLYKGIGSPMMGLTFINAI-VFGVQ-GNTMRLLGKDTPLNQ---FLAGAAAGSIQSVICCPMELAKTRMQMQGTGVKKSSTRKVYKNSLDCLARIYQREGLRGINRGMVTTLIRETPGFGVYFLAYDVLTRSLGCEPEDPYMIP--KLLFAGGMSGIASWLSTYPVDVIKSRLQADGVGGKYQYSSIMDCTRKSIEREGLRVFTRGLTSTLLRAFPVNAATF 269          

HSP 2 Score: 74.7146 bits (182), Expect = 6.912e-15
Identity = 60/191 (31.41%), Postives = 89/191 (46.60%), Query Frame = 2
Query:   89 PLKSFIAXXXXXXXXXXXXQPLDTIKVRLQ--AMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYN-LGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIP------ATGTYFMSY 634
            PL  F+AG   G    V+  P++  K R+Q     + K     +YK+  DC  +  + EG  G  +GM   LI  TP F V F  Y+ L R L  + E+ P   P++  AG +SG+ +     P + +K  LQ  G   G  +Y    D  ++  +  G+R   +G  +TLLR  P      AT T F+ Y
Sbjct:   90 PLNQFLAGAAAGSIQSVICCPMELAKTRMQMQGTGVKKSSTRKVYKNSLDCLARIYQREGLRGINRGMVTTLIRETPGFGVYFLAYDVLTRSLGCEPED-PYMIPKLLFAGGMSGIASWLSTYPVDVIKSRLQADGV-GGKYQYSSIMDCTRKSIEREGLRVFTRGLTSTLLRAFPVNAATFATVTLFLMY 278          

HSP 3 Score: 59.3066 bits (142), Expect = 1.423e-9
Identity = 50/193 (25.91%), Postives = 79/193 (40.93%), Query Frame = 2
Query:  401 FAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRT----LIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMM-------ANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLL 946
            F AG + G     +  P + VK  LQVQ A    P YKG     + + ++  +  +YKG            G+  M   ++   +    G+   L    T     +AG  AG    ++C P +  K+R+Q    G   +  R V++  +         EGL G+ RG+   LIR  P     FL Y++  + L
Sbjct:    3 FLAGCIGGAAGVLVGHPFDTVKVRLQVQSADK--PLYKGTIHCFQSIIRQESLLGLYKGI-----------GSPMMGLTFINAIVFGVQGNTMRLLGKDTPLNQFLAGAAAGSIQSVICCPMELAKTRMQMQGTGVKKSSTRKVYKNSLDCLARIYQREGLRGINRGMVTTLIRETPGFGVYFLAYDVLTRSL 182          
BLAST of slc25a-23 vs. Ensembl Cavefish
Match: SLC25A45 (solute carrier family 25 member 45 [Source:NCBI gene;Acc:103042612])

HSP 1 Score: 144.05 bits (362), Expect = 2.323e-40
Identity = 99/299 (33.11%), Postives = 147/299 (49.16%), Query Frame = 2
Query:   89 PLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLG--------RKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGP---PKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQ-TAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            P   FIAG + G   +V+G P+DT+KVRLQ   I        YK + DC ++T  +EG  GF KGMA P++ V    +V F  Y+           K + +    PL    +F AG +SG+    + +P + VK  LQ Q          +Y+ P   +  + +E G R +++G  A  LRD+P  G YF+ YE     LT +G + +  +    LIAGG AG+  W    P D +K+RLQ +   G+   G        +  EG+   ++G+    +RAFP NA  FL YEM L+ + 
Sbjct:    2 PFVEFIAGWISGAVGLVLGHPMDTVKVRLQTQSI--------YKGIFDCVVRTYTHEGFHGFLKGMAFPVLSVAVSNSVAFGSYSNALDYITQSQHKERAQGNKAPLWA--VFTAGCVSGMMQVLVTSPIDLVKVRLQNQTEGRSELDRARYRSPWHCMVMIVREDGARGLFRGVTALALRDVPCFGLYFLPYELTCRMLTEKGKEPSTYA---ILIAGGIAGVVTWSCATPMDVIKARLQMSGAGGRVYKGTLHCIITSLREEGIRVFFKGLLLNSLRAFPVNAVTFLSYEMLLRYMT 287          

HSP 2 Score: 69.707 bits (169), Expect = 3.861e-13
Identity = 60/197 (30.46%), Postives = 90/197 (45.69%), Query Frame = 2
Query:  401 FAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTA----ATLLRDIPATGTYFMSYEWLKESLTPE--GGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFRE-------MMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            F AG +SG     +  P + VK  LQ Q        YKG  D V + Y   G     KG A    +  + +  A G+Y  + +++ +S   E   G+KA L A     AG  +GM   LV  P D +K RLQ   EG+     R+ +R        ++  +G  GL+RGV+ + +R  P     FL YE+  ++L +
Sbjct:    6 FIAGWISGAVGLVLGHPMDTVKVRLQTQSI------YKGIFDCVVRTYTHEGFHGFLKGMAFPVLSVAVSNSVAFGSYSNALDYITQSQHKERAQGNKAPLWA--VFTAGCVSGMMQVLVTSPIDLVKVRLQNQTEGRSELD-RARYRSPWHCMVMIVREDGARGLFRGVTALALRDVPCFGLYFLPYELTCRMLTE 193          
BLAST of slc25a-23 vs. Ensembl Cavefish
Match: slc25a15a (mitochondrial ornithine transporter 1 [Source:NCBI gene;Acc:103032405])

HSP 1 Score: 135.961 bits (341), Expect = 3.436e-37
Identity = 89/281 (31.67%), Postives = 131/281 (46.62%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVK-----DENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPA-----DVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPE--GGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            QP DT KV++Q  P        +Y+    CF+   K  G  G Y+G    L+      AV F  Y   + + V+     +  T L+  Q   +G ++ +F++  + P E VKC LQ         K           VV+ + K  G    Y+G   T++R+IP    +F  YE L  SL     G  K  +     + +GGF G C W+V  P D +KSR+Q        +G    F  ++ NEG+  LY G++P LIR FPAN A FL YE++ K++ K
Sbjct:   28 QPFDTAKVKMQTFP-------NMYRGFVHCFVSISKQLGLRGLYQGTTPALLANIAENAVLFMSYGFCQDV-VRFTIGLERGTELSDIQKACSGSVASIFSSLALCPTELVKCRLQAMHEMEASGKIASGQKSTVWSVVRNVLKTNGPLGFYQGLTTTIVREIPGYFCFFGGYE-LSRSLFARAMGRSKEDIGVVPLMFSGGFGGACLWIVVYPIDCVKSRIQVLSLAGRQDGFLKTFMSIVRNEGVRPLYSGLTPTLIRTFPANGALFLAYELSRKMMMK 299          
BLAST of slc25a-23 vs. Ensembl Sea Lamprey
Match: slc25a20 (solute carrier family 25 member 20 [Source:ZFIN;Acc:ZDB-GENE-040426-1869])

HSP 1 Score: 344.739 bits (883), Expect = 1.058e-119
Identity = 168/264 (63.64%), Postives = 199/264 (75.38%), Query Frame = 2
Query:  158 TIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            T +VRLQ  P P PGE PLY    DC  +TL  EG  G YKGMAAPL+GV PMFAVCFFG+ LG+K Q       LT  Q+F AGMLSGVFTT IM PGER+KCLLQVQ A++G  KY GP D VKQ+Y+E GIR +YKGTA TL+RD+PA+G YFM+YEWLK  LTPEGG  + LS  + L AGG AG+ NW V IPPDTLKSR QTAPEGKYP+G R V RE++  EG++ LY+G + V++RAFPANAACFLG+E+A+K LN
Sbjct:    1 TPQVRLQTQPRPLPGESPLYAGTFDCCRKTLAKEGLRGLYKGMAAPLVGVAPMFAVCFFGFGLGKKFQQTHPEDSLTYIQLFKAGMLSGVFTTVIMAPGERIKCLLQVQ-ANTGGIKYAGPMDCVKQIYRESGIRGVYKGTALTLMRDVPASGMYFMTYEWLKNVLTPEGGSVSDLSIPKILFAGGMAGIFNWAVAIPPDTLKSRFQTAPEGKYPHGFRDVLRELVREEGVLSLYKGFTAVMLRAFPANAACFLGFEVAMKFLN 263          
BLAST of slc25a-23 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008980.1 (pep scaffold:Pmarinus_7.0:GL478832:29230:40541:-1 gene:ENSPMAG00000008118.1 transcript:ENSPMAT00000008980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 9.775e-30
Identity = 88/266 (33.08%), Postives = 127/266 (47.74%), Query Frame = 2
Query:  149 PLDTIKVRLQAMPIPKP--GELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGR-KLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYP--NGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEM 931
            P+D +K R+Q         GEL +YK+  DCF + ++ EG FG Y+G+   L+GV P  A+     +L R K   +D++ PL    I  AG  +G        P E VK  LQV G  +  P+     +V++ L    G   +YKG  A  LRDIP +  YF  Y   K S   E   K H+     L AG  AGM    +  P D +K+RLQ A        +G+   FR++++ EG   L++G    + R+ P      L YE+
Sbjct:    9 PIDLVKTRMQNQRSTGSFVGEL-MYKNSFDCFKKVVRYEGVFGLYRGLIPQLLGVAPEKAIKLTMNDLIRDKFTKRDKSIPLIGEII--AGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSA-LNVLRDL----GFLGLYKGAKACFLRDIPFSAIYFPVYAHTKSSFADE---KGHVGPLHLLTAGAIAGMPAASLVTPADVIKTRLQVAARAGQTTYSGVIDCFRKILSEEGPRALWKGAGARVCRSSPQFGVTLLTYEL 263          

