DNA helicase

Overview
NameDNA helicase
Smed IDSMED30006979
Length (bp)2780
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA helicase (SMED30006979) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA helicase (SMED30006979) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA helicase (SMED30006979) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA helicase (SMED30006979) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006979

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006979SMESG000052872.1 SMESG000023403.1 SmedASXL_014198SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30006979SMESG000052872.1 SMESG000023403.1 SmedASXL_014198SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30006979SMESG000052872.1 SMESG000023403.1 dd_Smed_v4_7682_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006979SMESG000052872.1 SMESG000023403.1 dd_Smed_v4_7682_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006979SMESG000052872.1 SMESG000023403.1 Contig39573uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006979SMESG000052872.1 SMESG000023403.1 Contig39573newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30006979SMESG000052872.1 SMESG000023403.1 dd_Smed_v6_7682_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30006979SMESG000052872.1 SMESG000023403.1 isotig15091be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30006979SMESG000052872.1 SMESG000023403.1 dd_Smed_v4_7682_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006979SMESG000052872.1 SMESG000023403.1 SmWIOct06_021000GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30006979SMESG000052872.1 SMESG000023403.1 SMED_02486_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30006979SMESG000052872.1 SMESG000023403.1 SMED_02486_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30006979SMESG000052872.1 SMESG000023403.1 SMED_02486_V2_1rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30006979SMESG000052872.1 SMESG000023403.1 SMED_02486_V2_1rGPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30006979 SMED_23433_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30006979 SMED_23433_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA helicase vs. Ensembl Human
Match: MCM2 (minichromosome maintenance complex component 2 [Source:HGNC Symbol;Acc:HGNC:6944])

HSP 1 Score: 940.258 bits (2429), Expect = 0.000e+0
Identity = 474/846 (56.03%), Postives = 623/846 (73.64%), Query Frame = 1
Query:  202 INDNMERDYRHIPELDTYETAGID-DDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            I D MERDYR IPELD YE  G+  DD D+ EL+ S+R   E  + +RDR EA       R       DE  E E   R+ R+ ++ A  D  GE  E +  E+IENLED +G +V +W+     + EI +RF +FLRT ++  G +V+ ERI+ M  EN  SL++NYE L A +  LAYFLPEAP  +L IFD+ A E+ L+ Y +Y +I + IHVRISHLPLV+++RSLRQ+H++QLIRTSGVV+SCT V+PQL++V+YNC +C+  +GPF Q + N E+KP +CP+CQS+GPFE+N E+T+Y+NYQRI IQESPG V AGRLPRSKDAILL DLVD CKPGDEI++TG Y   YD +LN    FPVF+T IL N+V KKD ++ +  LTDED + I +L+KD+++ E+I  SIAPSIYGHE+IKR +AL+LFGG PK  G  +++RGDINVLLCGDPGT KSQFLK++E+++ R +FTTGQGASAVGLTAYV ++  ++EWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR T+IAAANPIGGRYD +  FS+NVDLT PI+SRFDILCVVRD VDP+QD MLA+FV+GSH+RHH   + +E+  +        AM NT       ++P+P ++L+KYIIYAK+ + P LN+ +++K++++Y  LRK S   G I +TVR+ ESMIR++EAHA++HLR  V EDDVNMAIRV+LESFI T+K+S+M+ +   F +YL++++++ ELLLF LKQ+  +++T  R          IE+ EK   DKA+++NI ++  F +S L R N F  D  ++ IL Q
Sbjct:   73 IGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQRDR-EAGRGLGRMRRGLLYDSDEEDE-ERPARKRRQVER-ATED--GEEDE-EMIESIENLEDLKGHSVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQ-NQEVKPGSCPECQSAGPFEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHP--SNKEEEGLANGSAAEPAMPNTY-----GVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQR-NRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQ 903          
BLAST of DNA helicase vs. Ensembl Human
Match: MCM2 (minichromosome maintenance complex component 2 [Source:HGNC Symbol;Acc:HGNC:6944])

HSP 1 Score: 518.464 bits (1334), Expect = 2.224e-170
Identity = 258/435 (59.31%), Postives = 333/435 (76.55%), Query Frame = 1
Query: 1432 IVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            I  SIAPSIYGHE+IKR +AL+LFGG PK  G  +++RGDINVLLCGDPGT KSQFLK++E+++ R +FTTGQGASAVGLTAYV ++  ++EWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR T+IAAANPIGGRYD +  FS+NVDLT PI+SRFDILCVVRD VDP+QD MLA+FV+GSH+RHH   + +E+  +        AM NT   E     P+P ++L+KYIIYAK+ + P LN+ +++K++++Y  LRK S   G I +TVR+ ESMIR++EAHA++HLR  V EDDVNMAIRV+LESFI T+K+S+M+ +   F +YL++++++ ELLLF LKQ+  +++T  R          IE+ EK   DKA+++NI ++  F +S L R N F  D  ++ IL Q
Sbjct:  409 IFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHP--SNKEEEGLANGSAAEPAMPNTYGVE-----PLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQR-NRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQ 835          

HSP 2 Score: 385.185 bits (988), Expect = 2.231e-119
Identity = 184/340 (54.12%), Postives = 249/340 (73.24%), Query Frame = 1
Query:  412 SEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFER 1431
            S+ E   R  RK  ++      GE  E +  E+IENLED +G +V +W+     + EI +RF +FLRT ++  G +V+ ERI+ M  EN  SL++NYE L A +  LAYFLPEAP  +L IFD+ A E+ L+ Y +Y +I + IHVRISHLPLV+++RSLRQ+H++QLIRTSGVV+SCT V+PQL++V+YNC +C+  +GPF Q + N E+KP +CP+CQS+GPFE+N E+T+Y+NYQRI IQESPG V AGRLPRSKDAILL DLVD CKPGDEI++TG Y   YD +LN    FPVF+T IL N+V KKD ++ +  LTDED + I +L+KD+++ E+
Sbjct:    2 SDEEDEERPARKRRQVERATEDGEEDE-EMIESIENLEDLKGHSVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQ-NQEVKPGSCPECQSAGPFEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEK 339          
BLAST of DNA helicase vs. Ensembl Human
Match: MCM4 (minichromosome maintenance complex component 4 [Source:HGNC Symbol;Acc:HGNC:6947])

HSP 1 Score: 350.903 bits (899), Expect = 9.586e-107
Identity = 218/640 (34.06%), Postives = 345/640 (53.91%), Query Frame = 1
Query:  586 KNRFFSFLRTFLN-----------DEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTY---CIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILN---------LAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK----TKGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESF 2424
            K  F  FL+ F++           D  + +Y +R+  + +     L +N EH+ +  + L   L   P+ ++  FD   NEI   RY     +   I VR  +      +R+L    + QLI  SG+V   + ++P++    + C  C+ T    ++ +     +PS C  C ++    +   ++L+ + Q I +QESP  +PAG+ P +      +DLVD  +PGD ++VTG Y    I  +  ++N +   V+ THI V +  K D +  L GL +E  + + +         L++   ++ER+  ++APSIY HE+IK+ I L LFGG  K    T   + R +IN+LLCGDPGT KSQ L++V  L PR  +T+G+G+SAVGLTAYV K+  T++  L+ GALVL+D G+C IDEFDKMN+  R+ +HE MEQQ++SI+KAGI+  L AR++++AAANPI  +++  +   +N+ L   +LSRFD++ ++ D  D   D  LA  ++  + +      +EE++E     ++L  M                 +L+ YI YA  TI P L+++    L E Y+ +RK     G +    R  ES+IRL+EAHAK+ L   V   DV  A R+  E+ 
Sbjct:  113 KENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPD-SILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTR--VEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKS--VYKTHIDVIHYRKTDAKR-LHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQ------SEEQAE-----EELLDMA----------------VLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREAL 719          
BLAST of DNA helicase vs. Ensembl Human
Match: MCM4 (minichromosome maintenance complex component 4 [Source:HGNC Symbol;Acc:HGNC:6947])

HSP 1 Score: 351.288 bits (900), Expect = 2.165e-106
Identity = 218/640 (34.06%), Postives = 345/640 (53.91%), Query Frame = 1
Query:  586 KNRFFSFLRTFLN-----------DEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTY---CIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILN---------LAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK----TKGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESF 2424
            K  F  FL+ F++           D  + +Y +R+  + +     L +N EH+ +  + L   L   P+ ++  FD   NEI   RY     +   I VR  +      +R+L    + QLI  SG+V   + ++P++    + C  C+ T    ++ +     +PS C  C ++    +   ++L+ + Q I +QESP  +PAG+ P +      +DLVD  +PGD ++VTG Y    I  +  ++N +   V+ THI V +  K D +  L GL +E  + + +         L++   ++ER+  ++APSIY HE+IK+ I L LFGG  K    T   + R +IN+LLCGDPGT KSQ L++V  L PR  +T+G+G+SAVGLTAYV K+  T++  L+ GALVL+D G+C IDEFDKMN+  R+ +HE MEQQ++SI+KAGI+  L AR++++AAANPI  +++  +   +N+ L   +LSRFD++ ++ D  D   D  LA  ++  + +      +EE++E     ++L  M                 +L+ YI YA  TI P L+++    L E Y+ +RK     G +    R  ES+IRL+EAHAK+ L   V   DV  A R+  E+ 
Sbjct:  163 KENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPD-SILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTR--VEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKS--VYKTHIDVIHYRKTDAKR-LHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQ------SEEQAE-----EELLDMA----------------VLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREAL 769          
BLAST of DNA helicase vs. Ensembl Human
Match: MCM4 (minichromosome maintenance complex component 4 [Source:HGNC Symbol;Acc:HGNC:6947])

HSP 1 Score: 351.288 bits (900), Expect = 2.165e-106
Identity = 218/640 (34.06%), Postives = 345/640 (53.91%), Query Frame = 1
Query:  586 KNRFFSFLRTFLN-----------DEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTY---CIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILN---------LAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK----TKGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESF 2424
            K  F  FL+ F++           D  + +Y +R+  + +     L +N EH+ +  + L   L   P+ ++  FD   NEI   RY     +   I VR  +      +R+L    + QLI  SG+V   + ++P++    + C  C+ T    ++ +     +PS C  C ++    +   ++L+ + Q I +QESP  +PAG+ P +      +DLVD  +PGD ++VTG Y    I  +  ++N +   V+ THI V +  K D +  L GL +E  + + +         L++   ++ER+  ++APSIY HE+IK+ I L LFGG  K    T   + R +IN+LLCGDPGT KSQ L++V  L PR  +T+G+G+SAVGLTAYV K+  T++  L+ GALVL+D G+C IDEFDKMN+  R+ +HE MEQQ++SI+KAGI+  L AR++++AAANPI  +++  +   +N+ L   +LSRFD++ ++ D  D   D  LA  ++  + +      +EE++E     ++L  M                 +L+ YI YA  TI P L+++    L E Y+ +RK     G +    R  ES+IRL+EAHAK+ L   V   DV  A R+  E+ 
Sbjct:  163 KENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPD-SILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTR--VEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKS--VYKTHIDVIHYRKTDAKR-LHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQ------SEEQAE-----EELLDMA----------------VLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREAL 769          
BLAST of DNA helicase vs. Ensembl Celegans
Match: mcm-2 (DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6])

HSP 1 Score: 808.135 bits (2086), Expect = 0.000e+0
Identity = 425/853 (49.82%), Postives = 578/853 (67.76%), Query Frame = 1
Query:  208 DNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRL---EAIASGNLRRGMHDIFED-ESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSV-YAERIAAMALENGRSLIINYEHLV--AAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKL---TEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            D+MERDYR  PELD Y  +G+DD +D+  LS S R   E E+ +RD+L   +A+           ++ED +S E +   R   +  +  A D      E +    ++ LE+ RG T+ D +   +  +EI+ RF +FLR+F     K   Y + I +MA +N  SL +++  L     +Q ++YFLPEAP  ML I D+ A E+ ++ Y  Y ++ + I VRIS LP+ + IR LRQVH++ LIRT+GVV+  + ++PQL VV+Y+C+ C   +GPF+Q ++++E++P+ CP CQ  GPFE+N E T+Y NYQRIT+QESP  V AGRLPRSKD ILL DL D CKPGDEI+VTG Y   +D +LN KQ FPVF+T I  N++  KD ++    LTDED + I  L++D  + +R+  SIAPSIYGH+++KRAIAL+LF G  K  G  +RLRGDINVLLCGDPGT KSQFL++   +APR V TTGQGASAVGLTAYV ++  T+EWTLEAGA+VLADKGVCLIDEFDKM+DQDRTSIHEAMEQQSISISKAGIV SL AR T+IAA+NPIGGRY+ TR F++NVDLT PILSRFD+LCV+RD VD ++D  LAKFV+G+H  HH      +  ++VK+ D+L    +  D   G ++ IP DLLRKYIIYA++   P+L + +  K S ++  +RK S   G + +TVR+ ESMIRLSEAHAKLHLR  VN++D   AIRV+LESF++T+K S+M+ ++  F ++L   ++  ELLLF LKQ+   ++   T   A G       + I E  F +KA+++ I +VK F  S +  +NNF +D  K+ I+ +
Sbjct:   51 DDMERDYREQPELDQYSESGMDDASDVGSLSVSARRAAEREMAQRDQLLDDDAL-----------MYEDGDSEEVDTRRRGRGRRGRGDAADDDSVPMEEEDI-PVDILENIRGRTIRDHVSDEAVAKEIERRFKNFLRSFHEPGNKQTKYIQMIKSMAADNRESLEVSFTDLSDDNGEQNISYFLPEAPNEMLAIMDRAATEVVMNMYPFYSRVCNEIKVRISQLPVEEDIRMLRQVHLNMLIRTAGVVTIASGILPQLAVVKYDCVACGYLLGPFVQ-QNDEEVRPTICPSCQGKGPFELNVENTVYHNYQRITMQESPNKVAAGRLPRSKDVILLGDLCDSCKPGDEIEVTGVYTNNFDGSLNYKQGFPVFNTLIHANHITNKD-KMASDQLTDEDIKAIRELSQDPNISQRVFSSIAPSIYGHDDVKRAIALALFRGEAKNPGAKHRLRGDINVLLCGDPGTAKSQFLRYAAHIAPRSVLTTGQGASAVGLTAYVQRHPVTREWTLEAGAMVLADKGVCLIDEFDKMSDQDRTSIHEAMEQQSISISKAGIVTSLHARCTVIAASNPIGGRYNPTRTFAENVDLTEPILSRFDVLCVIRDSVDSVEDERLAKFVVGNHRTHH-----PDAKKIVKEGDELEE--DQMDERTG-VRLIPQDLLRKYIIYAREKCHPTLPEQHSEKFSNIFAQMRKESMATGSVAITVRHVESMIRLSEAHAKLHLRSYVNDEDCAAAIRVMLESFVNTQKASIMRMMKKTFSRHLTENRSANELLLFILKQLIRQQMHYATARAAAG--TILQSVTIPESEFIEKAQQLRIENVKPFYTSEIFASNNFLYDPSKKTIVQE 879          
BLAST of DNA helicase vs. Ensembl Celegans
Match: mcm-2 (DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6])

HSP 1 Score: 808.135 bits (2086), Expect = 0.000e+0
Identity = 425/853 (49.82%), Postives = 578/853 (67.76%), Query Frame = 1
Query:  208 DNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRL---EAIASGNLRRGMHDIFED-ESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSV-YAERIAAMALENGRSLIINYEHLV--AAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKL---TEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            D+MERDYR  PELD Y  +G+DD +D+  LS S R   E E+ +RD+L   +A+           ++ED +S E +   R   +  +  A D      E +    ++ LE+ RG T+ D +   +  +EI+ RF +FLR+F     K   Y + I +MA +N  SL +++  L     +Q ++YFLPEAP  ML I D+ A E+ ++ Y  Y ++ + I VRIS LP+ + IR LRQVH++ LIRT+GVV+  + ++PQL VV+Y+C+ C   +GPF+Q ++++E++P+ CP CQ  GPFE+N E T+Y NYQRIT+QESP  V AGRLPRSKD ILL DL D CKPGDEI+VTG Y   +D +LN KQ FPVF+T I  N++  KD ++    LTDED + I  L++D  + +R+  SIAPSIYGH+++KRAIAL+LF G  K  G  +RLRGDINVLLCGDPGT KSQFL++   +APR V TTGQGASAVGLTAYV ++  T+EWTLEAGA+VLADKGVCLIDEFDKM+DQDRTSIHEAMEQQSISISKAGIV SL AR T+IAA+NPIGGRY+ TR F++NVDLT PILSRFD+LCV+RD VD ++D  LAKFV+G+H  HH      +  ++VK+ D+L    +  D   G ++ IP DLLRKYIIYA++   P+L + +  K S ++  +RK S   G + +TVR+ ESMIRLSEAHAKLHLR  VN++D   AIRV+LESF++T+K S+M+ ++  F ++L   ++  ELLLF LKQ+   ++   T   A G       + I E  F +KA+++ I +VK F  S +  +NNF +D  K+ I+ +
Sbjct:   51 DDMERDYREQPELDQYSESGMDDASDVGSLSVSARRAAEREMAQRDQLLDDDAL-----------MYEDGDSEEVDTRRRGRGRRGRGDAADDDSVPMEEEDI-PVDILENIRGRTIRDHVSDEAVAKEIERRFKNFLRSFHEPGNKQTKYIQMIKSMAADNRESLEVSFTDLSDDNGEQNISYFLPEAPNEMLAIMDRAATEVVMNMYPFYSRVCNEIKVRISQLPVEEDIRMLRQVHLNMLIRTAGVVTIASGILPQLAVVKYDCVACGYLLGPFVQ-QNDEEVRPTICPSCQGKGPFELNVENTVYHNYQRITMQESPNKVAAGRLPRSKDVILLGDLCDSCKPGDEIEVTGVYTNNFDGSLNYKQGFPVFNTLIHANHITNKD-KMASDQLTDEDIKAIRELSQDPNISQRVFSSIAPSIYGHDDVKRAIALALFRGEAKNPGAKHRLRGDINVLLCGDPGTAKSQFLRYAAHIAPRSVLTTGQGASAVGLTAYVQRHPVTREWTLEAGAMVLADKGVCLIDEFDKMSDQDRTSIHEAMEQQSISISKAGIVTSLHARCTVIAASNPIGGRYNPTRTFAENVDLTEPILSRFDVLCVIRDSVDSVEDERLAKFVVGNHRTHH-----PDAKKIVKEGDELEE--DQMDERTG-VRLIPQDLLRKYIIYAREKCHPTLPEQHSEKFSNIFAQMRKESMATGSVAITVRHVESMIRLSEAHAKLHLRSYVNDEDCAAAIRVMLESFVNTQKASIMRMMKKTFSRHLTENRSANELLLFILKQLIRQQMHYATARAAAG--TILQSVTIPESEFIEKAQQLRIENVKPFYTSEIFASNNFLYDPSKKTIVQE 879          
BLAST of DNA helicase vs. Ensembl Celegans
Match: mcm-4 (DNA replication licensing factor mcm-4 [Source:UniProtKB/Swiss-Prot;Acc:Q95XQ8])