HSP 2 Score: 70.8626 bits (172), Expect = 5.067e-14
Identity = 57/201 (28.36%), Postives = 95/201 (47.26%), Query Frame = 2
Query:   74 NKEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDK 676
            +K I  +   IAGG  G   V+   PL+ +K+RLQ       GE+     ++   L  L++ G  G YKG  A  +   P F+  +F      K    DE   +    +  AG ++G+   +++TP + +K  LQV  A +G   Y G  D  +++  E G R+++KG  A + R  P  G   ++YE L++    + G +
Sbjct:   84 DKSIPLIGEIIAGGCAGGSQVIFTNPLEIVKIRLQVA-----GEITTGPRVSA--LNVLRDLGFLGLYKGAKACFLRDIP-FSAIYFPVYAHTKSSFADEKGHVGPLHLLTAGAIAGMPAASLVTPADVIKTRLQV-AARAGQTTYSGVIDCFRKILSEEGPRALWKGAGARVCRSSPQFGVTLLTYELLQQWFHVDFGGR 275          
BLAST of slc25a-23 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006621.1 (pep scaffold:Pmarinus_7.0:GL477233:35245:42511:-1 gene:ENSPMAG00000005981.1 transcript:ENSPMAT00000006621.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.768 bits (273), Expect = 5.742e-28
Identity = 84/280 (30.00%), Postives = 127/280 (45.36%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLI---GVTPMFAVCF-FGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQV--QGASSGPPKYK----GPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLR-SVFREMM-------ANEGLIGLYRGVSPVLIRAFPANAACFLGYEM 931
            QP DT KV++Q  P        LY     C  QT + EG +G Y+G    LI   G   M  +C+ F   L  +L    E + L+  Q+  AG L+  FT  ++ P E VKC +Q   +  ++G   +         V + + +  G+  +Y G ++T +RD+P    +F   E  K   TP G  K  L      ++G + G+ N   C+   T    L         + L  S+F+  +       A   ++ LY G +P +IRAFPANAA FL YE+
Sbjct:   28 QPFDTAKVKMQTFP-------KLYNGFVSCLGQTYRAEGMWGLYRGSFPALIANIGENAMLFLCYGFCQRLVARLSHLQEGSRLSNMQMATAGSLAAGFTAIVICPLELVKCRMQAMREMHAAGKTVFTMADCTAVAVTRNVLRVDGLLGLYNGLSSTWMRDMPGYFCFFWGNEVCKTLFTPPGKTKDDLVPSVHFLSG-YIGLLNH--CLFAHTFIDPLTRLSTHSMTHQLACSLFQSFVQSLTSKVATSCIMALYSGFTPTIIRAFPANAALFLAYEL 297          

HSP 2 Score: 49.2914 bits (116), Expect = 5.472e-7
Identity = 40/161 (24.84%), Postives = 68/161 (42.24%), Query Frame = 2
Query:  500 PPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLT--PEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPE----GKYPNGLR-----SVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            P  Y G    + Q Y+  G+  +Y+G+   L+ +I      F+ Y + +  +       + + LS  +   AG  A     +V  P + +K R+Q   E    GK    +      +V R ++  +GL+GLY G+S   +R  P     F G E+   L  
Sbjct:   41 PKLYNGFVSCLGQTYRAEGMWGLYRGSFPALIANIGENAMLFLCYGFCQRLVARLSHLQEGSRLSNMQMATAGSLAAGFTAIVICPLELVKCRMQAMREMHAAGKTVFTMADCTAVAVTRNVLRVDGLLGLYNGLSSTWMRDMPGYFCFFWGNEVCKTLFT 201          
BLAST of slc25a-23 vs. Ensembl Sea Lamprey
Match: slc25a48 (solute carrier family 25 member 48 [Source:NCBI gene;Acc:436640])

HSP 1 Score: 100.138 bits (248), Expect = 1.086e-24
Identity = 79/280 (28.21%), Postives = 118/280 (42.14%), Query Frame = 2
Query:  266 FGFYKGMAAPLIGVTPMFAVCFFGYNLGRKL----------------QVKDENTPLTKP--QIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPK--------------------------------YKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQT--APEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
              F+KGM+ PL  +    ++ F  ++  R++                Q   +  P   P  ++  A  L+G  +  +  P + VK  LQ+Q  + G                                   Y+GP   V      GG+R +Y+G  A LLRD+P   TYF+ Y  L +  TP G  +   S G   +AGG AG  +W +  P D +KSRLQ     E KY  G     +     EGL   +RG++  L+R FP +AA FL YE +L+ + 
Sbjct:    5 LAFFKGMSFPLASIAAYNSLVFGVFSTSRRVLESLRPPVGSGVPGSHQHAADAAPTRTPVSELMLASALTGAVSVTVGAPVDLVKIRLQMQTQNLGIAPMMSSLRSMPLPPAPPAPRALHVAPLGLQPCSLYRGPIHCVWLTVSRGGLRGLYRGAGAMLLRDVPGYCTYFVPYVLLCQLFTPSG--QPEPSMGAIWVAGGLAGSLSWGLATPFDVVKSRLQADGVVETKY-TGAWHCAQHSYRAEGLGVFFRGLTVNLVRGFPMSAAAFLAYEFSLRAIR 281          

HSP 2 Score: 57.3806 bits (137), Expect = 1.039e-9
Identity = 39/143 (27.27%), Postives = 61/143 (42.66%), Query Frame = 2
Query:  212 LYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEW 640
            LY+    C   T+   G  G Y+G  A L+   P +   F  Y L  +L         +   I+ AG L+G  +  + TP + VK  LQ  G      KY G     +  Y+  G+   ++G    L+R  P +   F++YE+
Sbjct:  135 LYRGPIHCVWLTVSRGGLRGLYRGAGAMLLRDVPGYCTYFVPYVLLCQLFTPSGQPEPSMGAIWVAGGLAGSLSWGLATPFDVVKSRLQADGVVE--TKYTGAWHCAQHSYRAEGLGVFFRGLTVNLVRGFPMSAAAFLAYEF 275          
BLAST of slc25a-23 vs. Ensembl Sea Lamprey
Match: SLC25A40 (solute carrier family 25 member 40 [Source:HGNC Symbol;Acc:HGNC:29680])

HSP 1 Score: 92.4337 bits (228), Expect = 1.387e-21
Identity = 76/310 (24.52%), Postives = 132/310 (42.58%), Query Frame = 2
Query:  149 PLDTIKVRLQAMPIP-KPGELPLY---------------------------KSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQI-FAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKA-----HLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTA------PEGKYPN-GLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            PLD +K+RLQA   P   G+  +Y                               D F+Q +++EG    + G+   L+   P   + F  Y+L R    +  N+    P I F AG ++ +    +++P E ++  +Q     S    YK  ++ V+    + G RS+++G   T+ RD+P +G Y+++YE +K  L    G        H ++G   ++G FAG+      +P D +K+R Q         +G + +    +  + +    GL GL+ G  P +I+  PA A     YE       K+
Sbjct:    3 PLDVVKIRLQAQQTPFYKGKCFVYCNGLMDHLCVCMNGNSKAWYKPAPGYVNGTLDAFVQIVRHEGVASLWSGLQPTLVMAVPATVIYFTSYDLLRDSLARHFNS--QHPSIPFVAGAVARLGAVTVISPLELIRTKMQ-----SRQLTYKELSECVRHSLAQDGWRSLWRGWGPTVFRDVPFSGLYWLNYELIKHGLMGSAGVNQATFLIHFTSG--AVSGTFAGIAT----LPFDVVKTRRQIELGEMEITKGAFRDISTWAAMKRIYWESGLRGLFAGFLPRVIKVAPACAIMISTYEFGKSFFRKL 299          
BLAST of slc25a-23 vs. Ensembl Yeast
Match: CRC1 (Mitochondrial inner membrane carnitine transporter; required for carnitine-dependent transport of acetyl-CoA from peroxisomes to mitochondria during fatty acid beta-oxidation; human homolog SLC25A20 complements yeast null mutant [Source:SGD;Acc:S000005626])

HSP 1 Score: 164.466 bits (415), Expect = 1.380e-48
Identity = 119/305 (39.02%), Postives = 158/305 (51.80%), Query Frame = 2
Query:   71 SNKEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGE--LPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDE----NTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTP-----EGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            SN     +KSF+AGGVGG+C V  G P D IKVR Q             + K        TL      GFYKG+  PL+GVTP+FAV F+GY++G+KL   +     +  LT  Q+ AAG +S + TT +  P ERVK +LQ     S            K + KEGGI S++KG+ ATL RD P +  YF SYE  K  L       + G    ++     +AGG AGM  WL   P DT+K++LQ +   +  N L +     +   G+ G + G+ P L+R+FPANAA FLG EM   L  K
Sbjct:   29 SNPVRENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFISAIPTTLVTAPTERVKVVLQTSSKGS-------FIQAAKTIVKEGGIASLFKGSLATLARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASSTRQ--NMLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATFLGVEMTHSLFKK 324          
BLAST of slc25a-23 vs. Ensembl Yeast
Match: YMC1 (Secondary mitochondrial inner membrane glycine transporter; required with HEM25 for the transport of glycine into mitochondria for the initiation of heme biosynthesis; proposed role in oleate metabolism and glutamate biosynthesis; member of the mitochondrial carrier (MCF) family; localizes to the vacuole in response to H2O2; YMC1 has a paralog, YMC2, that arose from the whole genome duplication [Source:SGD;Acc:S000006262])

HSP 1 Score: 144.436 bits (363), Expect = 2.908e-41
Identity = 104/308 (33.77%), Postives = 160/308 (51.95%), Query Frame = 2
Query:   68 MSNKEIHP-------LKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRK----LQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWL--KESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTA--PEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLL 946
            + + E HP       +K  +AG  GGI  V+VGQP DT KVRLQ    P         +  +   + L NEGP GFYKG   PLIGV    ++  FG N   K     +  D ++ L+ PQ +A G+  G+  + + +P E V+  LQ Q  S    ++KGP + +K+L      +++ +G   T+LR+    GTYF+ YE L   +     G ++  + A +  I G  +G   WL+  P D +KS +QT    + K+ N + SV + + AN G+   ++G  P ++RA PAN A F  +E+A++LL
Sbjct:   11 IDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT--------TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQ-FGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELAMRLL 306          
BLAST of slc25a-23 vs. Ensembl Yeast
Match: YMC2 (Putative mitochondrial inner membrane transporter; proposed role in oleate metabolism and glutamate biosynthesis; member of the mitochondrial carrier (MCF) family; YMC2 has a paralog, YMC1, that arose from the whole genome duplication [Source:SGD;Acc:S000000308])

HSP 1 Score: 131.339 bits (329), Expect = 3.935e-36
Identity = 84/285 (29.47%), Postives = 136/285 (47.72%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGV----TPMFAVC------FFGYNLGRKLQVKDENTPLTKP------QIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAP--EGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLL 946
            QP DT KVRLQ              +  +     +KNEG F FYKG   PL+GV    +  F V       F  YN  +   +  ++  L++       Q +  G+  GV  + + +P E+++  LQ Q ++ G  ++KGP D +K+L  +GG   + +G   T++R     GTYF+ YE L       G  +  +   +  + G F+G   WL   P D +KS +Q     + KY N +  V + + A EG+   ++G  P ++R+ P N A FL +E+ ++ L
Sbjct:   53 QPFDTTKVRLQTAT--------TRTTTLEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG---LMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMRFL 326          

HSP 2 Score: 51.9878 bits (123), Expect = 4.688e-8
Identity = 49/178 (27.53%), Postives = 78/178 (43.82%), Query Frame = 2
Query:  149 PLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQI-----FAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPAD-VVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPE 664
            P++ I++RLQ       G    +K   DC ++ LK +G  G  +G+   +I         F  Y     L  ++  T LT+ +I        G  SG      + P + VK +  +Q      PKYK     V K +Y + GIR+ +KG   T++R  P  G  F+++E +   L  E
Sbjct:  162 PIEQIRIRLQTQT--SNGGDREFKGPWDC-IKKLKAQG--GLMRGLFPTMIRAGHGLGTYFLVY---EALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSI--IQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMRFLGEE 329          
BLAST of slc25a-23 vs. Ensembl Yeast
Match: ORT1 (Ornithine transporter of the mitochondrial inner membrane; exports ornithine from mitochondria as part of arginine biosynthesis; functionally complemented by human ortholog, SLC25A15, which is associated with hyperammonaemia-hyperornithinaemia-homocitrullinuria (HHH) syndrome, but HHH-associated variants fail to complement [Source:SGD;Acc:S000005656])

HSP 1 Score: 118.242 bits (295), Expect = 1.638e-31
Identity = 87/268 (32.46%), Postives = 130/268 (48.51%), Query Frame = 2
Query:  149 PLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEG-PFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDEN-TPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQG--ASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGG----DKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYE 928
            P DT+KVRLQ           ++ +   C   T +NEG   GF++G+A+PL+G     A  F  YN   K   K  N +PL   QI  +G ++G   + ++TP E VKC LQV     +S   K+      +K +  E G+  +++G + T +R+      +F +YE +K+SL          +        LI+GG AG+       P DT+KS +QT       N ++ +F +     GL G YRG+   L RA PANAA F  +E
Sbjct:   33 PFDTVKVRLQTQA------SNVFPTTWSCIKFTYQNEGIARGFFQGIASPLVGACLENATLFVSYNQCSKFLEKHTNVSPL--GQILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQT-EHISLTNAVKKIFGKF----GLKGFYRGLGITLFRAVPANAAVFYIFE 287          

HSP 2 Score: 61.6178 bits (148), Expect = 2.322e-11
Identity = 55/189 (29.10%), Postives = 86/189 (45.50%), Query Frame = 2
Query:  410 GMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGI-RSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSA---GRTLIAGGFAGMCNWLVCIPPDTLKSRLQTA------PEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLL 946
            G ++G     I  P + VK  LQ Q ++  P  +      +K  Y+  GI R  ++G A+ L+       T F+SY    + L      + H +    G+ LI+GG AG C  LV  P + +K +LQ A       + K+   L ++ + ++   GL GL++G S   IR      A F  YE+  K L
Sbjct:   20 GSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTW----SCIKFTYQNEGIARGFFQGIASPLVGACLENATLFVSYNQCSKFL------EKHTNVSPLGQILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTI-KAIITERGLAGLWQGQSGTFIRESFGGVAWFATYEIVKKSL 197          

HSP 3 Score: 48.521 bits (114), Expect = 5.542e-7
Identity = 29/85 (34.12%), Postives = 42/85 (49.41%), Query Frame = 2
Query:  701 LIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLI-GLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            +I G  AG C  ++  P DT+K RLQT     +P    S  +    NEG+  G ++G++  L+ A   NA  F+ Y    K L K
Sbjct:   17 IINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTW-SCIKFTYQNEGIARGFFQGIASPLVGACLENATLFVSYNQCSKFLEK 100          
BLAST of slc25a-23 vs. Ensembl Yeast
Match: AGC1 (Mitochondrial amino acid transporter; acts both as a glutamate uniporter and as an aspartate-glutamate exchanger; involved in nitrogen metabolism and nitrogen compound biosynthesis; human homolog SLC25A13 complements yeast null mutant [Source:SGD;Acc:S000006225])