HSP 1 Score: 352.443 bits (903), Expect = 1.173e-107
Identity = 211/591 (35.70%), Postives = 328/591 (55.50%), Query Frame = 1
Query:  694 INYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRA----LNNKQ--CFPVFSTHILVNYVLKKDEQLILSG----LTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK----TKGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESF 2424
            +N +HL A  +AL   +   P  ++   D V NE+   R+ R   +  SI +R  +      +R L    V QLI  SG+V+  ++++P++    + C  C+  I   +     +E  P  C +C ++  F++   ++++ + Q + +QESP  +P+G  P +        LV+  +PGD I VTG +     RA    +N KQ     V+ T I   +  K D   +       +T+E  + I+ L+K   + + +  SIAPSIY H+++KR +   LFGG  K    T   +LR +IN+LLCGDPGT KSQ L++V +L PR  +T+G+G+SAVGLTA V+++  TK+  L+ GALVLAD GVC IDEFDKMN+  R+ +HE MEQQ++SI+KAGI+  L AR++++AAANP+  +++  +   +N+ L   +LSRFD++ ++ D  D +QD  L   ++  +  + G    +EK+E V                        ++LLR YI YAK  I P L+++    + E YL +RKA  ++G I    R  ES+IRLSEAHAK+ L Q V+ DDV  A  +  E+ 
Sbjct:  174 LNLKHLNAFSEALYRKVIAYPADVIPYLDIVVNEVFAERFNR--TLAQSIELRPFNAQKTRNMRGLNPNDVDQLITISGMVTRTSSLIPEMRSGYFQCAVCAFGIESEVDKGRIEE--PVVCTNCSNTHCFQLVHNRSVFLDKQVVKLQESPDDMPSGETPHTVSVYAHGSLVESVQPGDRITVTGIF-----RATGMKVNPKQRALASVYRTSIDALHFRKMDTSRLHQDNGETITEERIQQIIELSKRPDIMDALAQSIAPSIYEHDDVKRGLLCLLFGGTRKDDETTNKTKLRSEINILLCGDPGTSKSQMLQYVYRLLPRSQYTSGKGSSAVGLTASVSRDADTKQLVLQTGALVLADNGVCCIDEFDKMNESARSVLHEVMEQQTLSIAKAGIICQLNARASVLAAANPVDSKWNRNKTIVENITLPHTLLSRFDLIFLIVDAQDEMQDRRLGNHLVSLYFENDGN---QEKTEHVD-----------------------MNLLRDYIAYAKANIHPKLSEEASQFIIEKYLFMRKAGAQHGQITAYPRQLESLIRLSEAHAKIRLSQEVSVDDVEKAFTLWREAL 729          
BLAST of DNA helicase vs. Ensembl Celegans
Match: mcm-4 (DNA replication licensing factor mcm-4 [Source:UniProtKB/Swiss-Prot;Acc:Q95XQ8])

HSP 1 Score: 352.443 bits (903), Expect = 1.173e-107
Identity = 211/591 (35.70%), Postives = 328/591 (55.50%), Query Frame = 1
Query:  694 INYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRA----LNNKQ--CFPVFSTHILVNYVLKKDEQLILSG----LTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK----TKGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESF 2424
            +N +HL A  +AL   +   P  ++   D V NE+   R+ R   +  SI +R  +      +R L    V QLI  SG+V+  ++++P++    + C  C+  I   +     +E  P  C +C ++  F++   ++++ + Q + +QESP  +P+G  P +        LV+  +PGD I VTG +     RA    +N KQ     V+ T I   +  K D   +       +T+E  + I+ L+K   + + +  SIAPSIY H+++KR +   LFGG  K    T   +LR +IN+LLCGDPGT KSQ L++V +L PR  +T+G+G+SAVGLTA V+++  TK+  L+ GALVLAD GVC IDEFDKMN+  R+ +HE MEQQ++SI+KAGI+  L AR++++AAANP+  +++  +   +N+ L   +LSRFD++ ++ D  D +QD  L   ++  +  + G    +EK+E V                        ++LLR YI YAK  I P L+++    + E YL +RKA  ++G I    R  ES+IRLSEAHAK+ L Q V+ DDV  A  +  E+ 
Sbjct:  174 LNLKHLNAFSEALYRKVIAYPADVIPYLDIVVNEVFAERFNR--TLAQSIELRPFNAQKTRNMRGLNPNDVDQLITISGMVTRTSSLIPEMRSGYFQCAVCAFGIESEVDKGRIEE--PVVCTNCSNTHCFQLVHNRSVFLDKQVVKLQESPDDMPSGETPHTVSVYAHGSLVESVQPGDRITVTGIF-----RATGMKVNPKQRALASVYRTSIDALHFRKMDTSRLHQDNGETITEERIQQIIELSKRPDIMDALAQSIAPSIYEHDDVKRGLLCLLFGGTRKDDETTNKTKLRSEINILLCGDPGTSKSQMLQYVYRLLPRSQYTSGKGSSAVGLTASVSRDADTKQLVLQTGALVLADNGVCCIDEFDKMNESARSVLHEVMEQQTLSIAKAGIICQLNARASVLAAANPVDSKWNRNKTIVENITLPHTLLSRFDLIFLIVDAQDEMQDRRLGNHLVSLYFENDGN---QEKTEHVD-----------------------MNLLRDYIAYAKANIHPKLSEEASQFIIEKYLFMRKAGAQHGQITAYPRQLESLIRLSEAHAKIRLSQEVSVDDVEKAFTLWREAL 729          
BLAST of DNA helicase vs. Ensembl Celegans
Match: mcm-5 (DNA replication licensing factor mcm-5 [Source:UniProtKB/Swiss-Prot;Acc:Q21902])

HSP 1 Score: 317.005 bits (811), Expect = 4.505e-95
Identity = 222/722 (30.75%), Postives = 355/722 (49.17%), Query Frame = 1
Query:  577 QEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDK----VANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTI-----GPFIQGESNDEIKPSTCPDCQSS-------GPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFY-------DRALNNKQC--FPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK--TKGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQP------IPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKA-----------SQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVL---------------LESFISTEKYSLMKHLENKFRQYLNYKKNDYELLL---FTLKQMFHDKLTE 2556
            +++  +F +F+R F       +Y +++      +   L IN  HL    + +   L + P  +L   ++    VA+EIT  R    ++++D I V ++       +R ++   V Q+++ SG++ +   V  +   V   C +C  TI      P ++G +     P TC   Q          P+ +  +K    +YQ + +QE+P  VP G +PR         L D   PG+ + + G Y I         D++L   +     V   H+  +   + +     +  T E+ R    LA+ +  +E I  SIAPSIYG  +IK++IA  LFGG  K    G   RGDINVLL GDPGT KSQ LKFVEQ++P  V+T+G+G+SA GLTA V ++  ++ + +E GA+VLAD GV  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI  +L +R +++AAAN + GR+D +R   DN+D    ILSRFD++ +V+D  D ++D  LAK VI  H+           +   K+ D  G          G +        + ++ L+K++ YA+    P L      KL   Y+ +R                N  I +TVR  E+++R++E+ AK+ L+Q   +  V  A+R+                +E F ST     +  +E + ++      +  E L+   F  +Q + + L +
Sbjct:   33 RQLITQFRNFIRDFSTGGFGMIYRDQLKRNYFSHEYRLEINLNHLKNFDEDIEMKLRKFPGKVLPALEEAAKIVADEITTPRPKGEEKLHD-IQVTLTLDEYPTSLRQVKSAQVSQVVKISGIIVAAAQVRSKATKVTLQCRQCKHTIPDVSIKPGLEGFA----LPRTCAAPQQGQMQRCPIDPYIMLPDKCECVDYQTLKLQENPEDVPHGEMPRHLQLFTERYLTDKVVPGNRVTIVGVYSIKKLIQKKGGDKSLQGIRTPYLRVLGIHMETSGPGRTN----FTTFTPEEERMFKTLAQRKDAYELIAKSIAPSIYGSADIKKSIACLLFGGARKKLPDGITRRGDINVLLLGDPGTAKSQLLKFVEQVSPIGVYTSGKGSSAAGLTASVIRDPQSRSFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVYGRWDESRG-DDNIDFMPTILSRFDMIYIVKDTHDVLKDATLAKHVIEVHV----------NASAAKERDIAGVPKTATTDSDGVMTMFDTDGFLTIEFLKKFVTYARLNCGPRLTPQASEKLVNHYVKMRNPVVNADAFKSGKKAHNSAIPITVRQLEAIVRIAESIAKMELQQFATDKHVEEALRLFRVSTIEAAATGNLAGVEGFTSTADQEALNRIEVQMKKRFAIGTHVSEHLIVQDFVARQHYRESLVK 734          
BLAST of DNA helicase vs. Ensembl Fly
Match: Mcm2 (gene:FBgn0014861 transcript:FBtr0081827)

HSP 1 Score: 907.131 bits (2343), Expect = 0.000e+0
Identity = 456/870 (52.41%), Postives = 618/870 (71.03%), Query Frame = 1
Query:  124 PFEDETXXXXXXXXXXXXXXXXXXXXINDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILH 2727
            PFE+E E+L      +  EE +GEEL  DNME DYR +PELD Y+ A +DD+ D  E+SQ +R   E E+ +RDR   I   +   G    F     E +   R  R+A + AA   VGE  +++  E+IENLEDT+G +  +W+     + EI NRF SFLRTF+++ G   Y +RI  M  +N  S +++Y  L   +  LAYFLPEAP  ML+IFDKVA ++ LS +  Y+++   IHVRIS LPL++++R+ R++H++QL+RT GVV++ T V+PQL+V++Y+C++C   +GPF+Q + N EIKP +CP+CQS+GPF IN E+TLY+NYQ+IT+QESPG +PAGR+PRSKD ILL DL D CKPGDE++VTG Y   YD +LN  Q FPVF+T I+ N+V+ KD + ++  LTDED   I  L+KD R+ ER+V S+APSIYGH+ IKRA+AL+LFGG  K  G  +++RGDIN+L+CGDPGT KSQFLK+ E++APR VFTTGQGASAVGLTAYV +N  ++EWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR T+IAAANPIGGRYD +  FS+NV+L+ PILSRFD+LCVV+D  DP+QD  LAKFV+ SHM+HH                         + +  T+  IP DLLR+YI+YAK+ I P L   +E+K++++Y  LR+ S   G + +TVR+ ES+IR+SEAHA++HLR+ V E DV+MAIR++LESFI  +K+S+MK + + F++YL+++K+  ELL F L+Q+  D+L  +R        + +EI E+   ++AK+++I ++K F  S L RTN F +D  +R IL 
Sbjct:   34 PFENEDEILGDQTVRDEAEEEDGEELFGDNMENDYRPMPELDHYDPALLDDEDDFSEMSQGDRFAAESEMRRRDRAAGIHRDDRDLG----FGQSDDEDDVGPRAKRRAGEKAA---VGEVEDTEMVESIENLEDTKGHSTKEWVSMLGPRTEIANRFQSFLRTFVDERGAYTYRDRIRRMCEQNMSSFVVSYTDLANKEHVLAYFLPEAPFQMLEIFDKVAKDMVLSIFPTYERVTTEIHVRISELPLIEELRTFRKLHLNQLVRTLGVVTATTGVLPQLSVIKYDCVKCGYVLGPFVQSQ-NTEIKPGSCPECQSTGPFSINMEQTLYRNYQKITLQESPGRIPAGRIPRSKDVILLADLCDQCKPGDELEVTGIYTNNYDGSLNTDQGFPVFATVIIANHVVVKDSKQVVQSLTDEDIATIQKLSKDPRIVERVVASMAPSIYGHDYIKRALALALFGGESKNPGEKHKVRGDINLLICGDPGTAKSQFLKYTEKVAPRAVFTTGQGASAVGLTAYVRRNPVSREWTLEAGALVLADQGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSMTFSENVNLSEPILSRFDVLCVVKDEFDPMQDQQLAKFVVHSHMKHHPSEE---------------EQPELEEPQLKTVDEIPQDLLRQYIVYAKENIRPKLTNIDEDKIAKMYAQLRQESFATGSLPITVRHIESVIRMSEAHARMHLRENVMEADVSMAIRMMLESFIEAQKFSVMKKMRSTFQKYLSFQKDHSELLFFILRQLTLDQLAYIRCKD-GPGATHVEIMERDLIERAKQLDIVNLKPFYESDLFRTNGFSYDPKRRIILQ 879          
BLAST of DNA helicase vs. Ensembl Fly
Match: dpa (gene:FBgn0015929 transcript:FBtr0345797)

HSP 1 Score: 335.88 bits (860), Expect = 5.012e-101
Identity = 223/643 (34.68%), Postives = 342/643 (53.19%), Query Frame = 1
Query:  580 EIKNRFFSFLRTFLN------------DEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCS-CTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTY-CIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRN----------ILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK---TKGNR-LRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESF 2424
            + K++F SF+  F++            D  + +Y +++  +       L +N  HL    Q L   L   P+ ++  FD   NE+   RY     +   I VR  +      +RSL    + QLI  SG+V   +NV+P++    ++C  CS  T     +G  N   +P+ C +C ++  F +   ++ + + Q + +QESP  + AG+ P +      +DLVD  +PGD + VTG Y          +     V+ TH+ V +  K D + +     DE+ ++          +  LAK   +++R+  +IAPSIY +++IK+ I L LFGG  K   T G +  R +I++LLCGDPGT KSQ L++V  L PR  +T+G+G+SAVGLTAYVTK+  T++  L+ GALVLAD GVC IDEFDKMND  R+ +HE MEQQ++SI+KAGI+  L AR++I+AAANP   +++  +N  DNV L   +LSRFD++ +V D  D I D  LA     SH+     +T  E+ + +                        + +LR YI YA++ + P+L+ + + +L + Y+ +RK     G I    R  ES+IRLSEAHAK+ L   V   DV  A R+  E+ 
Sbjct:  163 QCKSKFKSFIMRFIDPSAEQDEISENIDVNQPLYLQKLEEIHTLEEPYLNLNCAHLKTFDQDLYRQLICYPQEVIPGFDMAINEMFFERYP-AALLEHQIQVRPFNADKTRNMRSLNPEDMDQLISISGMVIRSSNVIPEMREAFFSCNICSFSTTVEVDRGRIN---QPTLCTNCNTNHCFRLIHNRSEFTDKQLVKLQESPDDMAAGQTPHNVLLYAHNDLVDKVQPGDRVTVTGIYRATPLKTGGLSSSVKSVYKTHVDVVHFRKVDNKRLYE---DEEGKDHIFPPERVELLQLLAKKPDIYDRLARAIAPSIYENDDIKKGILLQLFGGTKKKHATLGRQNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLA-----SHLVSLYYVTRHEEEDTM----------------------FDMSVLRDYIAYAREHLSPTLSDEAQQRLIQAYVDMRKVGAGRGQISAYPRQLESLIRLSEAHAKVRLSNQVELLDVEEAWRLHREAL 771          
BLAST of DNA helicase vs. Ensembl Fly
Match: dpa (gene:FBgn0015929 transcript:FBtr0088982)

HSP 1 Score: 335.88 bits (860), Expect = 5.012e-101
Identity = 223/643 (34.68%), Postives = 342/643 (53.19%), Query Frame = 1
Query:  580 EIKNRFFSFLRTFLN------------DEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCS-CTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTY-CIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRN----------ILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK---TKGNR-LRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESF 2424
            + K++F SF+  F++            D  + +Y +++  +       L +N  HL    Q L   L   P+ ++  FD   NE+   RY     +   I VR  +      +RSL    + QLI  SG+V   +NV+P++    ++C  CS  T     +G  N   +P+ C +C ++  F +   ++ + + Q + +QESP  + AG+ P +      +DLVD  +PGD + VTG Y          +     V+ TH+ V +  K D + +     DE+ ++          +  LAK   +++R+  +IAPSIY +++IK+ I L LFGG  K   T G +  R +I++LLCGDPGT KSQ L++V  L PR  +T+G+G+SAVGLTAYVTK+  T++  L+ GALVLAD GVC IDEFDKMND  R+ +HE MEQQ++SI+KAGI+  L AR++I+AAANP   +++  +N  DNV L   +LSRFD++ +V D  D I D  LA     SH+     +T  E+ + +                        + +LR YI YA++ + P+L+ + + +L + Y+ +RK     G I    R  ES+IRLSEAHAK+ L   V   DV  A R+  E+ 
Sbjct:  163 QCKSKFKSFIMRFIDPSAEQDEISENIDVNQPLYLQKLEEIHTLEEPYLNLNCAHLKTFDQDLYRQLICYPQEVIPGFDMAINEMFFERYP-AALLEHQIQVRPFNADKTRNMRSLNPEDMDQLISISGMVIRSSNVIPEMREAFFSCNICSFSTTVEVDRGRIN---QPTLCTNCNTNHCFRLIHNRSEFTDKQLVKLQESPDDMAAGQTPHNVLLYAHNDLVDKVQPGDRVTVTGIYRATPLKTGGLSSSVKSVYKTHVDVVHFRKVDNKRLYE---DEEGKDHIFPPERVELLQLLAKKPDIYDRLARAIAPSIYENDDIKKGILLQLFGGTKKKHATLGRQNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLA-----SHLVSLYYVTRHEEEDTM----------------------FDMSVLRDYIAYAREHLSPTLSDEAQQRLIQAYVDMRKVGAGRGQISAYPRQLESLIRLSEAHAKVRLSNQVELLDVEEAWRLHREAL 771          
BLAST of DNA helicase vs. Ensembl Fly
Match: Mcm5 (gene:FBgn0017577 transcript:FBtr0082279)

HSP 1 Score: 322.398 bits (825), Expect = 2.923e-97
Identity = 223/647 (34.47%), Postives = 338/647 (52.24%), Query Frame = 1
Query:  577 QEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLI-INYEHLVAAQQALAYFLPEAPKGMLDIFDK----VANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTI-----GPFIQGESNDEIKPSTC-------PDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIF-----YDRALNNKQCFPVFSTHILVNYVLKKDEQL----ILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKGNRL--RGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLR-------KASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVL 2412
            Q +K ++  F+RTF  +     Y + +    L NGR  + I  E LV   + LA  L + P   L+IF++    VA+EIT  R    + ++D I + +S       IR L+   V +L++ +G++ + + +  +   +   C+ CS  I      P ++G +     P  C       P C    PF I  +K    ++Q + +QE P  VP G +PR         L +   PG+ + + G Y I        R    K    V + ++ V  +    E        S +T ++  +   +A    ++ER+  S+APSI+G  +IK+AI   LFGG  K   + L  RGDINVLL GDPGT KSQ LKFVE++AP  V+T+G+G+SA GLTA V K+  T+ + +E GA+VLAD GV  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI  +L +R +++AAAN I GR+D T+   +N+D    ILSRFD++ +V+D+ D  +D  LAK +I  H+  +    +E                  A+ E      I L   +KYI Y +    P L++    KL   Y+ +R       KAS +   I +TVR  E++IR+SE+ AK+ L+    ++ VN A+R+ 
Sbjct:   28 QAVKKKYKEFIRTFNEENFFYKYRDTLKRNYL-NGRYFLEIEMEDLVGFDETLADKLNKQPTEHLEIFEEAAREVADEITAPRPEHEEHMHD-IQILLSSNANPTNIRQLKSDCVSKLVKIAGIIVAASGISAKATRMSIQCLSCSTVIPNLKVNPGLEGYA----LPRKCNTEQAGRPKCPLD-PFFIMPDKCKCVDFQTLKLQELPDFVPQGEIPRHLQLFCDRSLCERVVPGNRVLIQGIYSIRKVGKPSRRDGREKAVVGVRAPYMRVVGITVDSEGAGAISRYSNITSDEEEHFRRMAASGDIYERLSQSLAPSIFGSRDIKKAITCMLFGGSRKRLPDGLCRRGDINVLLLGDPGTAKSQLLKFVEKVAPIAVYTSGKGSSAAGLTASVMKDPQTRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSIFGRWDDTKG-EENIDFMPTILSRFDMIFIVKDIHDESRDITLAKHIINVHLSSNKSAPSE-----------------PAEGE------ISLSTFKKYIHYCRTHCGPRLSEAAGEKLKSRYVLMRSGAGQQEKASDKRLSIPITVRQLEAVIRISESLAKIRLQPFATDEHVNEALRLF 643          
BLAST of DNA helicase vs. Ensembl Fly
Match: Mcm3 (gene:FBgn0284442 transcript:FBtr0340476)

HSP 1 Score: 324.709 bits (831), Expect = 2.953e-97
Identity = 235/653 (35.99%), Postives = 344/653 (52.68%), Query Frame = 1
Query:  577 QEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVA--AQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQI--RSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTC--PDCQSSGPF-EINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQ---CFPVFSTHILVNYV--LKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK--TKGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGK--------------------LTAEEK-SEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDV------TVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVL 2412
            ++I+  +  FL    ++E + +YA  +  M  E  + LI+N   L     Q+AL      A + +   F +   E   +    Y ++++ + V          +  RSL  +++  ++   G+V+  + + P++    + C      +       ++ E  PS    P     G   E     ++YK++Q +TIQE P   PAG+LPRS D +  DDLVD CKPGD + + G+Y     R L  K+       F T +L N +  L K+  L +S    ED      LAK+  +FE +  S+APSI+GH  +K+AI   L GGV K    G RLRGDINVLL GDP   KSQ L++V   APR + TTG+G+S VGLTA VT +  T E  LEAGA+VLAD+GV  IDEFDKM+D DRT+IHE MEQ  ++ISKAGI ASL AR +++AAANP+ GRYD  +   +N+ L   +LSRFD+L V+ DV+D   D M++  V+  H   + K                     ++EEK +EV +K D L    +    E    + + ++ +RKYI  AK  + P L +     ++  Y  LR  SQE    DV      T R  E++IRLS AHA+  + ++V  DD + AI ++
Sbjct:   10 KDIQREYVDFLD---DEEDQGIYAGHVKDMIAEKSKRLIVNVNDLKRKNPQRALGLLSNAADEQL--AFGRALKEYASTVDPGYAKMHEDLFVGFEGCFGNRHVTPRSLTSIYLGNMVCVEGIVTKVSLIRPKVVRSVHYCPNTRKVMERKYTDLTSFEAVPSGAAYPTKDEDGNLLETEYGLSVYKDHQTLTIQEMPEKAPAGQLPRSVDIVCDDDLVDRCKPGDRVQIVGSY-----RCLPGKRGGYTSGTFRTVLLANNISLLSKESNLDIS---REDIMLCKKLAKNNDIFELLSKSLAPSIHGHAYVKQAILCLLLGGVEKILPNGTRLRGDINVLLIGDPSVAKSQLLRYVLNTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHASLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFVMLDVIDSDVDQMISDHVVRMHRYRNPKEADGEPLSMGSSYADSLSFVSSSEEKDTEVYEKYDALLHGKSRQRHE----KILSVEFMRKYIHIAK-CMKPKLGEQACEAIANEYSRLR--SQEAVETDVARTQPITARTLETLIRLSTAHARARMSKSVTIDDAHAAIELV 642          
BLAST of DNA helicase vs. Ensembl Zebrafish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:ZFIN;Acc:ZDB-GENE-020419-24])

HSP 1 Score: 951.429 bits (2458), Expect = 0.000e+0
Identity = 477/845 (56.45%), Postives = 624/845 (73.85%), Query Frame = 1
Query:  202 INDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            I D MERDYR IPELD YE  G+D+D DL ELS S R   E  + +RDR + +  G + RG+  +++ E  + +   +R R   + AA     E  + +  E+IENLED +G TV +W+   + + EI +RF +FLRT +++ G +V+ ERI+ M  EN  SL++NYE L + +  LAYFLPEAP  ML IFD+ A E+ L+ Y +Y +I   IHVRI +LPLV+++RSLRQ+H++QLIRTSGVV+SCT V+PQL +V+YNC +C+  +GPF Q + N E+KP +CP+CQS GPFEIN E+T+Y+NYQRITIQESPG V AGRLPRSKDAILL DLVD+CKPGDEI++TG Y   YD +LN    FPVF+T IL N++ +KDE + ++ LTDED + I+ L+KDER+ ERI  SI PSIY HE+IKR +AL+LFGG  K  G  +++RGDINVLLCGDPGT KSQFLK+VE++A R VFTTGQGASAVGLTAYV ++  ++EWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR T+IAAANPIGGRYD +  FS+NVDLT PI+SRFD+LCVVRD VDP+QD MLA+FV+GSH++HH       K   V  L+++  + NT D     + PIP +LLRKYIIYAK+ + P LN+ +++K++ +Y  LRK S   G I +TVR+ ESMIR++EAHA++HLR  V EDDVNMAIRV+LESFI T+K+S+M+ +   F +YL +++++ ELLLF LKQ+  ++++  R          IEI+EK   DKA+++NI S+  F +S L R+N F  D  K+ I+ Q
Sbjct:   58 IGDAMERDYRVIPELDRYEAEGLDEDEDLSELSPSARAEAEAAMRRRDREQGLGMGRIGRGL--LYDSEDEDDKRPTKRQRVLAERAAEGGAMEGEDEEMIESIENLEDMKGHTVREWVSMAAPRLEIYHRFKNFLRTHVDEHGHNVFKERISDMCKENKESLLVNYEELASREHVLAYFLPEAPAEMLKIFDEAAKEVVLAMYPKYDRIAHEIHVRIGNLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCNFILGPFFQSQ-NQEVKPGSCPECQSLGPFEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDMCKPGDEIELTGIYHNNYDGSLNMANGFPVFATVILANHIARKDEGVAVAELTDEDVKAIVALSKDERIGERIFASIGPSIYAHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHH----PSNKEGGVAGLEEV-VLPNTFD-----VPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVLEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLAFRRDNNELLLFILKQLVSEQVSYQR-NRYGAQQDTIEIAEKDLVDKARQINIHSLSAFYDSDLFRSNKFSHDVKKKLIVQQ 888          
BLAST of DNA helicase vs. Ensembl Zebrafish
Match: mcm4 (minichromosome maintenance complex component 4 [Source:ZFIN;Acc:ZDB-GENE-030131-9544])

HSP 1 Score: 332.413 bits (851), Expect = 7.580e-100
Identity = 211/641 (32.92%), Postives = 335/641 (52.26%), Query Frame = 1
Query:  586 KNRFFSFLRTFLN-----------DEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQ--CFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNIL----------NLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK-----TKGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESF 2424
            K +F  FL+ F +           D  + +Y +++  +++     L +N  H+      L   L   P+ ++  FD   NE+   R+     +   I VR         +R+L    + QLI  SG+V   + ++P++    + C    C     ++ +     +P+ C +C ++    +   ++++ + Q I +QESP  +PAG+ P +      +DLVD  +PGD +++TG Y     R LN +Q     V+ THI   +  K DE+  L GL DED    L           LA    ++ER+  ++APSIY HE+IK+ I L LFGG  K      +GN  R ++N+LLCGDPGT KSQ L++V  L PR  +T+G+G+SAVGLTAYV K+  T++  L+ GALVL+D G+C IDEFDKM+D  R+ +HE MEQQ++SI+KAGI+  L AR++I+AAANP+  +++  +   +N+ L   +LSRFD++ ++ D  D   D  LA  ++  + +   ++  E        LD                    + +L+ YI +A+ T+ P L+++    L E Y+ +RK     G +    R  ES+IRL+EAHAK+     V   DV  A R+  E+ 
Sbjct:  145 KEKFQRFLQQFTDPDSREEENAGLDLNEPLYMQKLDEISVVGEPVLNVNCTHIQTFDADLYRQLICYPQEVIPTFDMSVNELFFDRFPD-SVLEHQIQVRPYSAIKTRNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFRC--QVCAFNTRVEVDRGRIAEPAVCRNCNTTHSMALVHNRSVFSDKQMIKLQESPEDMPAGQTPHTTVVYAHNDLVDKVQPGDRVNITGIYRAAPMR-LNPRQSQVKSVYKTHIDAIHFRKTDEKR-LHGL-DEDGEQKLFTKERVALLKELAAKPDVYERLSSALAPSIYEHEDIKKGILLQLFGGTRKDFTQTGRGN-FRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQSEEQIEEEH-------LD--------------------MAVLKDYIAFARTTVHPRLSEEASQALIEAYVDMRKIGSGRGMVSAYPRQLESLIRLAEAHAKVRFSGKVETIDVEEAKRLHREAL 751          
BLAST of DNA helicase vs. Ensembl Zebrafish
Match: mcm6 (minichromosome maintenance complex component 6 [Source:ZFIN;Acc:ZDB-GENE-030909-6])

HSP 1 Score: 332.028 bits (850), Expect = 8.558e-100
Identity = 215/668 (32.19%), Postives = 342/668 (51.20%), Query Frame = 1
Query:  595 FFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTC--PDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYD------------------------------------RALNNKQCFPVFSTHI------LVNYVLKKDEQL---ILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGID-----VTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTE 2436
            F +FL  F N +G+  Y      +      +L +++  L    Q LA  + E    +     +       +R       +   +V    LP   +IR L  V V  L+R SG V     V P+L    + C+ C   I    Q       +PS C  P C +   F +++ K+ + ++Q++ IQE+   +P G +PRS + IL  + V+  + GD+ D  G+  +  D                                    R L+ K  F   + H+           ++ +EQ    I   ++ ++   +  +++D+ L+  +  S+ P+I+G++ +KR I L LFGGVPKT  +G  LRGDINV + GDP T KSQFLK VE+  PR V+T+G+ +SA GLTA V ++  + E+ +EAGAL+LAD GVC IDEFDKM  +D+ +IHEAMEQQ+ISI+KAG+ A+L AR++I+AAANP+ GRYD +++   NV+LT+PI+SRFD+  ++ D  + + D  +A+ ++  H R                      + N+ D      +   LD +R+Y+++A+Q   P ++K++E  + E Y  LR+  ++  G+      +TVR  ES+IRLSE+ A++H    V    V  A R+L +S I  E
Sbjct:   28 FQAFLEEFQNSDGEVKYLRDAEELIRPERNTLAVSFTDLEGFNQELATAIQEEFYRLYPYLCRAVR--NFARDHGEVPTSKEFYVAFQDLPTRHKIRELTTVKVGSLVRISGQVVRTHPVHPELVSGTFLCLDCQGVIKDVEQ--QFKYTQPSICRNPVCNNRRRFLLDTNKSKFIDFQKVRIQETQAELPRGSIPRSMEVILRAEAVESAQAGDKCDFIGSLIVVPDISQLATPGVRAETSSRTAGVQGYENEGLRGLKALGVRELSYKLAF--LACHVAPTNPRFGGKEIRDEEQTAESIKKQMSVQEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGILLMLFGGVPKTTMEGTSLRGDINVCVVGDPSTAKSQFLKHVEEFCPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMETRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVSGRYDRSKSLKQNVNLTAPIMSRFDLFFILVDDCNEVTDYAIARRIVDLHSR----------------------IENSVD------RVYSLDEIRRYLLFARQ-FKPKISKESEEFIVEQYKRLRQ--RDGSGVTKSAWRITVRQLESLIRLSESMARMHCCDEVQPKHVKEAFRLLNKSIIRVE 658          
BLAST of DNA helicase vs. Ensembl Zebrafish
Match: mcm6l (MCM6 minichromosome maintenance deficient 6, like [Source:ZFIN;Acc:ZDB-GENE-050913-141])

HSP 1 Score: 327.02 bits (837), Expect = 6.548e-98
Identity = 215/667 (32.23%), Postives = 346/667 (51.87%), Query Frame = 1
Query:  595 FFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYAR-YQQINDS--IHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTC--PDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYD---------RA-----LNNKQCFPV---------------FSTHILVNYV-----------LKKDEQL---ILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGG------IDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFI 2427
            F  FL  F +  G ++Y      +      +L +++ ++    Q LA  + E    +     +      +  +AR +  I  S   +V  S  P   +IR L  V +  L+R SG V     V P+L    + C+ C   I    Q       +P+ C  P C +   F +++ K+ + ++Q++ IQE+   +P G +PRS + IL  + V+  + GD  D TGT  +  D         RA     +  K+ F                 +    L NYV           L++++Q    + + +T ++   +  +++D+ L+  +  S+ P+I+G++ IKR I L LFGGV KT  +G  LRGDINV + GDP T KSQFLK VE  APR V+T+G+ +SA GLTA V K+  + E+ +EAGAL+LAD GVC IDEFDKM+ +D+ +IHEAMEQQ+ISI+KAG+ A+L AR++I+AAANPI GRY+  ++   NV++++PI+SRFD+  ++ D  + + D  +A+ ++  H R+            V+ ++++ +                 D +++YI++A+Q   P +  + +  + + Y  LR   Q +GG        +TVR  ESM+RLSE  A+L+    V    V  A R+L +S I
Sbjct:   24 FLEFLEEFQDKNGDALYLSDAQELIRPERNTLTVSFSNIEHYNQQLATTIQEEYYRVYPFLCR-----AVRHFARDHGNIPPSKEFYVAFSEFPSRQKIRELSTVRIGTLLRISGQVVRTHPVHPELVSGTFLCLDCQSVIKDVEQ--QFKYTQPTICKNPVCANRRRFMLDTNKSRFVDFQKVRIQETQAELPRGSIPRSVEVILRAEAVETAQAGDRCDFTGTLIVVPDVSAMALAGTRAETSSRVTGKEGFEADGIQGLKALGVRELSYRLAFLANYVAPTNPRFGGKELRQEDQTAESVKNQMTVQEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEIKRGILLMLFGGVAKTTMEGTSLRGDINVCIVGDPSTSKSQFLKHVEDFAPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIDGRYNRAKSLKQNVNMSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHARN------------VESVERVYST----------------DEIQRYILFARQ-FQPKITVEAQEFVVDQYKRLR---QRDGGGTTKSAWRITVRQLESMLRLSEGMARLYCSDEVQPKHVKEAFRLLNKSII 651          
BLAST of DNA helicase vs. Ensembl Zebrafish
Match: mcm6l (MCM6 minichromosome maintenance deficient 6, like [Source:ZFIN;Acc:ZDB-GENE-050913-141])

HSP 1 Score: 326.635 bits (836), Expect = 8.290e-98
Identity = 215/667 (32.23%), Postives = 346/667 (51.87%), Query Frame = 1
Query:  595 FFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYAR-YQQINDS--IHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTC--PDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYD---------RA-----LNNKQCFPV---------------FSTHILVNYV-----------LKKDEQL---ILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGG------IDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFI 2427
            F  FL  F +  G ++Y      +      +L +++ ++    Q LA  + E    +     +      +  +AR +  I  S   +V  S  P   +IR L  V +  L+R SG V     V P+L    + C+ C   I    Q       +P+ C  P C +   F +++ K+ + ++Q++ IQE+   +P G +PRS + IL  + V+  + GD  D TGT  +  D         RA     +  K+ F                 +    L NYV           L++++Q    + + +T ++   +  +++D+ L+  +  S+ P+I+G++ IKR I L LFGGV KT  +G  LRGDINV + GDP T KSQFLK VE  APR V+T+G+ +SA GLTA V K+  + E+ +EAGAL+LAD GVC IDEFDKM+ +D+ +IHEAMEQQ+ISI+KAG+ A+L AR++I+AAANPI GRY+  ++   NV++++PI+SRFD+  ++ D  + + D  +A+ ++  H R+            V+ ++++ +                 D +++YI++A+Q   P +  + +  + + Y  LR   Q +GG        +TVR  ESM+RLSE  A+L+    V    V  A R+L +S I
Sbjct:   24 FLEFLEEFQDKNGDALYLSDAQELIRPERNTLTVSFSNIEHYNQQLATTIQEEYYRVYPFLCR-----AVRHFARDHGNIPPSKEFYVAFSEFPSRQKIRELSTVRIGTLLRISGQVVRTHPVHPELVSGTFLCLDCQSVIKDVEQ--QFKYTQPTICKNPVCANRRRFMLDTNKSRFVDFQKVRIQETQAELPRGSIPRSVEVILRAEAVETAQAGDRCDFTGTLIVVPDVSAMALAGTRAETSSRVTGKEGFEADGIQGLKALGVRELSYRLAFLANYVAPTNPRFGGKELRQEDQTAESVKNQMTVQEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEIKRGILLMLFGGVAKTTMEGTSLRGDINVCIVGDPSTSKSQFLKHVEDFAPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIDGRYNRAKSLKQNVNMSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHARN------------VESVERVYST----------------DEIQRYILFARQ-FQPKITVEAQEFVVDQYKRLR---QRDGGGTTKSAWRITVRQLESMLRLSEGMARLYCSDEVQPKHVKEAFRLLNKSII 651          
BLAST of DNA helicase vs. Ensembl Xenopus
Match: adat3 (adenosine deaminase, tRNA-specific 3 [Source:Xenbase;Acc:XB-GENE-6258400])

HSP 1 Score: 936.791 bits (2420), Expect = 0.000e+0
Identity = 474/845 (56.09%), Postives = 625/845 (73.96%), Query Frame = 1
Query:  202 INDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            I D MERDYR I ELD YE  G+DD+ D+ +L+ S+R   E+ +  RDR      G +RRG+  +++ +  + +   R+ R A++ A  +   E  E +  E+IENLED +G TV +W+   +T+ EI +RF +FLRT +++ G +V+ E+I+ M  EN  SL++NYE L A +  LAYFLPEAP  ML IFD+ A E+ L  Y +Y +I   IHVRISHLPLV+++RSLRQ+H++QLIRTSGVV+ CT V+PQL++V+YNC +C+  +GPF Q + N E+KP +CP+CQS GPFEIN E+T+Y+NYQRITIQESPG V AGRLPRSKDAILL DLVD CKPGDEI++TGTY   YD +LN    FPVF+T IL N++ KKD+++ +  LTDED + I+ L+KDER+ ERI  SIAPSIYGHE+IKR +AL+LFGG  K  G  +++RGDINVLLCGDPGT KSQFLK+VE++A R VFTTGQGASAVGLTAYV ++  TKEWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR TIIAA+NPIGGRYD +  FS+NVDLT PI+SRFDILCVVRD VDP+QD MLA+FV+GSH++HH        S+ +   ++  A+ NT   E     P+P ++L+KYI+Y+K+ I P LN+ +++K++++Y  LRK S   G I +TVR+ ESMIR++EAHA++HLR  V EDDVNMAIRV+LESFI T+K+S+M+ +   F +YL +++++ ELLLF LKQ+  ++ +  R          IE+ EK   DKA+++NI ++  F +S L + N F  D  K+ I+ Q
Sbjct:   58 IGDAMERDYRAISELDRYEAEGLDDEDDVEDLTASQRDAAEQAMRMRDREMGHELGRMRRGL--LYDSDEEDEDRPARKRRMAERAA--EGAPEEDE-EMIESIENLEDMKGHTVREWVSMAATRLEIYHRFKNFLRTHVDEHGHNVFKEKISDMCKENKESLVVNYEDLAAREHVLAYFLPEAPAEMLKIFDEAAKEVVLVMYPKYDRIAREIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTCCTGVLPQLSMVKYNCNKCNFILGPFFQSQ-NQEVKPGSCPECQSLGPFEINMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGTYHNNYDGSLNTANGFPVFATVILANHITKKDDKVAVGELTDEDVKAIIALSKDERIGERIFASIAPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTIIAASNPIGGRYDPSLTFSENVDLTEPIVSRFDILCVVRDTVDPVQDEMLARFVVGSHIKHH------PSSKDIANGEEF-ALPNTFGVE-----PLPQEVLKKYIMYSKEKIHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVVEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLAFRRDNNELLLFVLKQLVAEQTSYQR-NRYGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSDLFKMNRFTHDVKKKMIIQQ 883          
BLAST of DNA helicase vs. Ensembl Xenopus
Match: adat3 (adenosine deaminase, tRNA-specific 3 [Source:Xenbase;Acc:XB-GENE-6258400])