HSP 1 Score: 112.849 bits (281), Expect = 6.133e-28
Identity = 87/269 (32.34%), Postives = 128/269 (47.58%), Query Frame = 2
Query:  149 PLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTK-PQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTP-EGGDKAHLSAGRT---LIAGGFAGMCNWLVCIPPDTLKSRLQTAP---EGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEM 931
            P+D IK R+QA        L  YK+  DC L+ +  EG  G Y G+   LIGV P  A+     +  R  ++ D+N  L+  P+I + G  +G        P E VK  LQVQ    G    +   +   Q+ K+ G+R +Y G AA L+RD+P +  YF +Y  LK+ L   +  DK   +  +T   L AG  AGM    +  P D +K+RLQ  P   E KY NG+    R ++  E     ++G    ++R+ P        YE+
Sbjct:  550 PIDFIKTRMQAQR-----SLAQYKNSIDCLLKIISREGIKGLYSGLGPQLIGVAPEKAIKLTVNDFMRN-RLTDKNGKLSLFPEIIS-GASAGACQVIFTNPLEIVKIRLQVQSDYVGE-NIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKY-NGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYEL 809          

HSP 2 Score: 60.4622 bits (145), Expect = 1.590e-10
Identity = 54/190 (28.42%), Postives = 81/190 (42.63%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGY-NLGRKL-----QVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGR 697
             PL+ +K+RLQ         +      A    Q +K  G  G Y G+AA L+   P  A+ F  Y +L + L       K +   L   ++  AG ++G+    + TP + +K  LQ+     G  KY G    ++ + KE   RS +KG  A +LR  P  G    +YE  K    P   +K     GR
Sbjct:  643 NPLEIVKIRLQVQSDYVGENIQQANETA---TQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQI-DPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYELFK-GFIPSPDNKLKSREGR 827          
BLAST of slc25a-23 vs. Ensembl Nematostella
Match: EDO41788 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3K4])

HSP 1 Score: 348.591 bits (893), Expect = 3.546e-120
Identity = 170/288 (59.03%), Postives = 213/288 (73.96%), Query Frame = 2
Query:   92 LKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            +K+F AGG GG+C +  G PLDTIKVRLQ MP PKPGE P++    DC ++T++NEG FG YKGMAAP+ GVTP+FA+CF+G+N+G+KLQ+KD N   T  QI  AG  +GV TTAIM PGER+KCLLQ+Q AS    KYKGP D  +Q+Y + GIR +YKG  ATLLRD+P T  YF+SYE+L +  TPE G +  + A + L AGG AGM NW   I  D LKSRLQTAPEG YP G+R VFR+MM  EG   L+RG++PV++RAFPANAACFLGYE+A++  + I
Sbjct:   27 IKNFFAGGFGGVCCIATGHPLDTIKVRLQTMPRPKPGEKPMFTGTFDCAMKTIRNEGFFGLYKGMAAPITGVTPIFAICFWGFNMGKKLQMKDPNADPTYLQIMNAGAFAGVCTTAIMAPGERIKCLLQIQQASGAEKKYKGPIDCARQIYAQNGIRGVYKGVCATLLRDVPGTAMYFLSYEYLMKHFTPEDGSRKDVGAHKILFAGGTAGMLNWAAAIAQDVLKSRLQTAPEGTYPKGVRDVFRQMMREEGPSALFRGLTPVMLRAFPANAACFLGYELAMRFFDYI 314          

HSP 2 Score: 57.3806 bits (137), Expect = 1.982e-9
Identity = 37/98 (37.76%), Postives = 48/98 (48.98%), Query Frame = 2
Query:  674 KAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPE---GKYP--NGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            KA  S  +   AGGF G+C      P DT+K RLQT P    G+ P   G      + + NEG  GLY+G++  +    P  A CF G+ M  KL  K
Sbjct:   21 KASSSGIKNFFAGGFGGVCCIATGHPLDTIKVRLQTMPRPKPGEKPMFTGTFDCAMKTIRNEGFFGLYKGMAAPITGVTPIFAICFWGFNMGKKLQMK 118          
BLAST of slc25a-23 vs. Ensembl Nematostella
Match: EDO43921 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX88])

HSP 1 Score: 221.861 bits (564), Expect = 1.338e-70
Identity = 116/293 (39.59%), Postives = 177/293 (60.41%), Query Frame = 2
Query:   77 KEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            + + P ++ IAG V G+     GQPLD +KVRLQAM   KPGE   +K   DCF++T++ EG  G YKGM +PL+  TP  A+ F+  ++G+++Q+ D     T  Q   AG+  G   + +  P ER+KC+LQV+  +SG  +  GP  +VK++Y E G+R I++G   T++RD   TG ++++YE L   +  EG  +  +   + + AGG AG+  W +  P D LK+R+Q AP G+YP G R V +E++ NEG + LY+G  P +IRA   +   F+GYE  +K +N I
Sbjct:   16 RRLSPARNLIAGSVSGMLGCAAGQPLDLLKVRLQAMNQVKPGETAPFKGAMDCFMKTVRLEGLRGLYKGMLSPLLMATPSTALTFYSLSVGKRIQLSDPYQEPTLVQYGNAGLFCGFCVSFLFAPAERIKCILQVEAGASGSTQ-SGPYAIVKRIYAEEGVRGIFRGLPPTMIRDTFGTGVWYLTYEGLLMLMRSEGTSRDDIGTLQIVSAGGIAGLALWGLMFPVDMLKTRVQIAPMGRYPRGARDVLKEVLCNEGPMALYKGYVPGMIRAVVTHCGLFIGYEFTMKAMNYI 307          
BLAST of slc25a-23 vs. Ensembl Nematostella
Match: EDO47806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL60])

HSP 1 Score: 216.083 bits (549), Expect = 1.900e-68
Identity = 114/272 (41.91%), Postives = 164/272 (60.29%), Query Frame = 2
Query:  149 PLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTK-PQI---FAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGD-KAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            PLDTIKVRLQAMP+PKPGE  +YK+  DCF + ++NEG +  ++G+  P++   P   V F   +      VK    P++K P++    AAGM++GV T+ ++TP +RVKC+LQ++ A  G   Y GP D ++++Y+E G+R +YKG + T +RDIP  G  F + E    ++T E      H+  G  L++G  AGM  W   +P D LK+R QTAP G+Y   L  V R ++  EG   LY G   +LIRA P NAA FL Y+   +L+N
Sbjct:   38 PLDTIKVRLQAMPLPKPGEPWMYKNSFDCFFKIIRNEGVYYLFRGVTVPILNSIPNTTVLFSCVSF-----VKSYKLPVSKDPELLRSLAAGMIAGVATSFVLTPLDRVKCILQIEKAFGG-SSYGGPVDCLRRIYREAGVRGVYKGISVTAMRDIPGWGAMFFTNELCHRAITGEKNHLTRHIGPGGVLVSGAIAGMAYWTAGLPADVLKTRYQTAPPGRYGRVL-DVLRTLVRYEGFTALYTGFGAILIRALPVNAAFFLAYDYTARLIN 302          
BLAST of slc25a-23 vs. Ensembl Nematostella
Match: EDO33993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQM9])

HSP 1 Score: 212.616 bits (540), Expect = 4.078e-67
Identity = 118/298 (39.60%), Postives = 176/298 (59.06%), Query Frame = 2
Query:   62 NNMSNKEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            + ++ + + PL++ IAG VGG+  V  GQPLDTIKVRLQA      G  PL     D   +T+K+EG  G YKGM AP++   P+ AV F+  ++G++LQ+ D N   T  Q + AG+  GV  + I  P ERVKCLLQVQ  S    +Y+G  D + Q+Y+ GG+R ++KG   T+ R++   G ++++YE L   +      +  +     +++GG AG+  W++  P D +K+R+Q APEG Y  G R   RE++ NEG   LYRG  P L+RA   +AA   GYE+ +K +N +
Sbjct:    9 DQVNTRRLSPLRNLIAGSVGGVTGVTAGQPLDTIKVRLQA----SFGAGPL-----DMLARTVKSEGVRGLYKGMLAPVLVAAPVTAVSFYSLSIGKRLQLSDPNKEPTMVQYYNAGVFCGVCVSFIYAPTERVKCLLQVQKESGTKARYQGLGDCLLQVYRTGGLRGVFKGLGPTMGREVIGGGFWYLTYEGLLRVMRSGDCTRDQVGPIAVMLSGGSAGLVFWMITYPIDAIKTRVQVAPEGTYARGARDALRELLRNEGPRALYRGYVPGLMRAVVVHAALLAGYELTMKTMNVV 297          
BLAST of slc25a-23 vs. Ensembl Nematostella
Match: EDO38163 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDS4])