HSP 1 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 474/845 (56.09%), Postives = 625/845 (73.96%), Query Frame = 1
Query:  202 INDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            I D MERDYR I ELD YE  G+DD+ D+ +L+ S+R   E+ +  RDR      G +RRG+  +++ +  + +   R+ R A++ A  +   E  E +  E+IENLED +G TV +W+   +T+ EI +RF +FLRT +++ G +V+ E+I+ M  EN  SL++NYE L A +  LAYFLPEAP  ML IFD+ A E+ L  Y +Y +I   IHVRISHLPLV+++RSLRQ+H++QLIRTSGVV+ CT V+PQL++V+YNC +C+  +GPF Q + N E+KP +CP+CQS GPFEIN E+T+Y+NYQRITIQESPG V AGRLPRSKDAILL DLVD CKPGDEI++TGTY   YD +LN    FPVF+T IL N++ KKD+++ +  LTDED + I+ L+KDER+ ERI  SIAPSIYGHE+IKR +AL+LFGG  K  G  +++RGDINVLLCGDPGT KSQFLK+VE++A R VFTTGQGASAVGLTAYV ++  TKEWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR TIIAA+NPIGGRYD +  FS+NVDLT PI+SRFDILCVVRD VDP+QD MLA+FV+GSH++HH        S+ +   ++  A+ NT   E     P+P ++L+KYI+Y+K+ I P LN+ +++K++++Y  LRK S   G I +TVR+ ESMIR++EAHA++HLR  V EDDVNMAIRV+LESFI T+K+S+M+ +   F +YL +++++ ELLLF LKQ+  ++ +  R          IE+ EK   DKA+++NI ++  F +S L + N F  D  K+ I+ Q
Sbjct:   57 IGDAMERDYRAISELDRYEAEGLDDEDDVEDLTASQRDAAEQAMRMRDREMGHELGRMRRGL--LYDSDEEDEDRPARKRRMAERAA--EGAPEEDE-EMIESIENLEDMKGHTVREWVSMAATRLEIYHRFKNFLRTHVDEHGHNVFKEKISDMCKENKESLVVNYEDLAAREHVLAYFLPEAPAEMLKIFDEAAKEVVLVMYPKYDRIAREIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTCCTGVLPQLSMVKYNCNKCNFILGPFFQSQ-NQEVKPGSCPECQSLGPFEINMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGTYHNNYDGSLNTANGFPVFATVILANHITKKDDKVAVGELTDEDVKAIIALSKDERIGERIFASIAPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTIIAASNPIGGRYDPSLTFSENVDLTEPIVSRFDILCVVRDTVDPVQDEMLARFVVGSHIKHH------PSSKDIANGEEF-ALPNTFGVE-----PLPQEVLKKYIMYSKEKIHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVVEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLAFRRDNNELLLFVLKQLVAEQTSYQR-NRYGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSDLFKMNRFTHDVKKKMIIQQ 882          
BLAST of DNA helicase vs. Ensembl Xenopus
Match: adat3 (adenosine deaminase, tRNA-specific 3 [Source:Xenbase;Acc:XB-GENE-6258400])

HSP 1 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 474/845 (56.09%), Postives = 625/845 (73.96%), Query Frame = 1
Query:  202 INDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            I D MERDYR I ELD YE  G+DD+ D+ +L+ S+R   E+ +  RDR      G +RRG+  +++ +  + +   R+ R A++ A  +   E  E +  E+IENLED +G TV +W+   +T+ EI +RF +FLRT +++ G +V+ E+I+ M  EN  SL++NYE L A +  LAYFLPEAP  ML IFD+ A E+ L  Y +Y +I   IHVRISHLPLV+++RSLRQ+H++QLIRTSGVV+ CT V+PQL++V+YNC +C+  +GPF Q + N E+KP +CP+CQS GPFEIN E+T+Y+NYQRITIQESPG V AGRLPRSKDAILL DLVD CKPGDEI++TGTY   YD +LN    FPVF+T IL N++ KKD+++ +  LTDED + I+ L+KDER+ ERI  SIAPSIYGHE+IKR +AL+LFGG  K  G  +++RGDINVLLCGDPGT KSQFLK+VE++A R VFTTGQGASAVGLTAYV ++  TKEWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR TIIAA+NPIGGRYD +  FS+NVDLT PI+SRFDILCVVRD VDP+QD MLA+FV+GSH++HH        S+ +   ++  A+ NT   E     P+P ++L+KYI+Y+K+ I P LN+ +++K++++Y  LRK S   G I +TVR+ ESMIR++EAHA++HLR  V EDDVNMAIRV+LESFI T+K+S+M+ +   F +YL +++++ ELLLF LKQ+  ++ +  R          IE+ EK   DKA+++NI ++  F +S L + N F  D  K+ I+ Q
Sbjct:   77 IGDAMERDYRAISELDRYEAEGLDDEDDVEDLTASQRDAAEQAMRMRDREMGHELGRMRRGL--LYDSDEEDEDRPARKRRMAERAA--EGAPEEDE-EMIESIENLEDMKGHTVREWVSMAATRLEIYHRFKNFLRTHVDEHGHNVFKEKISDMCKENKESLVVNYEDLAAREHVLAYFLPEAPAEMLKIFDEAAKEVVLVMYPKYDRIAREIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTCCTGVLPQLSMVKYNCNKCNFILGPFFQSQ-NQEVKPGSCPECQSLGPFEINMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGTYHNNYDGSLNTANGFPVFATVILANHITKKDDKVAVGELTDEDVKAIIALSKDERIGERIFASIAPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTIIAASNPIGGRYDPSLTFSENVDLTEPIVSRFDILCVVRDTVDPVQDEMLARFVVGSHIKHH------PSSKDIANGEEF-ALPNTFGVE-----PLPQEVLKKYIMYSKEKIHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVVEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLAFRRDNNELLLFVLKQLVAEQTSYQR-NRYGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSDLFKMNRFTHDVKKKMIIQQ 902          
BLAST of DNA helicase vs. Ensembl Xenopus
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:448137])

HSP 1 Score: 344.739 bits (883), Expect = 3.076e-104
Identity = 215/641 (33.54%), Postives = 339/641 (52.89%), Query Frame = 1
Query:  586 KNRFFSFLRTFLN-----------DEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTY---CIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNIL----------NLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK----TKGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESF 2424
            K +F  F++ F++           D  + +Y +R+  + +     L ++ +HL +  Q L   L   P+ ++  FD  ANEI   RY     +   I VR  +      +RSL    + QLI  SG+V   + ++P++    + C  C+ T    ++ +     +PS C  C ++    +   ++++ + Q I +QESP  +PAG+ P +      +DLVD  +PGD ++VTG Y    I  +  + N +   V+ THI V +  K D +  L G+ DEDT   +           LA    ++ER+  ++APSIY HE+IK+ I L LFGG  K    T   + R ++N+LLCGDPGT KSQ L++V  L PR  +T+G+G+SAVGLTAYV K+  T++  L+ GALVL+D G+C IDEFDKMN+  R+ +HE MEQQ++SI+KAGI+  L AR++++AAANP+  +++  +   +N+ L   +LSRFD++ ++ D  D   D  LA  ++  + +   ++  E        LD                    + +L+ YI YA+  + P L ++    L E Y+ +RK     G +    R  ES+IRLSEAHAK+     V   DV  A R+  E+ 
Sbjct:  145 KEKFQRFVQRFIDPLAKEEENVGLDLNEPIYMQRLEEINVVGEPFLNVDCDHLRSFDQDLYRQLVCYPQEVIPTFDMAANEIFFERYPD-SILEHQIQVRPYNALKTRNMRSLNPEDIDQLITISGMVIRTSQIIPEMQEAFFKCQVCAFTTR--VEIDRGRISEPSVCKHCNTTHSMALIHNRSMFSDKQMIKLQESPEDMPAGQTPHTTILYGHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVRNVKS--VYKTHIDVIHYRKTDAKR-LHGI-DEDTEQKMFTEERVAMLKELAAKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKFRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDETYDRRLAHHLVALYYQSEEQMKEEH-------LD--------------------MAVLKDYIAYARTYVNPRLGEEASQALIEAYVDMRKIGSGRGMVSAYPRQLESLIRLSEAHAKVRFSSKVETIDVEEAKRLHREAL 751          
BLAST of DNA helicase vs. Ensembl Xenopus
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:448137])

HSP 1 Score: 342.813 bits (878), Expect = 3.285e-104
Identity = 215/637 (33.75%), Postives = 335/637 (52.59%), Query Frame = 1
Query:  586 KNRFFSFLRTFLN-----------DEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTY----CIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNIL----------NLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK----TKGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRV 2409
            K +F  F++ F++           D  + +Y +R+  + +     L ++ +HL +  Q L   L   P+ ++  FD  ANEI   RY     +   I VR  +      +RSL    + QLI  SG+V   + ++P++    + C  C+ T    ++ +     +PS C  C ++    +   ++++ + Q I +QESP  +PAG+ P +      +DLVD  +PGD ++VTG Y         R  N K    V+ THI V +  K D +  L G+ DEDT   +           LA    ++ER+  ++APSIY HE+IK+ I L LFGG  K    T   + R ++N+LLCGDPGT KSQ L++V  L PR  +T+G+G+SAVGLTAYV K+  T++  L+ GALVL+D G+C IDEFDKMN+  R+ +HE MEQQ++SI+KAGI+  L AR++++AAANP+  +++  +   +N+ L   +LSRFD++ ++ D  D   D  LA  ++  + +   ++  E        LD                    + +L+ YI YA+  + P L ++    L E Y+ +RK     G +    R  ES+IRLSEAHAK+     V   DV  A R+
Sbjct:  167 KEKFQRFVQRFIDPLAKEEENVGLDLNEPIYMQRLEEINVVGEPFLNVDCDHLRSFDQDLYRQLVCYPQEVIPTFDMAANEIFFERYPD-SILEHQIQVRPYNALKTRNMRSLNPEDIDQLITISGMVIRTSQIIPEMQEAFFKCQVCAFTTR--VEIDRGRISEPSVCKHCNTTHSMALIHNRSMFSDKQMIKLQESPEDMPAGQTPHTTILYGHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVRNVKS---VYKTHIDVIHYRKTDAKR-LHGI-DEDTEQKMFTEERVAMLKELAAKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKFRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDETYDRRLAHHLVALYYQSEEQMKEEH-------LD--------------------MAVLKDYIAYARTYVNPRLGEEASQALIEAYVDMRKIGSGRGMVSAYPRQLESLIRLSEAHAKVRFSSKVETIDVEEAKRL 768          
BLAST of DNA helicase vs. Ensembl Mouse
Match: Mcm2 (minichromosome maintenance complex component 2 [Source:MGI Symbol;Acc:MGI:105380])

HSP 1 Score: 932.169 bits (2408), Expect = 0.000e+0
Identity = 471/846 (55.67%), Postives = 619/846 (73.17%), Query Frame = 1
Query:  202 INDNMERDYRHIPELDTYETAGID-DDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            I D MERDYR IPELD YE  G+  DD D+ EL+ S+R   E  + +RDR    A   L R    +  D S E E    R R+  + A  D  GE  E +  E+IENLED +G +V +W+     + EI +RF +FLRT ++  G +V+ ERI+ M  EN  SL++NYE L A +  LAYFLPEAP  +L IFD+ A E+ L+ Y +Y +I + IHVRISHLPLV+++RSLRQ+H++QLIRTSGVV+SCT V+PQL++V+YNC +C+  +GPF Q + N E+KP +CP+CQS+GPFEIN E+T+Y+NYQRI IQESPG V AGRLPRSKDAILL DLVD CKPGDEI++TG Y   YD +LN    FPVF+T IL N+V KKD ++ +  LTDED + I  L+KD+++ E+I  SIAPSIYGHE+IKR +AL+LFGG PK  G  +++RGDINVLLCGDPGT KSQFLK++E+++ R +FTTGQGASAVGLTAYV ++  ++EWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR T+IAAANPIGGRYD +  FS+NVDLT PI+SRFD+LCVVRD VDP+QD MLA+FV+GSH+RHH    + +K E +      G  +  A      ++P+P ++L+KYIIYAK+ + P LN+ +++K++ +Y  LRK S   G I +TVR+ ESMIR++EAHA++HLR  V EDDVNMAIRV++ESFI T+K+S+M+ +   F +YL++++++ +LLLF LKQ+  +++T  R          IEI EK   DKA+++NI ++  F +S L + N F  D  ++ IL Q
Sbjct:   73 IGDGMERDYRPIPELDVYEAEGLALDDEDVEELTASQREAAERTMRQRDRE---AGRGLGRMRRGLLYDSSEEDEERPARKRRHVERATED--GEEDE-EMIESIENLEDLKGHSVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCSKCNFVLGPFCQSQ-NQEVKPGSCPECQSAGPFEINMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATIILANHVAKKDNKVAVGELTDEDVKMITGLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDVLCVVRDTVDPVQDEMLARFVVGSHVRHH---PSNKKDEGLTN----GGTLEPAMPNTYGVEPLPQEVLKKYIIYAKERVRPKLNQMDQDKVARMYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVMEDDVNMAIRVMMESFIDTQKFSVMRSMRKTFARYLSFRRDNNDLLLFILKQLVAEQVTYQR-NRFGAQQDTIEIPEKDLMDKARQINIHNLSAFYDSDLFKFNKFSRDLKRKLILQQ 903          
BLAST of DNA helicase vs. Ensembl Mouse
Match: Mcm4 (minichromosome maintenance complex component 4 [Source:MGI Symbol;Acc:MGI:103199])

HSP 1 Score: 342.428 bits (877), Expect = 2.512e-103
Identity = 214/640 (33.44%), Postives = 342/640 (53.44%), Query Frame = 1
Query:  586 KNRFFSFLRTFLN-----------DEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTY---CIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILN---------LAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK----TKGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESF 2424
            K  F  FL+ F +           D  + +Y +++  + +     L +N EH+ +  + L   L   P+ ++  FD   NEI   RY     +   I VR  +      +R+L    + QLI  SG+V   + ++P++    + C  C+ T    ++ +     +P +C  C ++    +   ++ + + Q I +QESP  +PAG+ P +      +DLVD  +PGD ++VTG Y    I  +  ++N +   V+ THI V +  K D +  L GL +E  + + +         L++   ++ER+  ++APSIY HE+IK+ I L LFGG  K    T   + R +IN+LLCGDPGT KSQ L++V  L PR  +T+G+G+SAVGLTAYV K+  T++  L+ GALVL+D G+C IDEFDKMN+  R+ +HE MEQQ++SI+KAGI+  L AR++++AAANPI  +++  +   +N+ L   +LSRFD++ ++ D  D   D  LA  ++  + +      +EE+ E  + LD                    + +L+ YI YA  TI P L+++    L E Y+++RK     G +    R  ES+IRL+EAHAK+     V   DV  A R+  E+ 
Sbjct:  162 KENFQRFLQCFTDPLAKEEENVGIDITQPLYMQQLGEINITGEPFLNVNCEHIKSFSKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPD-SILEHQIQVRPFNALKTKSMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTR--VEIDRGRIAEPCSCVHCHTTHSMALIHNRSFFSDKQMIKLQESPEDMPAGQTPHTIVLFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKS--VYKTHIDVIHYRKTDAKR-LHGLDEEAEQKLFSEKRVKLLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQ------SEEQVEE-EFLD--------------------MAVLKDYIAYAHSTIMPRLSEEASQALIEAYVNMRKIGSSRGMVSAYPRQLESLIRLAEAHAKVRFSNKVEAIDVEEAKRLHREAL 768          
BLAST of DNA helicase vs. Ensembl Mouse
Match: Mcm6 (minichromosome maintenance complex component 6 [Source:MGI Symbol;Acc:MGI:1298227])

HSP 1 Score: 327.791 bits (839), Expect = 1.553e-98
Identity = 214/689 (31.06%), Postives = 351/689 (50.94%), Query Frame = 1
Query:  559 QQPSTKQEIKNR----FFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGM-------LDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTC--PDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYD---------RALNNKQ-------------------------------CFPVFSTHILVNYVLKKDEQL---ILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGID-----VTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTE 2436
            Q P  + E+  +    F  FL  F   +G+  Y +    +      +L++++  L    Q L+  + E    +       L  F K   EI  ++           +V    LP   +IR L    +  L R SG V     V P+L    + C+ C   I    Q       +P+ C  P C +   F +++ K+ + ++Q++ IQE+   +P G +PRS + IL  + V+  + GD  D TG   +  D         RA  N +                               C    +        L+ +EQ    I + +T ++   +  +++D+ L+  +  S+ P+I+G++ +KR + L LFGGVPKT  +G  LRGDINV + GDP T KSQFLK V++ +PR V+T+G+ +SA GLTA V ++  + E+ +EAGAL+LAD GVC IDEFDKM+ +D+ +IHEAMEQQ+ISI+KAG+ A+L AR++I+AAANP+ G YD +++   N++L++PI+SRFD+  ++ D  + + D  +A+ ++  H R            + + +D++ +                LD +R+Y+++A+Q   P ++K++E+ + E Y  LR+  ++  G+      +TVR  ESMIRLSE+ A++H    V    V  A R+L +S I  E
Sbjct:   14 QHPEVRDEVAEKCQKLFLDFLEEFQGSDGEIKYLQFAEELIRPERNTLVVSFADLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPFAK---------DFYVAFQDLPTRHKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIKDVEQ--QFKYTQPNICRNPVCANRKRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDRCDFTGALIVVPDVSKLSTPGARAETNSRVSGADGYETEGIRGLRALGVRDLSYRLVFLACHVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVDEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDMRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVSGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSR------------IEESIDRVYS----------------LDDIRRYLLFARQ-FKPKISKESEDFIVEQYKRLRQ--RDGSGVTKSSWRITVRQLESMIRLSESMARMHCCDEVQPKHVKEAFRLLNKSIIRVE 660          
BLAST of DNA helicase vs. Ensembl Mouse
Match: Mcm6 (minichromosome maintenance complex component 6 [Source:MGI Symbol;Acc:MGI:1298227])

HSP 1 Score: 327.791 bits (839), Expect = 3.101e-98
Identity = 214/689 (31.06%), Postives = 351/689 (50.94%), Query Frame = 1
Query:  559 QQPSTKQEIKNR----FFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGM-------LDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTC--PDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYD---------RALNNKQ-------------------------------CFPVFSTHILVNYVLKKDEQL---ILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGID-----VTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTE 2436
            Q P  + E+  +    F  FL  F   +G+  Y +    +      +L++++  L    Q L+  + E    +       L  F K   EI  ++           +V    LP   +IR L    +  L R SG V     V P+L    + C+ C   I    Q       +P+ C  P C +   F +++ K+ + ++Q++ IQE+   +P G +PRS + IL  + V+  + GD  D TG   +  D         RA  N +                               C    +        L+ +EQ    I + +T ++   +  +++D+ L+  +  S+ P+I+G++ +KR + L LFGGVPKT  +G  LRGDINV + GDP T KSQFLK V++ +PR V+T+G+ +SA GLTA V ++  + E+ +EAGAL+LAD GVC IDEFDKM+ +D+ +IHEAMEQQ+ISI+KAG+ A+L AR++I+AAANP+ G YD +++   N++L++PI+SRFD+  ++ D  + + D  +A+ ++  H R            + + +D++ +                LD +R+Y+++A+Q   P ++K++E+ + E Y  LR+  ++  G+      +TVR  ESMIRLSE+ A++H    V    V  A R+L +S I  E
Sbjct:   14 QHPEVRDEVAEKCQKLFLDFLEEFQGSDGEIKYLQFAEELIRPERNTLVVSFADLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPFAK---------DFYVAFQDLPTRHKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIKDVEQ--QFKYTQPNICRNPVCANRKRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDRCDFTGALIVVPDVSKLSTPGARAETNSRVSGADGYETEGIRGLRALGVRDLSYRLVFLACHVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVDEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDMRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVSGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSR------------IEESIDRVYS----------------LDDIRRYLLFARQ-FKPKISKESEDFIVEQYKRLRQ--RDGSGVTKSSWRITVRQLESMIRLSESMARMHCCDEVQPKHVKEAFRLLNKSIIRVE 660          
BLAST of DNA helicase vs. Ensembl Mouse
Match: Mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:MGI Symbol;Acc:MGI:1913884])

HSP 1 Score: 306.22 bits (783), Expect = 1.646e-90
Identity = 200/567 (35.27%), Postives = 301/567 (53.09%), Query Frame = 1
Query:  841 IHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCP--DCQ--SSGPFEINSEKTLYKNYQRITIQE--SPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIF-YDRALNNKQCFPVFSTHILVNYVLKKD-----------EQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKGNR----LRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDK--------------LGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFIST 2433
            I+ R+ +   +  ++++R     + I   G V   +N+ P    + + C  C   I  F   +    + P+ CP   C+  S  P   +S  T+  ++Q I IQE  S     AGR+PR+ +  L+ DLVD C PGD + VTG   +   +    NK    +F  +I  N V               +   L   + +D   I  +  +E L + +V S+ P I+GHE +K  + L+LFGG  K   ++    +RGD +VL+ GDPG GKSQ L+    +APR V+  G   ++ GLT  ++K+ ++ ++ LEAGALVL D+G+C IDEFDKM +Q + ++ EAMEQQSIS++KAG+V SL AR++IIAAANP+GG Y+  R  S+N+ + S +LSRFD++ ++ D  +   D +L++ VI       GK  A   + V + L +              L   +  A  E     PIP  LLRKYI YA+Q + P L+ D    L + YL LRK SQ  G   +T R  ES+IRL+EA A+L LR+    +D    I ++  S + T
Sbjct:  159 IYARVYNYEPLTHLKNIRATCYGKYISIRGTVVRVSNIKPLCTNMAFQCAACG-EIQSFPLPDGKYTL-PTKCPVPACRGRSFAPLR-SSPLTVTLDWQLIKIQELMSDAQREAGRIPRTIECELVHDLVDSCVPGDTVTVTGIVKVSNSEEGSRNKNDKCMFLLYIEANSVSNSKGPKAQTAEDGCKHGTLMEFSLKDLYAIREIQAEENLLKLVVNSLCPVIFGHELVKAGLTLALFGGSQKYADDKNRIPIRGDPHVLIVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTSSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKMGNQHQ-ALLEAMEQQSISLAKAGVVCSLPARTSIIAAANPVGGHYNKARTVSENLKMGSALLSRFDLVFILLDTPNEQHDHLLSEHVIAIRA---GKQKAVSSATVTRVLSQDSNTSVLEVVSEKPLSERLKVAPGE--QTDPIPHQLLRKYIGYARQYVHPRLSTDAAQALQDFYLELRKQSQRVGSSPITTRQLESLIRLTEARARLELREEATREDAEDIIEIMKHSMLGT 716          
BLAST of DNA helicase vs. UniProt/SwissProt
Match: sp|P55861|MCM2_XENLA (DNA replication licensing factor mcm2 OS=Xenopus laevis OX=8355 GN=mcm2 PE=1 SV=2)

HSP 1 Score: 944.495 bits (2440), Expect = 0.000e+0
Identity = 472/845 (55.86%), Postives = 620/845 (73.37%), Query Frame = 1
Query:  202 INDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            I D MERDYR I ELD YE  G+DD+ D+ +L+ S+R   E+ +  RDR      G +RRG+  +++ +  E +   R+ R A++ A  +   E  E +  E+IENLED +G TV +W+   +T+ EI +RF +FLRT +++ G +V+ E+I+ M  EN  SL +NYE L A +  LAYFLPEAP  ML IFD+ A E+ L  Y +Y +I   IHVRISHLPLV+++RSLRQ+H++QLIRTSGVV+ CT V+PQL++V+YNC +C+  +GPF Q + N E++P +CP+CQS GPFEIN E+T+Y+NYQRITIQESPG V AGRLPRSKDAILL DLVD CKPGDEI++TG Y   YD +LN    FPVF+T IL N++ KKD+++ +  LTDED + I+ L+KDER+ ERI  SIAPSIYGHE+IKR +AL+LFGG  K  G  +++RGDINVLLCGDPGT KSQFLK+VE++A R VFTTGQGASAVGLTAYV ++  TKEWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR T+IAA+NPIGGRYD +  FS+NVDLT PI+SRFDILCVVRD VDP+QD MLA+FV+ SH++HH         ++        A+ NT   EA     +P ++L+KYI+YAK+ I P LN+ +++K++++Y  LRK S   G I +TVR+ ESMIR++EAHA++HLR  V EDDVNMAIRV+LESFI T+K+S+M+ +   F +YL +++++ ELLLF LKQ+  +++T  R          IE+ EK   DKA+++NI ++  F +S L + N F  D  K+ I+ Q
Sbjct:   58 IGDAMERDYRPISELDRYEVEGLDDEEDVEDLTASQREAAEQSMRMRDREMGRELGRMRRGL--LYDSDEEEEDRPARKRRMAERAA--EGAPEEDE-EMIESIENLEDMKGHTVREWVSMAATRLEIYHRFKNFLRTHVDEHGHNVFKEKISDMCKENKESLPVNYEDLAAREHVLAYFLPEAPAEMLKIFDEAAKEVVLVMYPKYDRIAREIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTCCTGVLPQLSMVKYNCNKCNFILGPFFQSQ-NQEVRPGSCPECQSFGPFEINMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHITKKDDKVAVGELTDEDVKAIVALSKDERIGERIFASIAPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAASNPIGGRYDPSLTFSENVDLTEPIVSRFDILCVVRDTVDPVQDEMLARFVVSSHIKHH-----PSSKDIANGDAAEFALPNTFGVEA-----LPQEVLKKYIMYAKEKIRPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVVEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLAFRRDNNELLLFVLKQLIAEQVTYQR-NRYGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSDLFKMNKFTHDVKKKLIIQQ 885          
BLAST of DNA helicase vs. UniProt/SwissProt
Match: sp|P49736|MCM2_HUMAN (DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4)

HSP 1 Score: 940.258 bits (2429), Expect = 0.000e+0
Identity = 474/846 (56.03%), Postives = 623/846 (73.64%), Query Frame = 1
Query:  202 INDNMERDYRHIPELDTYETAGID-DDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            I D MERDYR IPELD YE  G+  DD D+ EL+ S+R   E  + +RDR EA       R       DE  E E   R+ R+ ++ A  D  GE  E +  E+IENLED +G +V +W+     + EI +RF +FLRT ++  G +V+ ERI+ M  EN  SL++NYE L A +  LAYFLPEAP  +L IFD+ A E+ L+ Y +Y +I + IHVRISHLPLV+++RSLRQ+H++QLIRTSGVV+SCT V+PQL++V+YNC +C+  +GPF Q + N E+KP +CP+CQS+GPFE+N E+T+Y+NYQRI IQESPG V AGRLPRSKDAILL DLVD CKPGDEI++TG Y   YD +LN    FPVF+T IL N+V KKD ++ +  LTDED + I +L+KD+++ E+I  SIAPSIYGHE+IKR +AL+LFGG PK  G  +++RGDINVLLCGDPGT KSQFLK++E+++ R +FTTGQGASAVGLTAYV ++  ++EWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR T+IAAANPIGGRYD +  FS+NVDLT PI+SRFDILCVVRD VDP+QD MLA+FV+GSH+RHH   + +E+  +        AM NT       ++P+P ++L+KYIIYAK+ + P LN+ +++K++++Y  LRK S   G I +TVR+ ESMIR++EAHA++HLR  V EDDVNMAIRV+LESFI T+K+S+M+ +   F +YL++++++ ELLLF LKQ+  +++T  R          IE+ EK   DKA+++NI ++  F +S L R N F  D  ++ IL Q
Sbjct:   73 IGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQRDR-EAGRGLGRMRRGLLYDSDEEDE-ERPARKRRQVER-ATED--GEEDE-EMIESIENLEDLKGHSVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQ-NQEVKPGSCPECQSAGPFEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHP--SNKEEEGLANGSAAEPAMPNTY-----GVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQR-NRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQ 903          
BLAST of DNA helicase vs. UniProt/SwissProt
Match: sp|Q6DIH3|MCM2_XENTR (DNA replication licensing factor mcm2 OS=Xenopus tropicalis OX=8364 GN=mcm2 PE=2 SV=1)

HSP 1 Score: 936.791 bits (2420), Expect = 0.000e+0
Identity = 473/845 (55.98%), Postives = 626/845 (74.08%), Query Frame = 1
Query:  202 INDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            I D MERDYR I ELD YE  G+DD+ D+ +L+ S+R   E+ +  RDR      G +RRG+  +++ +  + +   R+ R A++ A  +   E  E +  E+IENLED +G TV +W+   +T+ EI +RF +FLRT +++ G +V+ E+I+ M  EN  SL++NYE L A +  LAYFLPEAP  ML IFD+ A E+ L  Y +Y +I   IHVRISHLPLV+++RSLRQ+H++QLIRTSGVV+ CT V+PQL++V+YNC +C+  +GPF Q + N E+KP +CP+CQS GPFEIN E+T+Y+NYQRITIQESPG V AGRLPRSKDAILL DLVD CKPGDEI++TGTY   YD +LN    FPVF+T IL N++ KKD+++ +  LTDED + I+ L+KDER+ ERI  SIAPSIYGHE+IKR +AL+LFGG  K  G  +++RGDINVLLCGDPGT KSQFLK+VE++A R VFTTGQGASAVGLTAYV ++  TKEWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR TIIAA+NPIGGRYD +  FS+NVDLT PI+SRFDILCVVRD VDP+QD MLA+FV+GSH++HH        S+ +   ++  A+ NT       ++P+P ++L+KYI+Y+K+ I P LN+ +++K++++Y  LRK S   G I +TVR+ ESMIR++EAHA++HLR  V EDDVNMAIRV+LESFI T+K+S+M+ +   F +YL +++++ ELLLF LKQ+  ++ +  R          IE+ EK   DKA+++NI ++  F +S L + N F  D  K+ I+ Q
Sbjct:   58 IGDAMERDYRAISELDRYEAEGLDDEDDVEDLTASQRDAAEQAMRMRDREMGHELGRMRRGL--LYDSDEEDEDRPARKRRMAERAA--EGAPEEDE-EMIESIENLEDMKGHTVREWVSMAATRLEIYHRFKNFLRTHVDEHGHNVFKEKISDMCKENKESLVVNYEDLAAREHVLAYFLPEAPAEMLKIFDEAAKEVVLVMYPKYDRIAREIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTCCTGVLPQLSMVKYNCNKCNFILGPFFQSQ-NQEVKPGSCPECQSLGPFEINMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGTYHNNYDGSLNTANGFPVFATVILANHITKKDDKVAVGELTDEDVKAIVALSKDERIGERIFASIAPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTIIAASNPIGGRYDPSLTFSENVDLTEPIVSRFDILCVVRDTVDPVQDEMLARFVVGSHIKHH------PSSKDIANGEEF-ALPNTF-----GVEPLPQEVLKKYIMYSKEKIHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVVEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLAFRRDNNELLLFVLKQLVAEQTSYQR-NRYGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSDLFKMNRFTHDVKKKMIIQQ 883          
BLAST of DNA helicase vs. UniProt/SwissProt
Match: sp|P97310|MCM2_MOUSE (DNA replication licensing factor MCM2 OS=Mus musculus OX=10090 GN=Mcm2 PE=1 SV=3)

HSP 1 Score: 932.169 bits (2408), Expect = 0.000e+0
Identity = 471/846 (55.67%), Postives = 619/846 (73.17%), Query Frame = 1
Query:  202 INDNMERDYRHIPELDTYETAGID-DDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            I D MERDYR IPELD YE  G+  DD D+ EL+ S+R   E  + +RDR    A   L R    +  D S E E    R R+  + A  D  GE  E +  E+IENLED +G +V +W+     + EI +RF +FLRT ++  G +V+ ERI+ M  EN  SL++NYE L A +  LAYFLPEAP  +L IFD+ A E+ L+ Y +Y +I + IHVRISHLPLV+++RSLRQ+H++QLIRTSGVV+SCT V+PQL++V+YNC +C+  +GPF Q + N E+KP +CP+CQS+GPFEIN E+T+Y+NYQRI IQESPG V AGRLPRSKDAILL DLVD CKPGDEI++TG Y   YD +LN    FPVF+T IL N+V KKD ++ +  LTDED + I  L+KD+++ E+I  SIAPSIYGHE+IKR +AL+LFGG PK  G  +++RGDINVLLCGDPGT KSQFLK++E+++ R +FTTGQGASAVGLTAYV ++  ++EWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR T+IAAANPIGGRYD +  FS+NVDLT PI+SRFD+LCVVRD VDP+QD MLA+FV+GSH+RHH    + +K E +      G  +  A      ++P+P ++L+KYIIYAK+ + P LN+ +++K++ +Y  LRK S   G I +TVR+ ESMIR++EAHA++HLR  V EDDVNMAIRV++ESFI T+K+S+M+ +   F +YL++++++ +LLLF LKQ+  +++T  R          IEI EK   DKA+++NI ++  F +S L + N F  D  ++ IL Q
Sbjct:   73 IGDGMERDYRPIPELDVYEAEGLALDDEDVEELTASQREAAERTMRQRDRE---AGRGLGRMRRGLLYDSSEEDEERPARKRRHVERATED--GEEDE-EMIESIENLEDLKGHSVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCSKCNFVLGPFCQSQ-NQEVKPGSCPECQSAGPFEINMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATIILANHVAKKDNKVAVGELTDEDVKMITGLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDVLCVVRDTVDPVQDEMLARFVVGSHVRHH---PSNKKDEGLTN----GGTLEPAMPNTYGVEPLPQEVLKKYIIYAKERVRPKLNQMDQDKVARMYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVMEDDVNMAIRVMMESFIDTQKFSVMRSMRKTFARYLSFRRDNNDLLLFILKQLVAEQVTYQR-NRFGAQQDTIEIPEKDLMDKARQINIHNLSAFYDSDLFKFNKFSRDLKRKLILQQ 903          
BLAST of DNA helicase vs. UniProt/SwissProt
Match: sp|P49735|MCM2_DROME (DNA replication licensing factor Mcm2 OS=Drosophila melanogaster OX=7227 GN=Mcm2 PE=1 SV=1)

HSP 1 Score: 907.131 bits (2343), Expect = 0.000e+0
Identity = 456/870 (52.41%), Postives = 618/870 (71.03%), Query Frame = 1
Query:  124 PFEDETXXXXXXXXXXXXXXXXXXXXINDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILH 2727
            PFE+E E+L      +  EE +GEEL  DNME DYR +PELD Y+ A +DD+ D  E+SQ +R   E E+ +RDR   I   +   G    F     E +   R  R+A + AA   VGE  +++  E+IENLEDT+G +  +W+     + EI NRF SFLRTF+++ G   Y +RI  M  +N  S +++Y  L   +  LAYFLPEAP  ML+IFDKVA ++ LS +  Y+++   IHVRIS LPL++++R+ R++H++QL+RT GVV++ T V+PQL+V++Y+C++C   +GPF+Q + N EIKP +CP+CQS+GPF IN E+TLY+NYQ+IT+QESPG +PAGR+PRSKD ILL DL D CKPGDE++VTG Y   YD +LN  Q FPVF+T I+ N+V+ KD + ++  LTDED   I  L+KD R+ ER+V S+APSIYGH+ IKRA+AL+LFGG  K  G  +++RGDIN+L+CGDPGT KSQFLK+ E++APR VFTTGQGASAVGLTAYV +N  ++EWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR T+IAAANPIGGRYD +  FS+NV+L+ PILSRFD+LCVV+D  DP+QD  LAKFV+ SHM+HH                         + +  T+  IP DLLR+YI+YAK+ I P L   +E+K++++Y  LR+ S   G + +TVR+ ES+IR+SEAHA++HLR+ V E DV+MAIR++LESFI  +K+S+MK + + F++YL+++K+  ELL F L+Q+  D+L  +R        + +EI E+   ++AK+++I ++K F  S L RTN F +D  +R IL 
Sbjct:   34 PFENEDEILGDQTVRDEAEEEDGEELFGDNMENDYRPMPELDHYDPALLDDEDDFSEMSQGDRFAAESEMRRRDRAAGIHRDDRDLG----FGQSDDEDDVGPRAKRRAGEKAA---VGEVEDTEMVESIENLEDTKGHSTKEWVSMLGPRTEIANRFQSFLRTFVDERGAYTYRDRIRRMCEQNMSSFVVSYTDLANKEHVLAYFLPEAPFQMLEIFDKVAKDMVLSIFPTYERVTTEIHVRISELPLIEELRTFRKLHLNQLVRTLGVVTATTGVLPQLSVIKYDCVKCGYVLGPFVQSQ-NTEIKPGSCPECQSTGPFSINMEQTLYRNYQKITLQESPGRIPAGRIPRSKDVILLADLCDQCKPGDELEVTGIYTNNYDGSLNTDQGFPVFATVIIANHVVVKDSKQVVQSLTDEDIATIQKLSKDPRIVERVVASMAPSIYGHDYIKRALALALFGGESKNPGEKHKVRGDINLLICGDPGTAKSQFLKYTEKVAPRAVFTTGQGASAVGLTAYVRRNPVSREWTLEAGALVLADQGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSMTFSENVNLSEPILSRFDVLCVVKDEFDPMQDQQLAKFVVHSHMKHHPSEE---------------EQPELEEPQLKTVDEIPQDLLRQYIVYAKENIRPKLTNIDEDKIAKMYAQLRQESFATGSLPITVRHIESVIRMSEAHARMHLRENVMEADVSMAIRMMLESFIEAQKFSVMKKMRSTFQKYLSFQKDHSELLFFILRQLTLDQLAYIRCKD-GPGATHVEIMERDLIERAKQLDIVNLKPFYESDLFRTNGFSYDPKRRIILQ 879          
BLAST of DNA helicase vs. TrEMBL
Match: Q9BI22 (DNA helicase (Fragment) OS=Dugesia japonica OX=6161 GN=mcm2 PE=2 SV=1)