HSP 1 Score: 151.754 bits (382), Expect = 1.293e-43
Identity = 99/274 (36.13%), Postives = 137/274 (50.00%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQ---GASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGK---YPNGLRSVFREMMANE-GLIGLYRGVSPVLIRAFPANAACFLGYEMALKLL 946
             P DT+KVRLQ  P+ +P    +YK + DCF++TLK EG  G YKG+ +P++G     A  F  Y   R      E   LT P+ +A G  +G+    I  P +  K  +QVQ     S  P +Y+        + +  GIR  Y+G +ATL+R+IPA G +F  YE+ K  LTPEGG    +S    L +G   G   W +  P D +KS +      K     +G     R++  NE G    YRG +P L+R+ PANAA FL  E   K  
Sbjct:   42 HPFDTLKVRLQTQPVDRP----VYKGLVDCFVKTLKWEGIGGLYKGVGSPIVGQMFFRATLFGSYFQER------EGQRLTLPEYYACGAGTGLVVAFIEGPIDLFKSKMQVQIIRAQSGAPIQYRNVFHAGYTIAQTYGIRGCYQGLSATLVRNIPANGFFFGFYEFTKNLLTPEGGTVNDVSPLGLLTSGAMGGFFYWFLTYPTDLVKSSMMADHSDKALRKYHGYIDCARKLYTNEGGWRRFYRGFTPCLLRSMPANAAMFLTVETLRKYF 305          

HSP 2 Score: 52.7582 bits (125), Expect = 6.411e-8
Identity = 50/187 (26.74%), Postives = 74/187 (39.57%), Query Frame = 2
Query:  407 AGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTA---PEGKYPNGLRSVFR---EMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            +G   G+    +  P + +K  LQ Q      P YKG  D   +  K  GI  +YKG  + ++  +    T F SY   +E           L+       G   G+    +  P D  KS++Q      +   P   R+VF     +    G+ G Y+G+S  L+R  PAN   F  YE    LL 
Sbjct:   29 SGTAGGISVCLVGHPFDTLKVRLQTQPVDR--PVYKGLVDCFVKTLKWEGIGGLYKGVGSPIVGQMFFRATLFGSYFQEREG--------QRLTLPEYYACGAGTGLVVAFIEGPIDLFKSKMQVQIIRAQSGAPIQYRNVFHAGYTIAQTYGIRGCYQGLSATLVRNIPANGFFFGFYEFTKNLLT 205          
BLAST of slc25a-23 vs. Ensembl Medaka
Match: slc25a20 (solute carrier family 25 member 20 [Source:ZFIN;Acc:ZDB-GENE-040426-1869])

HSP 1 Score: 375.941 bits (964), Expect = 8.385e-131
Identity = 192/289 (66.44%), Postives = 220/289 (76.12%), Query Frame = 2
Query:   83 IHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLN 949
            I PLK+F AGG GG+C V  G PLDTIKVRLQ  P  KPGE  +Y    DCF +TL  EG  G YKGMAAP+IGVTPMFAVCFFG+ LGRKLQ +  +  L+ PQ+FAAGMLSGVFTTAIM PGER+KCLLQ+Q AS+G  KY GP D VKQLY+E GIR IY+GTA TL+RD+PA+G YFMSYEWLK  LTP G     LS    L AGG AG+CNW V IPPD LKSR QTAPEGKYPNG R V RE++  EG+  LY+G + V++RAFPANAACFLG+EMA+K LN
Sbjct:    9 ISPLKNFFAGGFGGVCLVFAGHPLDTIKVRLQTQPKAKPGESLMYAGTLDCFKKTLAKEGVKGLYKGMAAPIIGVTPMFAVCFFGFGLGRKLQQRSPDDVLSYPQLFAAGMLSGVFTTAIMAPGERIKCLLQIQ-ASTGEVKYSGPMDCVKQLYRESGIRGIYRGTALTLMRDVPASGMYFMSYEWLKNLLTPAGKSHNELSIPSVLFAGGMAGICNWAVAIPPDVLKSRFQTAPEGKYPNGFRDVLRELIREEGVASLYKGFNAVMLRAFPANAACFLGFEMAMKFLN 296          
BLAST of slc25a-23 vs. Ensembl Medaka
Match: si:dkey-150i13.2 (solute carrier family 25 member 20 [Source:NCBI gene;Acc:101162741])

HSP 1 Score: 191.045 bits (484), Expect = 2.279e-59
Identity = 96/190 (50.53%), Postives = 130/190 (68.42%), Query Frame = 2
Query:  386 TKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            T+P+   + + SGV+       G +V+       +SSG  KY GP D   +LY+E GIRS+YKGT  TL+RD+P+TG YF++YE+LK +LTP G   +HLS    L+AGG AG+ NW V +PPD LKS  QTAP+G+Y +G+  + R ++  EG  GLY+G S VL+RAFPANAACFLG+E+ALK LN +
Sbjct:   36 TQPKAPPSALYSGVYDCFCHIVGRQVQ-------SSSGESKYAGPLDCAFKLYQEDGIRSVYKGTLLTLIRDVPSTGLYFLTYEYLKCALTPAGQSVSHLSTPNILLAGGVAGVLNWTVALPPDVLKSNFQTAPDGRY-SGVWDILRTLLHEEGPRGLYKGFSAVLLRAFPANAACFLGFEVALKALNIV 217          

HSP 2 Score: 73.559 bits (179), Expect = 7.107e-15
Identity = 70/211 (33.18%), Postives = 97/211 (45.97%), Query Frame = 2
Query:   83 IHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTL------------------------KNEGPFGFYKGMAAPLIGVTPMFAVCFFGYN-LGRKLQVKDEN-TPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYE 637
            + PLK+F+AGGVGG C ++VG PLDTIKV LQ  P   P    LY  + DCF   +                        + +G    YKG    LI   P   + F  Y  L   L    ++ + L+ P I  AG ++GV    +  P + +K     Q A  G  +Y G  D+++ L  E G R +YKG +A LLR  PA    F+ +E
Sbjct:    4 VSPLKNFVAGGVGGACLLLVGHPLDTIKVILQTQPKAPPSA--LYSGVYDCFCHIVGRQVQSSSGESKYAGPLDCAFKLYQEDGIRSVYKGTLLTLIRDVPSTGLYFLTYEYLKCALTPAGQSVSHLSTPNILLAGGVAGVLNWTVALPPDVLKS--NFQTAPDG--RYSGVWDILRTLLHEEGPRGLYKGFSAVLLRAFPANAACFLGFE 208          
BLAST of slc25a-23 vs. Ensembl Medaka
Match: SLC25A15 (mitochondrial ornithine transporter 1 [Source:NCBI gene;Acc:101171685])

HSP 1 Score: 150.984 bits (380), Expect = 8.114e-43
Identity = 91/277 (32.85%), Postives = 131/277 (47.29%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLG----RKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPA-----DVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPE-GGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLL 946
            QP DT KV++Q  P        +Y+      + T++  G FG Y+G A  L+      AV F GY L     R L   D+   L+  Q  +AG L+ +F++ ++ P E VKC LQ         +           VVK + K  G    Y+G  +T++RDIP    +F +YE  + +     G DK  +     + +GGF G C WLV  P D +KSR+Q         G    F  ++  EG   LY G++P +IR FPAN A FL YE +  L+
Sbjct:   28 QPFDTAKVKMQTFP-------TMYRGFIHSLVSTVREVGLFGLYRGTAPALLANISENAVLFLGYGLCQDAVRFLSRMDKGVDLSDIQKASAGSLASIFSSMVLCPTELVKCRLQAMHEMEATGRVAAGQRSTVWSVVKTVLKTNGPLGFYQGLTSTIVRDIPGNFCFFGAYELCRTTFAKHMGTDKEGIGILPLMFSGGFGGACLWLVIYPIDCVKSRIQVHSLAGKQEGFMKTFMAIIRTEGFTALYSGLTPTMIRTFPANGALFLVYEYSHNLM 297          
BLAST of slc25a-23 vs. Ensembl Medaka
Match: slc25a29 (mitochondrial basic amino acids transporter [Source:NCBI gene;Acc:101155318])