HSP 1 Score: 1341.64 bits (3471), Expect = 0.000e+0
Identity = 676/873 (77.43%), Postives = 763/873 (87.40%), Query Frame = 1
Query:   49 ENLIKMTSQNNRNRLVSIEASDDEIPFEDETXXXXXXXXXXXXXXXXXXXXINDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRG-MHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQ-SYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKGNRLRG--DINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVK 2655
            +N  K    NN  R  S+  +DD  PFEDETE LLGAE  + E E E    IND+MERDYR IPELD+YE AGIDD++D+ E+SQ+ER  VE+EL++RDRLEA+ASG+LRRG + DIFEDESS+AEAS+RR R ADKIA+YDS GE   SQ +YE +ENLEDT+GM+VA WIQQP+TK EI+NRFFSFLRTFLNDEGK+VY+ERI  MA  N +SL INYEHLVA +QALAYFLPEAP+GML+IFD+VA  +TLSRY  Y+ I +SIHVRISHLPLVD+IRSLRQVH++QLIRT  +        PQLN+VQ+NC+RC CTIGPF Q +S +EIKPSTCPDCQS+GPFEIN EKTLYKNYQRIT QESPGTVPAGRLPRSKDAILLDDLVD CKPGDEID+TG Y I+YDRALNNKQCFPVFST+ILVNYVLK DE LILSG+TDED  NI NLAKDERLF+RI+ SIAPSIYGHENIKRAIALSLFGGV KTKG +LRG  DINVL+CGDPGT KSQFLKFVEQLAPRCVFTTGQGASAVGLTAYV++N T+KEWTLEAGALVLADKGVCLIDEFDKMN QDRTSIHEAMEQQ+ISISKAGIV SLQARSTIIAAANPI GRYDT+RNFSDNVDLTSPILSRFDILCVVRD+VDPIQD MLAK+VIGSHMRHHG+L+ EEK EVVK+L+ LGAMVNT+DSEAG LQ IPL+LL+KYIIYA+Q + P L+K NE KL EVY+ LRKAS+ENGGIDVTVRYFESMIRLSEAHAKLH R+ VNE+DVNMAIRVLLESFISTEKYSLMK+LENKFR YLNYKKND+EL++FTLKQMFHD+LT +RA GKS++NSIIEI+EKS  DK +RMNI ++K
Sbjct:    2 KNNFKKDMSNNLER--SLSEADDS-PFEDETEQLLGAEYQDEESEEEEL--INDSMERDYRRIPELDSYEAAGIDDESDVDEISQNERNVVEQELDRRDRLEAVASGDLRRGVIPDIFEDESSDAEASFRRQRMADKIASYDSAGETLGSQQTYEAVENLEDTKGMSVAMWIQQPATKLEIRNRFFSFLRTFLNDEGKAVYSERIGTMAQANKKSLTINYEHLVAVEQALAYFLPEAPQGMLEIFDEVAFAVTLSRYPNYKTITESIHVRISHLPLVDEIRSLRQVHINQLIRTPELCQVVLLFCPQLNLVQFNCMRCGCTIGPFTQTDSTNEIKPSTCPDCQSNGPFEINVEKTLYKNYQRITGQESPGTVPAGRLPRSKDAILLDDLVDSCKPGDEIDITGIYFIYYDRALNNKQCFPVFSTNILVNYVLKTDEHLILSGVTDEDIVNIQNLAKDERLFDRILRSIAPSIYGHENIKRAIALSLFGGVAKTKGQKLRGRGDINVLICGDPGTAKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVSRNPTSKEWTLEAGALVLADKGVCLIDEFDKMNGQDRTSIHEAMEQQTISISKAGIVTSLQARSTIIAAANPIAGRYDTSRNFSDNVDLTSPILSRFDILCVVRDIVDPIQDSMLAKYVIGSHMRHHGRLSEEEKKEVVKRLEALGAMVNTSDSEAGDLQAIPLELLQKYIIYARQRVSPRLSKTNEGKLCEVYVELRKASKENGGIDVTVRYFESMIRLSEAHAKLHFREVVNEEDVNMAIRVLLESFISTEKYSLMKNLENKFRHYLNYKKNDHELIMFTLKQMFHDQLTTLRAEGKSLNNSIIEITEKSLLDKVRRMNIMTIK 869          
BLAST of DNA helicase vs. TrEMBL
Match: A0A0X3NPY1 (DNA helicase OS=Schistocephalus solidus OX=70667 GN=MCM2 PE=3 SV=1)

HSP 1 Score: 1073.15 bits (2774), Expect = 0.000e+0
Identity = 518/879 (58.93%), Postives = 688/879 (78.27%), Query Frame = 1
Query:  103 EASDDEI-PFEDETXXXXXXXXXXXXXXXXXXXXINDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGM-HDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILH 2727
            E SD E  PFEDE+  LLG + +  EE    +    D+MERDYR IPELD YE  G+ DD D+  LS + R   E ++ +RDR E +A+G LRR +  D++ +E  E     RR R A+++AA      +  +++ E+IENLED +GM+V +W+QQP+T+QEIKNRF  FLRTFLN+   +VYAERI  MA EN +SL ++Y+H+ AA+Q LAYFLPEAP  ML+IF++ A E+TL+RY RY +I+  ++VRI  LPL++ +RSLR +H++QL+RT GVV+S T+VMPQL++V+YNC++CSC +GPF+Q +++ E+KPSTCPDCQS GPFEIN E+T+YKNYQRITIQESPG VPAGRLPRSKDAILLDDLVD CKPGDE+++TG Y   Y  +LN++  FPVFST I  N +++K+++++L GLTDED R I+ L++DER+ +RI  SIAPSIYGHE+IKRAIAL+LFGG PK  G  +++RGDINVLLCGDPGT KSQFLK++EQ+APRCVFTTGQGASAVGLTAYVT+N  +KEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR ++IAAANPIGGRYD +  FSDNVDL+ PILSRFDILCVVRD VDP+QD MLA+FV+GSHMRHH  LT EE++++ ++L  LGA   ++D+ A   QP+  +LL+KYI+YAK  I P LN+ +++K+++ Y  LR+ S   G I +TVR+ ES++R++EAHA++HLR+ VNEDDVN+A+R +LESF+ST+KY +MK +  KF ++L+Y++++ EL+LF LKQ+ H++    R+      +  IEI E+   +KAK++NI+SV+ FL+S L   ++F +DAG++ I++
Sbjct:   15 EESDSEAQPFEDESAALLGDDSEVQEETEGEDL-FRDDMERDYRPIPELDVYEQEGLADDADVSSLSPTARAEAERQMRQRDRAELLATGGLRRDIVADLYGEEEEEEIVPARRRRLAERVAAGTDAELSDYTEALESIENLEDMKGMSVNEWVQQPATRQEIKNRFKVFLRTFLNENDVNVYAERIVQMARENRQSLCVDYQHIAAAEQVLAYFLPEAPFHMLEIFNEAALEVTLARYPRYDRISSHVNVRIVDLPLIEDLRSLRHLHLNQLVRTCGVVTSATSVMPQLSLVKYNCVKCSCILGPFVQNQTS-EVKPSTCPDCQSGGPFEINVEQTVYKNYQRITIQESPGKVPAGRLPRSKDAILLDDLVDSCKPGDEVELTGIYTNSYSNSLNSQTGFPVFSTIIHANNIVRKEDKMVLGGLTDEDVRTIVKLSRDERISDRIFASIAPSIYGHEDIKRAIALTLFGGEPKNPGEKHKIRGDINVLLCGDPGTAKSQFLKYIEQVAPRCVFTTGQGASAVGLTAYVTRNPVSKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCSVIAAANPIGGRYDPSMTFSDNVDLSEPILSRFDILCVVRDTVDPVQDEMLARFVVGSHMRHHPNLTGEERTQLTEQLAGLGATTASSDASAAECQPLSQELLKKYILYAKDRIHPKLNQMDQDKVAKAYADLRRESMATGSIPITVRHIESVVRMAEAHARMHLREYVNEDDVNVALRTVLESFVSTQKYGVMKSMRQKFSRFLSYRRDNQELILFLLKQLVHERTAFERSRHIDDESWQIEIPEQDLANKAKQVNISSVRAFLSSELFTAHHFTYDAGRKMIIY 891          
BLAST of DNA helicase vs. TrEMBL
Match: A0A183T5Q6 (DNA helicase OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS11804 PE=3 SV=1)

HSP 1 Score: 1063.91 bits (2750), Expect = 0.000e+0
Identity = 518/892 (58.07%), Postives = 688/892 (77.13%), Query Frame = 1
Query:  103 EASDDEI-PFEDETXXXXXXXXXXXXXXXXXXXXINDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGM-HDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDK-------------MNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILH 2727
            E SD E  PFEDE+  LLG + +  EE    +    D+MERDYR IPELD YE  G+ DD D+  LS + R   E ++ +RDR E +A+G LRR +  D++ +E  E     RR R A+++AA      +  +++ E+IENLED +GM+V +W+QQP+T+QEIKNRF  FLRTFLN+   +VYAERI  MA EN +SL ++Y+H+ AA+Q LAYFLPEAP  ML+IF++ A E+TL+RY RY +I+  ++VRI  LPL++ +RSLR +H++QL+RT GVV+S T+VMPQL++V+YNC++CSC +GPF+Q +++ E+KPSTCPDCQS GPFEIN E+T+YKNYQRITIQESPG VPAGRLPRSKDAILLDDLVD CKPGDE+++TG Y   Y  +LN++  FPVFST I  N +++K+++++L GLTDED R I+ L++DER+ +RI  SIAPSIYGHE+IKRAIAL+LFGG PK  G  +++RGDINVLLCGDPGT KSQFLK++EQ+APRCVFTTGQGASAVGLTAYVT+N  +KEWTLEAGALVLADKGVCLIDEFDK             MNDQDRTSIHEAMEQQSISISKAGIV SLQAR ++IAAANPIGGRYD +  FSDNVDL+ PILSRFDILCVVRD VDP+QD MLA+FV+GSHMRHH  LT EE++++ ++L  LGA   ++D+ A   QP+  +LL+KYI+YAK  I P LN+ +++K+++ Y  LR+ S   G I +TVR+ ES++R++EAHA++HLR+ VNEDDVN+A+R +LESF+ST+KY +MK +  KF ++L+Y++++ EL+LF LKQ+ H++    R+      +  IEI E+   +KAK++NI+SV+ FL+S L   ++F +DAG++ I++
Sbjct:   15 EESDSEAQPFEDESAALLGDDSEVQEETEGEDL-FRDDMERDYRPIPELDVYEQEGLADDADVSSLSPTARAEAERQMRQRDRAELLATGGLRRDIVADLYGEEEEEEIVPARRRRLAERVAAGTDAELSDYTEALESIENLEDMKGMSVNEWVQQPATRQEIKNRFKVFLRTFLNENDVNVYAERIVQMARENRQSLCVDYQHIAAAEQVLAYFLPEAPFHMLEIFNEAALEVTLARYPRYDRISSHVNVRIVDLPLIEDLRSLRHLHLNQLVRTCGVVTSATSVMPQLSLVKYNCVKCSCILGPFVQNQTS-EVKPSTCPDCQSGGPFEINVEQTVYKNYQRITIQESPGKVPAGRLPRSKDAILLDDLVDSCKPGDEVELTGIYTNSYSNSLNSQTGFPVFSTIIHANNIVRKEDKMVLGGLTDEDVRTIVKLSRDERISDRIFASIAPSIYGHEDIKRAIALTLFGGEPKNPGEKHKIRGDINVLLCGDPGTAKSQFLKYIEQVAPRCVFTTGQGASAVGLTAYVTRNPVSKEWTLEAGALVLADKGVCLIDEFDKDYPISLTSVLTHQMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCSVIAAANPIGGRYDPSMTFSDNVDLSEPILSRFDILCVVRDTVDPVQDEMLARFVVGSHMRHHPNLTGEERTQLTEQLAGLGATTASSDASAAECQPLSQELLKKYILYAKDRIHPKLNQMDQDKVAKAYADLRRESMATGSIPITVRHIESVVRMAEAHARMHLREYVNEDDVNVALRTVLESFVSTQKYGVMKSMRQKFSRFLSYRRDNQELILFLLKQLVHERTAFERSRHIDDESWQIEIPEQDLANKAKQVNISSVRAFLSSELFTAHHFTYDAGRKMIIY 904          
BLAST of DNA helicase vs. TrEMBL
Match: A0A0R3U8Y3 (DNA helicase OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS3369 PE=3 SV=1)

HSP 1 Score: 1062.37 bits (2746), Expect = 0.000e+0
Identity = 522/875 (59.66%), Postives = 680/875 (77.71%), Query Frame = 1
Query:  115 DEIPFEDETXXXXXXXXXXXXXXXXXXXXINDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGM-HDIFEDESSEAEASYRRHRKADKIAA-YDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILH 2727
            D+ PFEDE+  +LG E+ + E E E      D+MERDYR IPELD YE  G+    D   +S + R   E E+ +RDR EA+A+G LRRG+  D++ DE  E E   RR R A+++AA  D  G    +++ E+IENLED  GMT+ +W+QQP+T+QEIKNRF SFLRTFL++ G +VYAERI  MA EN +SL ++Y+HL AA+Q LAYFLPEAP  +L+IF++ A EITL+RY RY +I+  ++VRI  LPL++ +RSLR +H++QL+RT GVV+S T+VMPQL++V+YNC++CSC +GPF+Q +++ E +PSTCPDCQSSGPFEIN E+T+YKNYQRITIQESPG VP GRLPRSKDAILLDDLVD CKPGDEI++TG Y   Y  +LN +  FPVFST I  N +++K+++L+L  LTDED + I+ L++DER+ ERI  SIAPSIYGHE+IKR IAL+LFGG PK  G  +++RGDINVLLCGDPGT KSQFLK+VEQ+APRCVFTTGQGASAVGLTAYVT+N  TKEWTLEAGALVL+DKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR ++IAAANPIGGRYD +  F+DNVDL+ PILSRFD+LCVVRD VD +QD MLA+FV+GSHMRHH  L+ EEK ++V++L  LGA   + D+ +   QP+P +LL+KYI+YAK  + P LN+ +++K+++ Y  LR+ S   G I +TVR+ ES++RLSEAHA++HLR+ VNEDDVN+A+R++LESF+ST+KY +MK +  KF ++L+Y+ ++ ELLLF LKQ+ H++ T  R+         IE+ E    D+A+++NI SV+ FL S L   + F +DAG++ I+H
Sbjct:   21 DDQPFEDESAAILGDEEVQEESEGEDL--FRDDMERDYRPIPELDVYEPEGLASTEDFSSMSPTARAEAEREMRQRDRAEALATGGLRRGLVADLYGDEE-EDEVPLRRRRLAERVAAGLDGEGSGDLAEALESIENLEDMHGMTINEWVQQPATRQEIKNRFKSFLRTFLDESGINVYAERIVQMARENRQSLSVDYQHLAAAEQVLAYFLPEAPFHVLEIFNEGALEITLARYPRYDRISSHVNVRIVDLPLIEDLRSLRHLHLNQLVRTGGVVTSSTSVMPQLSLVKYNCMKCSCVLGPFVQSQTSGEFRPSTCPDCQSSGPFEINVEQTVYKNYQRITIQESPGKVPPGRLPRSKDAILLDDLVDSCKPGDEIELTGIYTNSYSGSLNIQTGFPVFSTVIHANNIIRKEDKLVLGSLTDEDVKTIVKLSRDERISERIFASIAPSIYGHEDIKRGIALALFGGEPKNPGEKHKIRGDINVLLCGDPGTAKSQFLKYVEQIAPRCVFTTGQGASAVGLTAYVTRNPMTKEWTLEAGALVLSDKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCSVIAAANPIGGRYDPSLTFADNVDLSEPILSRFDVLCVVRDTVDSVQDEMLARFVVGSHMRHHPNLSVEEKEQLVEQLSNLGATTASGDANSCDRQPLPQELLKKYIVYAKDRVHPKLNQMDQDKVAKAYADLRRESMATGSIPITVRHIESVVRLSEAHARMHLREYVNEDDVNVALRIVLESFVSTQKYGIMKTMRQKFSRFLSYRLDNQELLLFLLKQLVHERATFERSRHADEQTWQIEVPESELTDRARQVNIPSVRAFLTSELFTAHRFTYDAGRKVIIH 892          
BLAST of DNA helicase vs. TrEMBL
Match: A0A0R3T626 (DNA helicase OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS2513 PE=3 SV=1)