HSP 1 Score: 144.821 bits (364), Expect = 1.039e-40
Identity = 88/263 (33.46%), Postives = 138/263 (52.47%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQG---ASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEG---KYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACF 916
             P DT+KVRLQ  P+ KP    LY+    CF   ++ E   G YKG+ +P++G+T + A+ F  +  G  ++  +E+TP  +     AG  +G     +  P E  K  +Q+QG     +    Y+   D +  +Y++ G+R + +G   TL+R+ P  G YF SY+ L  SL  E   +  +   + L AGG AG+ +W+V  P D +KSRLQ    G   +Y + +  V R+ +  EG +   RG++  L+RAFP NA  F
Sbjct:   18 HPFDTVKVRLQVQPVDKP----LYRGTYHCFQSIIRQESVLGLYKGIGSPMMGLTVINAIVFGVH--GNTMRFLEEDTPTNQF---FAGAAAGAIQCVVCCPVELAKTRMQMQGIGEKKASRKTYRSSLDCLVHIYRQEGVRGVNRGMVTTLIRETPGFGAYFWSYDVLTRSLGCEPDSRFIIP--KLLFAGGMAGIASWIVTYPADVIKSRLQMDGAGGVQRYSSIMDCV-RQSIGKEGYMVFTRGLTSTLLRAFPVNATTF 268          
BLAST of slc25a-23 vs. Ensembl Medaka
Match: SLC25A29 (solute carrier family 25 member 29 [Source:NCBI gene;Acc:101165114])

HSP 1 Score: 144.821 bits (364), Expect = 1.783e-40
Identity = 92/263 (34.98%), Postives = 135/263 (51.33%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPK---YKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEG---KYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACF 916
             P DT+KVRLQ   + KP    LY+    CF   ++ E   G YKG+ +P++G+T + A+ F G   G  ++    +TPL +   F AG  +G     I  P E  K  +Q+QG      K   YK   D + ++YK+ G R I +G   T +R+ P  G YF++Y+ L  SL  E  D   +   + L AGG +G+ +W+   P D +KSRLQ    G   KY + +  V R+ +  EG     RG++  L+RAFP NA  F
Sbjct:   20 HPFDTVKVRLQVQNVDKP----LYRGTFHCFQSIVRQESMLGLYKGIGSPMMGLTFINAIVF-GVQ-GNAMRRLGSDTPLNQ---FLAGASAGAIQCVICCPMELAKTRMQMQGTGEKKSKRKLYKNSLDCLVRIYKKEGFRGINRGMVTTFVRETPGFGVYFLAYDVLTRSLGCEPEDPYMIP--KLLFAGGMSGIASWISTYPVDVIKSRLQADGVGGVNKYSSIMDCV-RQSLKKEGWRVFTRGLTSTLLRAFPVNATTF 270          

HSP 2 Score: 82.4185 bits (202), Expect = 1.760e-17
Identity = 61/181 (33.70%), Postives = 86/181 (47.51%), Query Frame = 2
Query:   89 PLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPI-PKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYN-LGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYF 625
            PL  F+AG   G    V+  P++  K R+Q      K  +  LYK+  DC ++  K EG  G  +GM    +  TP F V F  Y+ L R L  + E+ P   P++  AG +SG+ +     P + +K  LQ  G   G  KY    D V+Q  K+ G R   +G  +TLLR  P   T F
Sbjct:   92 PLNQFLAGASAGAIQCVICCPMELAKTRMQMQGTGEKKSKRKLYKNSLDCLVRIYKKEGFRGINRGMVTTFVRETPGFGVYFLAYDVLTRSLGCEPED-PYMIPKLLFAGGMSGIASWISTYPVDVIKSRLQADGV-GGVNKYSSIMDCVRQSLKKEGWRVFTRGLTSTLLRAFPVNATTF 270          

HSP 3 Score: 48.521 bits (114), Expect = 4.443e-6
Identity = 43/176 (24.43%), Postives = 73/176 (41.48%), Query Frame = 2
Query:  449 PGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMS---YEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGK-------YPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLL 946
            P + VK  LQVQ      P Y+G     + + ++  +  +YKG  +      P  G  F++   +     ++   G D    +     +AG  AG    ++C P +  K+R+Q    G+       Y N L  + R +   EG  G+ RG+    +R  P     FL Y++  + L
Sbjct:   21 PFDTVKVRLQVQNVDK--PLYRGTFHCFQSIVRQESMLGLYKGIGS------PMMGLTFINAIVFGVQGNAMRRLGSD----TPLNQFLAGASAGAIQCVICCPMELAKTRMQMQGTGEKKSKRKLYKNSLDCLVR-IYKKEGFRGINRGMVTTFVRETPGFGVYFLAYDVLTRSL 183          
BLAST of slc25a-23 vs. Planmine SMEST
Match: SMESG000009142.1 (SMESG000009142.1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 296/296 (100.00%), Postives = 296/296 (100.00%), Query Frame = 2
Query:   68 MSNKEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            MSNKEIHPLKSFIAGGVGGICTVVVGQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI
Sbjct:    1 MSNKEIHPLKSFIAGGVGGICTVVVGQPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 296          
BLAST of slc25a-23 vs. Planmine SMEST
Match: SMESG000010598.1 (SMESG000010598.1)

HSP 1 Score: 126.331 bits (316), Expect = 1.065e-33
Identity = 90/285 (31.58%), Postives = 130/285 (45.61%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPF-GFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTP---LTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQ------GASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGG----DKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQ-TAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
            QPLDTIKV++Q  P        LY +   CF+ TLK +G + G Y G    L+      +V F      + L     N P   L   Q   AG ++ +F++  + P E VKC  Q        G SS      GP  + KQ+Y   GIR  + G   T  R++P    +F +YE+ +  LT         K  L+   T + G  AG   W V  P D +KSR+Q  + E      L S+   ++  EG+  LY+G+ P ++R  PA AA F+  E   K ++ I
Sbjct:   20 QPLDTIKVKMQMFP-------QLYNNALTCFINTLKKDGIYRGLYAGTVPALVANVAENSVLFCALPPCKNLVSFILNKPVKELNPIQSGCAGGIAAIFSSLTLCPTELVKCKQQAMREMIEAGKSSMKLTDTGPWRICKQVYGSQGIRGFFHGLVPTFAREVPGYFCFFGAYEFSQHILTNWCSVAVRSKEELTLFETGVCGAVAGTTLWTVIFPFDVVKSRVQINSHESSVSKSLPSMMMTIVNTEGIKSLYKGLGPTVVRTIPATAALFIAVEYTKKFMDYI 297          

HSP 2 Score: 48.9062 bits (115), Expect = 2.581e-6
Identity = 51/204 (25.00%), Postives = 92/204 (45.10%), Query Frame = 2
Query:   77 KEIHPLKSFIAXXXXXXXXXXXXQPLDTIKVRLQAM-PIPKPGELPLYKSMADC-----FLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFG-YNLGRKLQVK------DENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKE 649
            KE++P++S  AGG+  I + +   P + +K + QAM  + + G+  +   + D        Q   ++G  GF+ G+        P +  CFFG Y   + +              LT  +    G ++G     ++ P + VK  +Q+    S     K    ++  +    GI+S+YKG   T++R IPAT   F++ E+ K+
Sbjct:   94 KELNPIQSGCAGGIAAIFSSLTLCPTELVKCKQQAMREMIEAGKSSM--KLTDTGPWRICKQVYGSQGIRGFFHGLVPTFAREVPGY-FCFFGAYEFSQHILTNWCSVAVRSKEELTLFETGVCGAVAGTTLWTVIFPFDVVKSRVQINSHESSVS--KSLPSMMMTIVNTEGIKSLYKGLGPTVVRTIPATAALFIAVEYTKK 292          
BLAST of slc25a-23 vs. Planmine SMEST
Match: SMESG000011486.1 (SMESG000011486.1)