HSP 1 Score: 1048.88 bits (2711), Expect = 0.000e+0
Identity = 527/913 (57.72%), Postives = 693/913 (75.90%), Query Frame = 1
Query:   76 NNRNRLVSIEASDDE-----------IPFEDETXXXXXXXXXXXXXXXXXXXXINDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGM-HDIFEDESSEAEASYRRHRKADKIAAYDSVGENFES--QSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKGN--RLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDK-------------LTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILH 2727
            + RN+    E SDDE            PFEDE+  +LG + D+ +EE EGE+L  D+MERDYR IPELD YE  G+    D   LS + R   E E+ +RDR E +A+G+LRRG+  D++     E E   RR R A+++AA    G + E   +  E+IENLED  GM+V +W+QQP+T+ EIKNRF SFLRTFL+++G +VYA+RI  MA +N +SL ++Y+HL +++Q LAYFLPEAP  ML++F++ A E+TL RY RY++I+D ++VR+  LPL++++RSLR +H++QLIRTSGVV+S T+VMPQL+VV+YNC++CSC +GPF+Q +   E+KP+ C DCQS+GPFEIN EKT+YKNYQRIT+QESPG VP GRLPRSKDAIL+DDLVD CKPGDEI++TG Y   Y  +LN +  FPVFST IL N VL+K+++LILS LTDED + IL L++DER+ +RI  SIAPSI+GHE+IKR IAL+LFGG  K  G+  RLRGDINVLLCGDPGT KSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVT+N  +KEWTLEAGALVL+DKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR TIIAAANPIGGRYD +  F+DNVDL+ PILSRFD+LCVVRD VD +QD ML+KFV+GSHMRHH  ++A+E  E+V+KL  +GA  ++A++  G ++P+  DLL+KYI+YAK  I P LN+ +++K++  Y  LR+ S   G + +TVR  ES +RL+EAHA++HLR+ VN+DDVNMA+R++LESF++T+KY +MK +  KF +YL+Y++++ ELLLF LKQ+ H++               E+        +  +E+SEK F D+A+++NI S++GFL S L   + F +D+ ++ I+H
Sbjct:    5 SRRNQGSREEGSDDEGNIGAGSDIENAPFEDESAAILGDDMDDVQEESEGEDLFRDDMERDYRPIPELDVYEPEGLASSGDYPSLSPTARAEAEREMRERDRAEGLAAGDLRRGIVADLYGLGEEEEEVPTRRRRLAERVAA----GLDLEEPDEVLESIENLEDMHGMSVVEWVQQPATRLEIKNRFKSFLRTFLDEKGTNVYADRIVQMARDNKQSLTLDYQHLASSEQVLAYFLPEAPFQMLEMFNESALEVTLGRYPRYEKISDRVNVRVVDLPLIEELRSLRHIHLNQLIRTSGVVTSATSVMPQLSVVRYNCVKCSCVLGPFVQSQGGSEVKPTLCSDCQSTGPFEINLEKTIYKNYQRITVQESPGKVPPGRLPRSKDAILVDDLVDSCKPGDEIELTGIYTNSYSGSLNVQTGFPVFSTVILANNVLRKEDKLILSSLTDEDVKTILALSRDERVADRIFASIAPSIFGHEDIKRGIALALFGGEFKNPGDKHRLRGDINVLLCGDPGTAKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTRNPMSKEWTLEAGALVLSDKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTIIAAANPIGGRYDPSLTFADNVDLSEPILSRFDVLCVVRDTVDSVQDEMLSKFVVGSHMRHHPNISADESKELVEKLASMGATSSSAEANGGDIEPLSQDLLKKYILYAKDRIHPKLNQMDQDKVARAYADLRRESSSTGSVAITVRQIESTVRLAEAHARMHLREYVNDDDVNMALRIVLESFVATQKYGVMKSMRQKFSRYLSYRRDNQELLLFLLKQLIHERSAFARSRQAALSSTAEIEGESAPTPSLQVEVSEKEFADRARQVNIQSIRGFLTSELFTAHRFSYDSNRKVIVH 913          
BLAST of DNA helicase vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 912.138 bits (2356), Expect = 0.000e+0
Identity = 474/845 (56.09%), Postives = 626/845 (74.08%), Query Frame = 1
Query:  202 INDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            I + ME DYR IPELD YE  G+DD+ DL ELS   R   EE + +RDR + +  G + RG+  +++ E  + E   +R R+  + AA  +  E  + +  E+IENLED +G TV +W+   + + EI +RF +FLRT +++ G +V+ ERI+ M  EN  SL++NYE L + +  LAYFLPEAP  ML IFD+ A E+ L+ Y +Y +I   IHVRI +LPLV+++RSLRQ+H++QLIRTSGVV+SCT V+PQL +V+YNC +CS  +GPF Q + N E+KP +CP+CQS GPFEIN E+T+Y+NYQRITIQESPG V AGRLPRSKDAILL DLVD CKPGDEI++TG Y   YD +LN    FPVF+T IL N++ +KD+++ ++ LTDED + I+ L+KDER+ ERI  SI PSIYGHE+IKR +AL+LFGG  K  G  +++RGDINVL+CGDPGT KSQFLK+VE++A R VFTTGQGASAVGLTAYV ++  T+EWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR T++AAANPIGGRYD +  FS+NVDLT PI+SRFD+LCVVRD VDP+QD MLA+FV+GSH++HH       K   V  L+++  + N++D     + PIP +LLRKYIIYAK+ + P LN+ +++K++ +Y  LRK S   G I +TVR+ ESMIR++EAHA++HLR  V EDDVNMAIRV+LESFI T+K+S+MK +   F +YL +++++ ELLLF LKQ+  +++   R         +IEI EK   DKA+++NI ++  F +S + R+N F  D  K+ I+ Q
Sbjct:   60 IGNGMEMDYRAIPELDRYEEEGLDDEEDLSELSPGARAAAEEAMRRRDRDQGM--GRMGRGL--LYDSEDEDDERPSKRRRRLAERAAEGAGAEGEDEEMIESIENLEDMKGHTVREWVSMAAPRLEIYHRFKNFLRTHVDEHGHNVFKERISDMCKENKESLLVNYEELASREHVLAYFLPEAPAEMLKIFDEAAKEVVLAMYPKYDRIAHEIHVRIGNLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCSFILGPFFQSQ-NQEVKPGSCPECQSLGPFEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDHCKPGDEIELTGIYHNNYDGSLNMANGFPVFATVILANHIARKDDRVAVAELTDEDVKAIVALSKDERIGERIFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHH----PSNKEGGVAGLEEV-VLPNSSD-----VPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVMLESFIDTQKFSVMKSMRKTFARYLAFRRDNNELLLFILKQLVAEQVAYQR-NRYGAQQDVIEIPEKDLVDKARQINIHNLSAFYDSDMFRSNKFSHDLKKKLIMQQ 888          
BLAST of DNA helicase vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 911.753 bits (2355), Expect = 0.000e+0
Identity = 474/845 (56.09%), Postives = 626/845 (74.08%), Query Frame = 1
Query:  202 INDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            I + ME DYR IPELD YE  G+DD+ DL ELS   R   EE + +RDR + +  G + RG+  +++ E  + E   +R R+  + AA  +  E  + +  E+IENLED +G TV +W+   + + EI +RF +FLRT +++ G +V+ ERI+ M  EN  SL++NYE L + +  LAYFLPEAP  ML IFD+ A E+ L+ Y +Y +I   IHVRI +LPLV+++RSLRQ+H++QLIRTSGVV+SCT V+PQL +V+YNC +CS  +GPF Q + N E+KP +CP+CQS GPFEIN E+T+Y+NYQRITIQESPG V AGRLPRSKDAILL DLVD CKPGDEI++TG Y   YD +LN    FPVF+T IL N++ +KD+++ ++ LTDED + I+ L+KDER+ ERI  SI PSIYGHE+IKR +AL+LFGG  K  G  +++RGDINVL+CGDPGT KSQFLK+VE++A R VFTTGQGASAVGLTAYV ++  T+EWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR T++AAANPIGGRYD +  FS+NVDLT PI+SRFD+LCVVRD VDP+QD MLA+FV+GSH++HH       K   V  L+++  + N++D     + PIP +LLRKYIIYAK+ + P LN+ +++K++ +Y  LRK S   G I +TVR+ ESMIR++EAHA++HLR  V EDDVNMAIRV+LESFI T+K+S+MK +   F +YL +++++ ELLLF LKQ+  +++   R         +IEI EK   DKA+++NI ++  F +S + R+N F  D  K+ I+ Q
Sbjct:   51 IGNGMEMDYRAIPELDRYEEEGLDDEEDLSELSPGARAAAEEAMRRRDRDQGM--GRMGRGL--LYDSEDEDDERPSKRRRRLAERAAEGAGAEGEDEEMIESIENLEDMKGHTVREWVSMAAPRLEIYHRFKNFLRTHVDEHGHNVFKERISDMCKENKESLLVNYEELASREHVLAYFLPEAPAEMLKIFDEAAKEVVLAMYPKYDRIAHEIHVRIGNLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCSFILGPFFQSQ-NQEVKPGSCPECQSLGPFEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDHCKPGDEIELTGIYHNNYDGSLNMANGFPVFATVILANHIARKDDRVAVAELTDEDVKAIVALSKDERIGERIFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHH----PSNKEGGVAGLEEV-VLPNSSD-----VPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVMLESFIDTQKFSVMKSMRKTFARYLAFRRDNNELLLFILKQLVAEQVAYQR-NRYGAQQDVIEIPEKDLVDKARQINIHNLSAFYDSDMFRSNKFSHDLKKKLIMQQ 879          
BLAST of DNA helicase vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 892.493 bits (2305), Expect = 0.000e+0
Identity = 455/789 (57.67%), Postives = 596/789 (75.54%), Query Frame = 1
Query:  202 INDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMR 2562
            I + ME DYR IPELD YE  G+DD+ DL ELS   R   EE + +RDR + +  G + RG+  +++ E  + E   +R R+  + AA  +  E  + +  E+IENLED +G TV +W+   + + EI +RF +FLRT +++ G +V+ ERI+ M  EN  SL++NYE L + +  LAYFLPEAP  ML IFD+ A E+ L+ Y +Y +I   IHVRI +LPLV+++RSLRQ+H++QLIRTSGVV+SCT V+PQL +V+YNC +CS  +GPF Q + N E+KP +CP+CQS GPFEIN E+T+Y+NYQRITIQESPG V AGRLPRSKDAILL DLVD CKPGDEI++TG Y   YD +LN    FPVF+T IL N++ +KD+++ ++ LTDED + I+ L+KDER+ ERI  SI PSIYGHE+IKR +AL+LFGG  K  G  +++RGDINVL+CGDPGT KSQFLK+VE++A R VFTTGQGASAVGLTAYV ++  T+EWTLEAGALVLAD+GVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV SLQAR T++AAANPIGGRYD +  FS+NVDLT PI+SRFD+LCVVRD VDP+QD MLA+FV+GSH++HH       K   V  L+++  + N++D     + PIP +LLRKYIIYAK+ + P LN+ +++K++ +Y  LRK S   G I +TVR+ ESMIR++EAHA++HLR  V EDDVNMAIRV+LESFI T+K+S+MK +   F +YL +++++ ELLLF LKQ+  +++   R
Sbjct:   51 IGNGMEMDYRAIPELDRYEEEGLDDEEDLSELSPGARAAAEEAMRRRDRDQGM--GRMGRGL--LYDSEDEDDERPSKRRRRLAERAAEGAGAEGEDEEMIESIENLEDMKGHTVREWVSMAAPRLEIYHRFKNFLRTHVDEHGHNVFKERISDMCKENKESLLVNYEELASREHVLAYFLPEAPAEMLKIFDEAAKEVVLAMYPKYDRIAHEIHVRIGNLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCSFILGPFFQSQ-NQEVKPGSCPECQSLGPFEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDHCKPGDEIELTGIYHNNYDGSLNMANGFPVFATVILANHIARKDDRVAVAELTDEDVKAIVALSKDERIGERIFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHH----PSNKEGGVAGLEEV-VLPNSSD-----VPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATGSIPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVMLESFIDTQKFSVMKSMRKTFARYLAFRRDNNELLLFILKQLVAEQVAYQR 824          
BLAST of DNA helicase vs. Ensembl Cavefish
Match: mcm4 (minichromosome maintenance complex component 4 [Source:ZFIN;Acc:ZDB-GENE-030131-9544])

HSP 1 Score: 339.732 bits (870), Expect = 7.470e-103
Identity = 208/638 (32.60%), Postives = 334/638 (52.35%), Query Frame = 1
Query:  586 KNRFFSFLRTFLNDEGK-----------SVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRA-LNNKQCFPVFSTHILVNYVLKKDEQLILSG--------LTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK-----TKGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESF 2424
            K +F  FL+ F++ E +            +Y +++  +++     L +N  H+ A    L   L   P+ ++  FD   NE+   R+     +   I VR  +      +RSL    + QLI  SG+V   + ++P++    + C  C+ +    ++ +     +P+ C  C ++    +   ++++ + Q I +QESP  +PAG+ P +      +DLVD  +PGD +++TG Y     R      Q   V+ THI   +  K DE+ + S          T+E    +  LA    ++ER+  ++APSIY HE+IK+ I L LFGG  K      +GN  R ++N+LLCGDPGT KSQ L++V  L PR  +T+G+G+SAVGLTAYV K+  T++  L+ GALVL+D G+C IDEFDKM+D  R+ +HE MEQQ++SI+KAGI+  L AR++I+AAANP+  +++  +   +N+ L   +LSRFD++ ++ D  D   D  LA  ++  + +   ++  E        LD                    + +L+ YI YA+  I P L+++    L E Y+ +RK     G +    R  ES+IRL+EAHAK+     V   DV  A R+  E+ 
Sbjct:  115 KEKFQRFLQRFIDPESREDENASLDLNEPLYLQKLDEISVVGDPVLNVNCSHIQAFDADLYRQLISYPQEVIPTFDMSVNELFFDRFPD-SVLEHQIQVRPYNALKTRNMRSLNPEDIDQLITISGMVIRTSQLIPEMQEAFFRCQVCAFSTR--VEVDRGRIAEPAVCRHCNTTHSLALVHNRSVFSDKQMIKLQESPEDMPAGQTPHTTVVYAHNDLVDKVQPGDRVNITGIYRAAPMRVNPRQSQVKSVYKTHIDAIHFRKTDERRLHSLDEENEQKLFTEERVATLKELAAKPDVYERLSSALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRGN-FRAEVNILLCGDPGTSKSQLLQYVFNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVALYYQSEEQIVEE-------YLD--------------------MAVLKDYIAYARTYINPRLSEEASQALIEAYVDMRKIGSGRGMVSAYPRQLESLIRLAEAHAKVRFSDKVETIDVEEAKRLHREAL 721          
BLAST of DNA helicase vs. Ensembl Cavefish
Match: mcm6 (minichromosome maintenance complex component 6 [Source:NCBI gene;Acc:103037949])

HSP 1 Score: 339.347 bits (869), Expect = 1.676e-102
Identity = 222/696 (31.90%), Postives = 358/696 (51.44%), Query Frame = 1
Query:  514 ENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEI-TLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTC--PDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYD------------------------------------RALNNKQCFPVFSTHI------LVNYVLKKDEQL---ILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGID-----VTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTE 2436
            E   +T G  V D + +   K      F +FL  F N +G+  Y      +      +L++++  +    Q LA  + E       I+  +   +   +R       +   +V I  LP   +IR L  + +  L+R SG V     V P+L    + C+ C   I    Q       +PS C  P C +   F +++ K+ + ++Q++ IQE+   +P G +PRS + IL  + V+  + GD+ D  G   +  D                                    R L  K  F   ++H+           ++ +EQ    I + +T ++   +  +++D+ L+  +  S+ P+I+G++ +KR I L LFGGVPKT  +G  LRGDINV + GDP T KSQFLK VE+ +PR V+T+G+ +SA GLTA V ++  + E+ +EAGAL+LAD GVC IDEFDKM  +D+ +IHEAMEQQ+ISI+KAG+ A+L AR++I+AAANP+GGRYD +++   NV+LT+PI+SRFD+  ++ D  + + D  +A+ ++  H R            +   +D++                  LD +R+Y+++A+Q   P ++K++E+ + E Y  LR+  ++  G+      +TVR  ESMIRLSE+ A++H    V    V  A R+L +S I  E
Sbjct:    5 EPTAETAGQLVKDELAEKCQKL-----FQAFLEEFHNSDGELKYLRDAEELIRPERNTLLVSFTDVEGFNQELATTIQEE---FYRIYPYLCRAVRNFARDRGNVPASKEFYVAIQDLPTRHKIRELTTLRIGSLVRISGQVVRTHPVHPELVSGTFLCLDCQSAIKDVEQ--QFKYTQPSICRNPVCNNRRRFLLDTNKSKFIDFQKVRIQETQAELPRGSIPRSMEIILRAEAVESAQAGDKCDFIGCLIVVPDVSQLATSGVRAETSSRTAGTQGYENEGVRGLKALGVRELTYKLAF--LASHVAPTNPRFGGKEIRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGILLMLFGGVPKTTMEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMETRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVGGRYDRSKSLKQNVNLTAPIMSRFDLFFILVDDSNEVTDYAIARRIVDLHSR------------IENSIDRM----------------YTLDEIRRYLLFARQ-FKPKISKESEDFIVEQYKRLRQ--RDGSGVTKSAWRITVRQLESMIRLSESMARMHCCDEVQPKHVKEAFRLLNKSIIRVE 657          
BLAST of DNA helicase vs. Ensembl Sea Lamprey
Match: mcm2 (minichromosome maintenance complex component 2 [Source:ZFIN;Acc:ZDB-GENE-020419-24])

HSP 1 Score: 290.041 bits (741), Expect = 5.519e-90
Identity = 147/305 (48.20%), Postives = 209/305 (68.52%), Query Frame = 1
Query:  202 INDNMERDYRHIPELDTYETAGIDDD--TDLIELSQSERIRVEEELNKRDR-LEAIASGNLRRGM-HDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEK 1104
            I DNM  DYR IPELD YE  GIDD+      ELS   R R EEE+ +RD+ +   A G  R G+ +D+ E++   A     R R+  ++AA    G + + +  E+IENLED +G++V +W+   + + EI NRF +FLRT ++  G +V+ ERIA M  EN  SL++NYE L A +  LAYFLPEAP  ML + D+ A E+ L+ + +Y +I  +IHVRIS LPLV+++RSLRQ+H++QLIRTSGVV++CT V+PQL++V+YNC +C+  +GPF+Q +S  E++P +CP+CQS GPFEIN E+
Sbjct:   81 IGDNMIADYRAIPELDMYEHEGIDDNEIPSEAELSPGARARAEEEMERRDQQMGRTAPGRTRLGLLYDMDEEDGQPA-----RKRRLGELAAE---GADDDEEMIESIENLEDMKGLSVREWVSMAAPRLEIHNRFKNFLRTHVDAHGHNVFKERIADMCKENRESLVVNYEDLAAREHVLAYFLPEAPAEMLGVMDEAAKEVVLAMFPKYDRIAPAIHVRISSLPLVEELRSLRQLHLNQLIRTSGVVTACTAVLPQLSMVKYNCHKCNFVLGPFLQSQSQ-EVRPGSCPECQSLGPFEINMEQ 376          
BLAST of DNA helicase vs. Ensembl Sea Lamprey
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:ZFIN;Acc:ZDB-GENE-120927-1])