HSP 1 Score: 122.094 bits (305), Expect = 2.782e-32
Identity = 84/272 (30.88%), Postives = 138/272 (50.74%), Query Frame = 2
Query:  146 QPLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGM--LSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKI 955
             P+DTIK   Q+ P     ++  Y    D +   ++N     F+KG   P      + +V F  Y + +K        P ++  + + G    SGV   A   P E +K  +Q+  A+S   K       +K +YK  GI+  Y GT A LLRDIP    YF++YE L + L  +   + +L   +++I+GG  GM +W++ IP D +K+R+Q+  +    +  +++      + G + ++RG S +L+R+F ANA  FL YEM L +LNK+
Sbjct:   38 HPIDTIKTIYQSHP-----KMKYYFVCKDIYKIGIRN-----FWKGCTVPSTTFAIVNSVSFATYFVPKK-----HFDPRSESDLVSVGCASFSGVCQLAFWVPSEVIKIKMQMY-ANSPMSKSVTVMTSIKHIYKTYGIKGFYHGTIAQLLRDIPNNVAYFITYEKLSKYL--DQTYQMNL-VEKSIISGGATGMISWVIVIPMDLVKTRIQSRTDKDLISSYKAIL-----SLGYLAMFRGTSILLLRSFSANAMIFLVYEMTLPILNKL 285          
BLAST of slc25a-23 vs. Planmine SMEST
Match: SMESG000061041.1 (SMESG000061041.1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.873e-22
Identity = 80/273 (29.30%), Postives = 123/273 (45.05%), Query Frame = 2
Query:  149 PLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIM--TPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGF---AGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            P + +K +LQ     + G    YK   DC   T+K  G  G Y+G++  + G  P  AV F  +   +K  +  + T LT  +    G+ +GV + AI+  TP E +K    +    SG PKY G    VK + K  GI+ +Y+G  AT+++        F   E LK+      GD +  +   TL+ G F   AG  +     P D +K+R+Q     +Y N     F ++  NEG    Y+G  P L R        F+ Y+  ++L  K
Sbjct:   27 PTEYVKTQLQLDQ--RVGMAKRYKGPIDCVKVTVKEHGVLGLYRGLSVLVYGSIPKSAVRFGAFEEFKKRNLSADGT-LTNSRKLLCGLGAGV-SEAILAVTPMETIKVKF-INDQISGNPKYNGFIHGVKTIVKSEGIKGLYQGVTATIMKQGTNQAIRFFVMESLKDGYRKYRGDTSPNAPIPTLLTGVFGATAGAASVFGNTPIDVVKTRMQGLDSKQYKNTF-DCFLKIFKNEGPRAFYKGTVPRLSRVCLDVGITFMIYDNFMQLFEK 293          

HSP 2 Score: 67.781 bits (164), Expect = 1.100e-12
Identity = 50/168 (29.76%), Postives = 84/168 (50.00%), Query Frame = 2
Query:  440 IMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSY-EWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPP-DTLKSRL---QTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYE 928
            I  P E VK  LQ+        +YKGP D VK   KE G+  +Y+G +  +   IP +   F ++ E+ K +L+ +G     L+  R L+ G  AG+   ++ + P +T+K +    Q +   KY NG     + ++ +EG+ GLY+GV+  +++     A  F   E
Sbjct:   24 ITFPTEYVKTQLQLDQRVGMAKRYKGPIDCVKVTVKEHGVLGLYRGLSVLVYGSIPKSAVRFGAFEEFKKRNLSADG----TLTNSRKLLCGLGAGVSEAILAVTPMETIKVKFINDQISGNPKY-NGFIHGVKTIVKSEGIKGLYQGVTATIMKQGTNQAIRFFVME 186          
BLAST of slc25a-23 vs. Planmine SMEST
Match: SMESG000061041.1 (SMESG000061041.1)

HSP 1 Score: 95.1301 bits (235), Expect = 4.393e-22
Identity = 80/273 (29.30%), Postives = 123/273 (45.05%), Query Frame = 2
Query:  149 PLDTIKVRLQAMPIPKPGELPLYKSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVKDENTPLTKPQIFAAGMLSGVFTTAIM--TPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGF---AGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 952
            P + +K +LQ     + G    YK   DC   T+K  G  G Y+G++  + G  P  AV F  +   +K  +  + T LT  +    G+ +GV + AI+  TP E +K    +    SG PKY G    VK + K  GI+ +Y+G  AT+++        F   E LK+      GD +  +   TL+ G F   AG  +     P D +K+R+Q     +Y N     F ++  NEG    Y+G  P L R        F+ Y+  ++L  K
Sbjct:   43 PTEYVKTQLQLDQ--RVGMAKRYKGPIDCVKVTVKEHGVLGLYRGLSVLVYGSIPKSAVRFGAFEEFKKRNLSADGT-LTNSRKLLCGLGAGV-SEAILAVTPMETIKVKF-INDQISGNPKYNGFIHGVKTIVKSEGIKGLYQGVTATIMKQGTNQAIRFFVMESLKDGYRKYRGDTSPNAPIPTLLTGVFGATAGAASVFGNTPIDVVKTRMQGLDSKQYKNTF-DCFLKIFKNEGPRAFYKGTVPRLSRVCLDVGITFMIYDNFMQLFEK 309          

HSP 2 Score: 67.781 bits (164), Expect = 1.262e-12
Identity = 50/168 (29.76%), Postives = 84/168 (50.00%), Query Frame = 2
Query:  440 IMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSY-EWLKESLTPEGGDKAHLSAGRTLIAGGFAGMCNWLVCIPP-DTLKSRL---QTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYE 928
            I  P E VK  LQ+        +YKGP D VK   KE G+  +Y+G +  +   IP +   F ++ E+ K +L+ +G     L+  R L+ G  AG+   ++ + P +T+K +    Q +   KY NG     + ++ +EG+ GLY+GV+  +++     A  F   E
Sbjct:   40 ITFPTEYVKTQLQLDQRVGMAKRYKGPIDCVKVTVKEHGVLGLYRGLSVLVYGSIPKSAVRFGAFEEFKKRNLSADG----TLTNSRKLLCGLGAGVSEAILAVTPMETIKVKFINDQISGNPKY-NGFIHGVKTIVKSEGIKGLYQGVTATIMKQGTNQAIRFFVME 202          
The following BLAST results are available for this feature:
BLAST of slc25a-23 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC25A208.788e-12564.26solute carrier family 25 member 20 [Source:HGNC Sy... [more]
SLC25A201.670e-6661.73solute carrier family 25 member 20 [Source:HGNC Sy... [more]
SLC25A451.388e-4333.22solute carrier family 25 member 45 [Source:HGNC Sy... [more]
SLC25A451.388e-4333.22solute carrier family 25 member 45 [Source:HGNC Sy... [more]
SLC25A291.677e-4337.31solute carrier family 25 member 29 [Source:HGNC Sy... [more]
back to top
BLAST of slc25a-23 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dif-13.182e-10459.15pep chromosome:WBcel235:IV:7551550:7553008:-1 gene... [more]
dif-13.182e-10459.15pep chromosome:WBcel235:IV:7551550:7552874:-1 gene... [more]
dif-13.182e-10459.15pep chromosome:WBcel235:IV:7551657:7552874:-1 gene... [more]
slc-25A297.227e-5237.45SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
slc-25A291.342e-5137.45SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
back to top
BLAST of slc25a-23 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
colt1.071e-10954.03gene:FBgn0019830 transcript:FBtr0077731[more]
colt1.071e-10954.03gene:FBgn0019830 transcript:FBtr0077734[more]
MME15.857e-8951.88gene:FBgn0031881 transcript:FBtr0079389[more]
CG49951.372e-4135.06gene:FBgn0032219 transcript:FBtr0079991[more]
CG49951.372e-4135.06gene:FBgn0032219 transcript:FBtr0331665[more]
back to top
BLAST of slc25a-23 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a207.797e-13165.32solute carrier family 25 member 20 [Source:ZFIN;Ac... [more]
si:dkey-150i13.29.624e-10354.24si:dkey-150i13.2 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
SLC25A291.550e-4334.60solute carrier family 25 member 29 [Source:NCBI ge... [more]
slc25a293.334e-4335.74solute carrier family 25 member 29 [Source:ZFIN;Ac... [more]
FO704822.19.749e-4233.21solute carrier family 25 member 45 [Source:NCBI ge... [more]
back to top
BLAST of slc25a-23 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a203.774e-12765.74solute carrier family 25 (carnitine/acylcarnitine ... [more]
slc25a201.084e-10660.00solute carrier family 25 (carnitine/acylcarnitine ... [more]
ENSXETT00000016618.13.577e-8352.38solute carrier family 25 (carnitine/acylcarnitine ... [more]
slc25a451.452e-4234.88solute carrier family 25 member 45 [Source:NCBI ge... [more]
pofut28.412e-4235.11protein O-fucosyltransferase 2 [Source:Xenbase;Acc... [more]
back to top
BLAST of slc25a-23 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc25a203.144e-12362.80solute carrier family 25 (mitochondrial carnitine/... [more]
Slc25a451.282e-4433.45solute carrier family 25, member 45 [Source:MGI Sy... [more]
Slc25a451.282e-4433.45solute carrier family 25, member 45 [Source:MGI Sy... [more]
Slc25a293.688e-4336.54solute carrier family 25 (mitochondrial carrier, p... [more]
Slc25a152.431e-4235.64solute carrier family 25 (mitochondrial carrier or... [more]
back to top
BLAST of slc25a-23 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43772|MCAT_HUMAN4.220e-12464.26Mitochondrial carnitine/acylcarnitine carrier prot... [more]
sp|Q8HXY2|MCAT_MACFA5.090e-12363.23Mitochondrial carnitine/acylcarnitine carrier prot... [more]
sp|P97521|MCAT_RAT1.656e-12262.80Mitochondrial carnitine/acylcarnitine carrier prot... [more]
sp|Q9Z2Z6|MCAT_MOUSE2.199e-12262.80Mitochondrial carnitine/acylcarnitine carrier prot... [more]
sp|Q9VQG4|COLT_DROME1.073e-10854.03Congested-like trachea protein OS=Drosophila melan... [more]
back to top
BLAST of slc25a-23 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJ780.000e+0100.00Slc25a-23 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A0P4WB876.212e-13669.42Uncharacterized protein OS=Scylla olivacea OX=8555... [more]
V5H1M71.638e-13468.37Putative mitochondrial carnitine/acylcarnitine car... [more]
A0A131Y3C41.994e-13467.68Putative mitochondrial ornithine transporter OS=Ix... [more]
A0A0K8REX43.560e-13467.68Putative mitochondrial carnitine-acylcarnitine car... [more]
back to top
BLAST of slc25a-23 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a201.860e-12865.29solute carrier family 25 member 20 [Source:NCBI ge... [more]
si:dkey-150i13.22.604e-10555.14mitochondrial carnitine/acylcarnitine carrier prot... [more]
slc25a292.642e-4336.50solute carrier family 25 member 29 [Source:NCBI ge... [more]
SLC25A452.323e-4033.11solute carrier family 25 member 45 [Source:NCBI ge... [more]
slc25a15a3.436e-3731.67mitochondrial ornithine transporter 1 [Source:NCBI... [more]
back to top
BLAST of slc25a-23 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a201.058e-11963.64solute carrier family 25 member 20 [Source:ZFIN;Ac... [more]
ENSPMAT00000008980.19.775e-3033.08pep scaffold:Pmarinus_7.0:GL478832:29230:40541:-1 ... [more]
ENSPMAT00000006621.15.742e-2830.00pep scaffold:Pmarinus_7.0:GL477233:35245:42511:-1 ... [more]
slc25a481.086e-2428.21solute carrier family 25 member 48 [Source:NCBI ge... [more]
SLC25A401.387e-2124.52solute carrier family 25 member 40 [Source:HGNC Sy... [more]
back to top
BLAST of slc25a-23 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CRC11.380e-4839.02Mitochondrial inner membrane carnitine transporter... [more]
YMC12.908e-4133.77Secondary mitochondrial inner membrane glycine tra... [more]
YMC23.935e-3629.47Putative mitochondrial inner membrane transporter;... [more]
ORT11.638e-3132.46Ornithine transporter of the mitochondrial inner m... [more]
AGC16.133e-2832.34Mitochondrial amino acid transporter; acts both as... [more]
back to top
BLAST of slc25a-23 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO417883.546e-12059.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439211.338e-7039.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478061.900e-6841.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339934.078e-6739.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381631.293e-4336.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc25a-23 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a208.385e-13166.44solute carrier family 25 member 20 [Source:ZFIN;Ac... [more]
si:dkey-150i13.22.279e-5950.53solute carrier family 25 member 20 [Source:NCBI ge... [more]
SLC25A158.114e-4332.85mitochondrial ornithine transporter 1 [Source:NCBI... [more]
slc25a291.039e-4033.46mitochondrial basic amino acids transporter [Sourc... [more]
SLC25A291.783e-4034.98solute carrier family 25 member 29 [Source:NCBI ge... [more]
back to top
BLAST of slc25a-23 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009142.10.000e+0100.00SMESG000009142.1[more]
SMESG000010598.11.065e-3331.58SMESG000010598.1[more]
SMESG000011486.12.782e-3230.88SMESG000011486.1[more]
SMESG000061041.12.873e-2229.30SMESG000061041.1[more]
SMESG000061041.14.393e-2229.30SMESG000061041.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30006987
GenBankAKN21591.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006987 ID=SMED30006987|Name=slc25a-23|organism=Schmidtea mediterranea sexual|type=transcript|length=1016bp
CTTGTTTAATTATATTATAAAAAAATATTTTACAGTTATTTAATTATTCA
TCAAATTATAAAATAATATGTCAAATAAAGAAATTCATCCTCTTAAAAGT
TTTATCGCCGGTGGGGTTGGTGGTATATGTACTGTAGTGGTCGGACAACC
TCTTGACACAATAAAAGTCCGATTGCAAGCAATGCCCATTCCAAAGCCTG
GTGAATTGCCATTATATAAGAGTATGGCGGATTGCTTTTTACAAACTCTT
AAAAATGAAGGACCATTTGGATTTTACAAAGGAATGGCCGCACCGTTGAT
AGGAGTAACGCCAATGTTTGCCGTTTGCTTTTTTGGCTATAATCTTGGTA
GAAAGTTACAAGTTAAAGATGAAAACACACCGTTGACGAAACCTCAGATA
TTCGCCGCAGGAATGCTTTCGGGTGTTTTTACAACGGCGATTATGACCCC
GGGTGAACGGGTGAAGTGTTTATTGCAAGTTCAAGGAGCTTCAAGTGGTC
CCCCAAAATACAAGGGACCTGCCGATGTTGTCAAACAGCTATACAAAGAA
GGTGGTATACGGAGTATTTATAAAGGAACTGCAGCCACTCTTTTGAGAGA
TATTCCTGCTACTGGAACTTATTTCATGTCTTACGAGTGGTTGAAAGAGT
CATTAACTCCAGAAGGTGGCGACAAAGCACATCTTAGCGCAGGCCGGACA
CTGATTGCTGGTGGTTTTGCTGGCATGTGCAATTGGCTTGTCTGCATTCC
TCCTGATACTTTGAAGTCCCGTTTACAAACTGCTCCAGAAGGTAAATATC
CAAATGGTTTACGATCAGTTTTCCGTGAAATGATGGCTAATGAGGGTCTA
ATTGGTCTTTATAGAGGAGTATCCCCTGTATTGATACGAGCTTTCCCTGC
CAATGCGGCTTGCTTTTTAGGATATGAAATGGCTCTTAAATTACTGAACA
AAATATTTTAAAATAGAATATTTTTCCATTTTTTTGATTAATAAATTGTT
TTTGTCTAAAAAAAAA
back to top

protein sequence of SMED30006987-orf-1

>SMED30006987-orf-1 ID=SMED30006987-orf-1|Name=SMED30006987-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=298bp
MSNKEIHPLKSFIAGGVGGICTVVVGQPLDTIKVRLQAMPIPKPGELPLY
KSMADCFLQTLKNEGPFGFYKGMAAPLIGVTPMFAVCFFGYNLGRKLQVK
DENTPLTKPQIFAAGMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKG
PADVVKQLYKEGGIRSIYKGTAATLLRDIPATGTYFMSYEWLKESLTPEG
GDKAHLSAGRTLIAGGFAGMCNWLVCIPPDTLKSRLQTAPEGKYPNGLRS
VFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNKIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005347ATP transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0015867ATP transport
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002067Mit_carrier
IPR018108Mitochondrial_sb/sol_carrier
IPR023395Mt_carrier_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002067Mitochondrial carrier proteinPRINTSPR00926MITOCARRIERcoord: 11..24
score: 28.69
coord: 168..186
score: 29.77
coord: 24..38
score: 27.65
coord: 215..237
score: 24.52
IPR018108Mitochondrial substrate/solute carrierPFAMPF00153Mito_carrcoord: 110..196
e-value: 8.3E-23
score: 80.1
coord: 206..295
e-value: 2.3E-23
score: 81.9
coord: 5..100
e-value: 1.8E-20
score: 72.6
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 106..195
score: 22.985
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 206..292
score: 20.432
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 6..97
score: 23.564
IPR023395Mitochondrial carrier domain superfamilyGENE3DG3DSA:1.50.40.10coord: 11..297
e-value: 6.0E-78
score: 263.5
IPR023395Mitochondrial carrier domain superfamilySUPERFAMILYSSF103506Mitochondrial carriercoord: 4..287
NoneNo IPR availablePANTHERPTHR45624:SF32SOLUTE CARRIER FAMILY 25 (CARNITINE/ACYLCARNITINE TRANSLOCASE), MEMBER 20coord: 4..295
NoneNo IPR availablePANTHERPTHR45624FAMILY NOT NAMEDcoord: 4..295
NoneNo IPR availableTMHMMTMhelixcoord: 12..29
NoneNo IPR availableTMHMMTMhelixcoord: 72..94