HSP 1 Score: 289.271 bits (739), Expect = 1.126e-84
Identity = 225/690 (32.61%), Postives = 341/690 (49.42%), Query Frame = 1
Query:  571 TKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHL-----------------------------PLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSC-TIGPFIQGESNDEIKPSTCPD--CQSSGPFEIN--SEKTLYKNYQRITIQE--SPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNK----QCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDE-----------RLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK--TKGNRL--RGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHG--------------KLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFIST 2433
            TK E+  +FF F R  L ++ +           +E   S++++++ LV     L   +P     + +  D+V   + L+ +  Y      + +RIS L                             PL  Q+++LR     +L+   G V    N+ P    + ++C  C    +     G+     K   C D  C+S   F  N  S+ T   ++Q I +QE        AGR+PR+ +  L  DLVD C PGD I +TG   +       NK    +C  +F  +I    V     Q    G  D      L+ +  E            LF  +V SI P+IYGHE +K  +AL+LFGGV +  T  NR+  RGD +VL+ GDPG GKSQ L+ V  +APR V+  G   +  GLT  ++K+  + ++ LEAGALVL D+G+C IDEFDKM +Q + ++ EAMEQQSIS++KAG+V SL AR++I+AAANP+ G Y+ ++  S+N+ + S +LSRFD++ ++ D  D  +D +L++ V+  H                   KLTA   S+ V     L   +     EA  L P+P  LLRKY+ YA++ + P L+ +    L + YL LR+      G  +T R  ES+IRL+EA A+L LR+   ++D +  I ++  SF  T
Sbjct:   93 TKVEVFEKFF-FARLELYNKDE-----------IEEKGSILVDFKELVE-DHCLTVAMPTLADDLAETPDRVLQYMGLAVHQVYLHCTPRLEIRISDLEEQKITSHGAVLRANLPTLPYRQIIYNYEPLT-QLKNLRANCYGRLVAIRGTVVRVGNIKPLCTRLAFSCNACGTEQVLRLPYGKFTLPTKRVKCADEDCRSR-TFMPNRRSQLTETVDWQNIKVQELMHGEQREAGRIPRTVECELTHDLVDSCVPGDVITLTGIVKVASSDEGRNKSNKDKC--MFLLYIQAVAVSNTKGQRSDGGGEDTAPGVALDFSLKELYAVQEIQAQPHLFRLLVHSICPTIYGHELVKAGLALALFGGVQRYGTDKNRIPVRGDPHVLIVGDPGLGKSQMLQAVCNIAPRGVYVCGNTTTTAGLTVTLSKDGPSGDYALEAGALVLGDQGLCCIDEFDKMPNQHQ-ALLEAMEQQSISLAKAGVVCSLPARTSIVAAANPVCGHYNKSKTVSENLKMGSALLSRFDLVFILVDTPDEERDHVLSEHVMAMHAGKRMLAGASVSRAAAPGLKLTASSSSDDVLGGLSLSDRLKARRGEA--LDPVPHSLLRKYVGYARRYVRPCLSAEAAQTLQDFYLELRRQHHGGDGTPITTRQLESLIRLTEARARLELRENATKEDADDVIDIMKHSFSDT 762          
BLAST of DNA helicase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008164.1 (pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:ENSPMAG00000007367.1 transcript:ENSPMAT00000008164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 272.322 bits (695), Expect = 2.057e-82
Identity = 164/396 (41.41%), Postives = 236/396 (59.60%), Query Frame = 1
Query:  883 RSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCP---DCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTY-CIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAK--DERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSH 2046
            R+L    +  ++   G+V+ C+ V P++    + C     +I       ++ +  PS+       + S P E     ++Y+++Q I++QE P   PAG+LPRS D +L DDLVD CKPGD + V GT+ C+   +A      F      IL+   +K+  + ++   + ED   I   +K   + +F+++  S+APSI+GHE IK+A+   L GG  K    G+R+RGDINVLL GDP   KSQ L++V   APR + TTG+G+S VGLTA VT +  T E  LEAGA+VL D+GV  IDEFDKM D DRT+IHE MEQ  ++I+KAGI A L AR +++AAANPI GRYD  +   +N+ L   +LSRFD+L +V D  DP  D  ++  V+  H
Sbjct:   51 RTLTSRFLGNMVCVEGIVTKCSLVRPKVVRSVHYCPATQKSIERKYSDLTSLDAFPSSAAYPTKDEESNPLETEYGLSIYRDHQTISLQEMPEKAPAGQLPRSADVVLDDDLVDRCKPGDRVQVIGTFRCLPGKKAGYTSGTFRT----ILIGNNVKQMNKEVVPTFSGEDVNKIKTFSKTHSKNIFDQLSKSLAPSIHGHEYIKKAVLCLLLGGTEKILDNGSRIRGDINVLLIGDPSVAKSQMLRYVLHTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLGDRGVVCIDEFDKMTDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPIYGRYDQYKTPMENIGLQDSLLSRFDLLFIVLDQTDPEYDREISDHVLRMH 442          
BLAST of DNA helicase vs. Ensembl Sea Lamprey
Match: mcm5 (minichromosome maintenance complex component 5 [Source:ZFIN;Acc:ZDB-GENE-021209-1])

HSP 1 Score: 263.077 bits (671), Expect = 5.325e-78
Identity = 175/508 (34.45%), Postives = 261/508 (51.38%), Query Frame = 1
Query: 1060 PDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHI--------LVNYVLKKDEQLILSG--LTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKGNRL--RGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISK-AGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQEN-------GGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVL---------------LESFISTEKYSLMKHLENKFRQ 2478
            P C    P+ I  +K    +YQ + +QE+P  VP G +PR         L D   PG+ I V G Y I   +A    Q      T          +V   +  D      G  L  ++   I  LA    ++E I  SIAPSIYG  +IK+AIA  L GG  K   + L  RGDIN+LL GDPGT KSQ LKFVE+ +P  V+T+G+G+SA GLTA V ++  T+ + +E GA+VLAD GV  IDEFDKM + DR +IHEAMEQQ+IS  +  GI  +L +R +++AAAN + GR+D ++   +N+D    ILSRFD++ +++D  +  +D +LAK V+  H+    ++ A E                           I L  L+K+I Y +    P ++ +   KL   Y+ +R  ++E+         I +TVR  E+++R+SE+ AK+ L+    E  V+ A+R+                 E F + E   L+  +E + ++
Sbjct:   13 PSCPID-PYFIMPDKCKCVDYQTLKLQEAPDAVPHGEMPRHMQLYCDRYLCDRVVPGNRITVMGIYSI--KKAFTKMQGKGRDRTGAGIRNPYLRVVGITVDTDGAGRSMGIALHPQEEEEIRQLAASPSVYETIARSIAPSIYGFMDIKKAIASLLIGGSRKRLPDGLTRRGDINLLLLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVMRDPATRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISTLRIGGITTTLNSRCSVLAAANSVFGRWDDSKG-EENIDFMPTILSRFDMIFIIKDEHNEKRDMILAKHVMNVHLNAKTQMQAVEGE-------------------------IELSTLKKFIAYCRSKCGPRMSAEACEKLKNRYVLMRSGAREHDRDRDHRNSIPITVRQLEAIVRISESQAKMRLQPFATEAHVDEALRLFQVSTLDAALSGSLSGAEGFTTQEDQELLARVEKQLKR 491          
BLAST of DNA helicase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006035.1 (pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 gene:ENSPMAG00000005356.1 transcript:ENSPMAT00000006035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 254.218 bits (648), Expect = 4.554e-73
Identity = 196/658 (29.79%), Postives = 314/658 (47.72%), Query Frame = 1
Query:  586 KNRFFSFLRTFLNDEG----KSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQIN-DSIHVRISHLPLVD------------------------------------QIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSC-TIGPFIQGESNDEIKPSTCP--DCQ---SSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLK----KDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT-KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVT-VRYFESMIRLSEAHAKLHLRQTVNEDDVNMA 2400
            K+    FL+ F  D+G    +  Y E++  +A     SL I+ + L   +  LA  + E  +    +F    +E+ L  Y + + +  D++ V I H  ++                                      +R ++   + +L+   GVV+  T V P + V  Y C +C   T  P     S   +  + CP  DCQ   S G   + S  + +  +Q + IQE    VP G +PR+    +  +   + +PGD I +TG +     +     Q   +  T +  + V+K    +D +L +  L++ + R I     +E  +E++  SIAP IYGHE++K+A+ L L GGV ++ +G ++RG+IN+ L GDPG  KSQ L ++++LAPR  +TTG+G+S VGLTA V ++  T E TLE GALVLAD GVC IDEFDKM D DRTSIHE MEQQ+ISI+K         R+ ++       G   +  +    + L + +LSRFD+L +++D  D   D  LA+ +   H   H   +                             P+ + L+R+YI    Q   P++     + ++  Y+ +RK ++ +     T  R   +++RLS A A+L L   V ++DVN A
Sbjct:   10 KDNCKKFLQEFYKDDGLGKKQFKYGEQLVHLAQREQVSLCIDLDDLAELEPELAERVVENARRYAALFADAVSEL-LPEYRQGEPVQKDALDVYIEHRLMLQNRHGDADAHDPKNQYPPELMRRFELYFKAPGTLKPLSVRDVKANSIGRLVTVRGVVTRATEVKPMMVVATYTCDQCGAETYQPIA---STSFMPLALCPSRDCQTNKSGGRLYLQSRGSKFVKFQELKIQEHSDQVPVGCIPRAMTVCVRGENTRLAQPGDHISITGIFLPVLKQGFRAMQQGLLSETFLEAHRVVKMNKTEDNELDVEELSESELRQI----TEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDRSPRGMKIRGNINICLMGDPGVAKSQLLCYIDRLAPRSQYTTGRGSSGVGLTAAVLQDPLTGEMTLEGGALVLADHGVCCIDEFDKMADSDRTSIHEVMEQQTISIAKVTWGVGASTRTRVLQLVGYGRGGGGSCCSRWLGIKLPAALLSRFDLLWLIQDKPDRDNDIRLAQHITYVHQHCHQPPSQH--------------------------TPLDMKLMRRYIALC-QRRQPAVPDTLADYITAAYVEMRKEARVSKDTTFTSARTLLAILRLSTALARLRLVDVVEKEDVNEA 632          
BLAST of DNA helicase vs. Ensembl Yeast
Match: MCM2 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000000119])

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 368/800 (46.00%), Postives = 503/800 (62.88%), Query Frame = 1
Query:  202 INDNMERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYE--------------TIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKD--------EQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKGNR--LRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHH---------------GKLTAEE-KSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQY 2481
            ++DNM  DY      D Y+   +DD  +  ELS SER R++ +LN+RDRL       LR   +   EDE  E  A         +        E+ E+   +              T+E+L + +  + ++WI QP+  + I     SFL  + ++ G+SVY  RI  +   N  SL +NY HL  ++  LA FL + P+ ML IFD VA E T   Y  Y +I+  IHVRIS  P +  +R LR+ ++  L+R +GVV+  T V PQL  V++NC++C   +GPF Q +SN+EI+ S C +C+S GPF +N EKT+Y+NYQR+T+QE+PGTVP GRLPR ++ ILL DLVD+ KPG+E++VTG Y   YD  LN K  FPVF+T I  N + +++        E L +   T+E+ R    +++D  + ++I+ S+APSIYGH +IK A+A SLFGGVPK    +  +RGDINVLL GDPGT KSQ LK+VE+ A R VF TGQGASAVGLTA V K+  TKEWTLE GALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIV +LQAR +IIAAANP GGRY++T   + NV LT PILSRFDILCVVRD+VD   D  LA FV+ SH+R H               G+   E+ + E+ ++L+     +     +   + PIP +LL KYI YA+  I+P L++ + +K+S VY  LR+ S   G   +TVR+ ES++R++E+ AK+ L + V+  D++ AI+V+++SF+  +K S+ + L   F  Y
Sbjct:   74 MDDNMYEDYAADHNRDRYDPDQVDD-REQQELSLSERRRIDAQLNERDRL-------LRNVAYIDDEDEEQEGAAQLDEMGLPVQRRRRRRQYEDLENSDDDLLSDMDIDPLREELTLESLSNVKANSYSEWITQPNVSRTIARELKSFLLEYTDETGRSVYGARIRTLGEMNSESLEVNYRHLAESKAILALFLAKCPEEMLKIFDLVAMEATELHYPDYARIHSEIHVRISDFPTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQ-DSNEEIRISFCTNCKSKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIYKNNYDGNLNAKNGFPVFATIIEANSIKRREGNTANEGEEGLDVFSWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKNNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQMDMDKVSRVYADLRRESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKVVVDSFVDAQKVSVRRQLRRSFAIY 864          
BLAST of DNA helicase vs. Ensembl Yeast
Match: MCM4 (Essential helicase component of heterohexameric MCM2-7 complexes; MCM2-7 complexes bind pre-replication complexes on DNA and melt DNA prior to replication; forms an Mcm4p-6p-7p subcomplex; shows nuclear accumulation in G1; homolog of S. pombe Cdc21p [Source:SGD;Acc:S000006223])

HSP 1 Score: 356.681 bits (914), Expect = 5.886e-109
Identity = 211/543 (38.86%), Postives = 306/543 (56.35%), Query Frame = 1
Query:  880 IRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCP--DCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCF-PVFSTHILVNYVLKKDEQLI-----------------------LSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGG----IDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVL 2412
            +R L    + +LI   G+V   T V+P + V  + C  C  T+   I      E  P+ C   DC       +   +  + + Q I +QE+P  VP G+ P S    + D+LVD C+ GD I+VTGT+     RA + ++    ++ T++ V +V K  ++ +                       +  +TD+D   I  +A  E L+  +  SIAPSIY  E++K+ I L LFGG  KT  KG R RGDIN+LLCGDP T KSQ L++V ++ PR V+T+G+G+SAVGLTAY+T++  TK+  LE+GALVL+D GVC IDEFDKM+D  R+ +HE MEQQ+ISI+KAGI+ +L ARS+I+A+ANPIG RY+     ++N+DL  P+LSRFD++ +V D VD   D  LAK        H   L  E+K E + + D L                 P++ L  YI YAK+ I P + +  + +L   Y+ +RK   ++      I  T R  ESMIRL+EAHAK+ L+  V  +DV  A+R++
Sbjct:  314 MRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQE--PARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAK--------HLTNLYLEDKPEHISQDDVL-----------------PVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLI 829          
BLAST of DNA helicase vs. Ensembl Yeast
Match: MCM5 (Component of the Mcm2-7 hexameric helicase complex; MCM complex is important for priming origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation when activated by Cdc7p-Dbf4p in S-phase [Source:SGD;Acc:S000004264])

HSP 1 Score: 315.464 bits (807), Expect = 3.523e-95
Identity = 224/691 (32.42%), Postives = 346/691 (50.07%), Query Frame = 1
Query:  580 EIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEIT--LSRYARYQQIN-----------DSIHVRISHLPLVDQI----------RSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRC----SCTIGPF-----------------IQGESN--------DEIKPSTC-PDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILN---------------LAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKA-------SQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLES 2421
            EI   F +F+  F  D  + +Y +++    L    SL +N EHL+   + +   L + P  ++ +F+    ++   +S  +R Q  N           D+  + ++ LP    I          R L   HV +++R SG++ S + +  +   +   C  C    S TI  F                 I+ ES+        DE     C PD     P+ I  E + + + Q + +QE P  VP G +PR+        L +   PG  + + G Y I+  +  N          +      ++     IL   +D +T +I N               L+++ +L+E +  SIAPSI+G+E+IK+AI   L GG  K    G RLRGDINVLL GDPGT KSQ LKFVE+++P  V+T+G+G+SA GLTA V ++  T+E+ LE GA+VLAD GV  IDEFDKM D+DR +IHEAMEQQ+ISI+KAGI   L +R++++AAANPI GRYD  ++  DN+D  + ILSRFD++ +V+D  +  +D  +A  VI  H  +   +  +++                   E G+   I ++ +++YI Y +    P L+     KLS  ++++RK        S E   I +T+R  E++IR++E+ AKL L     E  V+ AIR+   S
Sbjct:   26 EIIKSFKNFILEFRLD-SQFIYRDQLRNNILVKNYSLTVNMEHLIGYNEDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENTSMDTDSLLLNSLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNCRHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPD-----PYIIIHESSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIYSIYNSK--NGAGSGRSGGGNGGSGVAIRTPYIKILGIQSDVETSSIWNSVTMFTEEEEEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQE-------------------ENGS--EISIEKMKRYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEAIIRITESLAKLELSPIAQERHVDEAIRLFQAS 687          
BLAST of DNA helicase vs. Ensembl Yeast
Match: MCM6 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex; forms a subcomplex with Mcm4p and Mcm7p [Source:SGD;Acc:S000003169])

HSP 1 Score: 318.546 bits (815), Expect = 2.414e-94
Identity = 200/611 (32.73%), Postives = 315/611 (51.55%), Query Frame = 1
Query:  823 QQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPD--CQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLV------DICK--------------------PGDEIDVTG-----------------------TYCIFY-----------------DRALNNKQCFPVFSTHILVNYVLK---KDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQEN---GGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFI 2427
            +Q      +   +LP V +IR +R   +  L+  SG V+  + V P+L    + C  C   +    Q  S    +P+ CP+  C++   + +N  ++ + ++Q++ IQE+   +P G +PR+ D IL  D V      D CK                    P   +D  G                       TY I +                 D   NN++     + ++  N V +   +D+++ L+ L+ ++   +  + KDE +++++V SIAP+++GHE +K+ I L + GGV K+  +G +LRGDIN+ + GDP T KSQFLK+V   APR V+T+G+ +SA GLTA V ++    ++T+EAGAL+LAD G+C IDEFDKM+  D+ +IHEAMEQQ+ISI+KAGI A+L AR++I+AAANP+GGRY+   +   N+++T+PI+SRFD+  V+ D  +   D  LA  ++  HM+         + E ++                    P   + LR+YI YA+ T  P L K+  + L E Y  LRK   +        +TVR  ESMIRLSEA A+ +    +    +  A  +L +S I
Sbjct:  257 EQTERVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMCRAIVDNVEQ--SFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVRIQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSSTLDTRGISKTTEGLNSGVTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRETELQMAANLQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMK---------RDEAIEP-------------------PFSAEQLRRYIKYAR-TFKPILTKEARSYLVEKYKELRKDDAQGFSRSSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSII 836          
BLAST of DNA helicase vs. Ensembl Yeast
Match: MCM3 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex [Source:SGD;Acc:S000000758])

HSP 1 Score: 314.309 bits (804), Expect = 3.957e-93
Identity = 227/619 (36.67%), Postives = 328/619 (52.99%), Query Frame = 1
Query:  733 AYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQL-NVVQYNCIRCSCTIGPFIQGESNDEIK---PSTCPDCQSSGPFEINSEK--TLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALN--NKQCFPVFSTHILVN--YVLKKDEQLILSG--LTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSH----------------------MRHHGKLTAEEKS---------------EVVKKLDKL---GAMV-----NTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVL 2412
            AYF+P A K + D+ D + +    +  A   +    +  + S        R+L   H+++L+   G+V+  + V P+L   V Y           +    +    +   P+  P   + G  ++ +E   + + ++QRIT+QE P   PAG+LPRS D IL DDLVD  KPGD ++V G +       +N  N      F T IL N  Y L      + +   LTD D RNI  L+K + +F+ +  S+APSIYGH++IK+AI L L GGV K    G+ LRGDIN+L+ GDP T KSQ L+FV   A   + TTG+G+S VGLTA VT +  T E  LEAGA+VLAD+GV  IDEFDKM D DR +IHE MEQQ+++I+KAGI  +L AR ++IAAANP+ G+YD  R+   N+ L   +LSRFD+L VV D ++ I+D  +++ V+ +H                      +     +  EE S                V +K + L   GA +     N   +E   L  IP   LRKY+ YAK+ + P L ++  N + + Y  LR          +T R  E++IRL+ AHAK+ L +TVN+ D  +A  +L
Sbjct:  119 AYFIPPAEKALTDLADSMDDVPHPNASAVSSRHPWKLSFKGSFGAHALSPRTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTPAIYPTEDTEG-NKLTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKPGDRVNVVGVFKSLGAGGMNQSNSNTLIGFKTLILGNTVYPLHARSTGVAARQMLTDFDIRNINKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTHRYLPPGYLEGEPVRERLNLSLAVGEDADINPEEHSNSGAGVENEGEDDEDHVFEKFNPLLQAGAKLAKNKGNYNGTEIPKLVTIP--FLRKYVQYAKERVIPQLTQEAINVIVKNYTDLRNDDNTKKS-PITARTLETLIRLATAHAKVRLSKTVNKVDAKVAANLL 733          
BLAST of DNA helicase vs. Ensembl Nematostella
Match: EDO35060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMI2])

HSP 1 Score: 919.072 bits (2374), Expect = 0.000e+0
Identity = 469/841 (55.77%), Postives = 611/841 (72.65%), Query Frame = 1
Query:  214 MERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENF-ESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILH 2727
            MERDYR IP LDTY+   +DDD       + +R   E  + KRDR EA + G LRRG   I  D+  + E S  RHR+  +IA   + GE   E +  E+IENLED +G +V +W+   + + EIKNRF  FLRTF++D+G SVY E+I  M   N +SL+I+Y  L   QQ LAYFLPEAP  ML IFD+ A E+ L+ +  Y +I   IHVRI+ LPL++++RSLRQ+HV+QLIRT GVV+S T +MPQL+V++Y+C +CS  +GPF QG S+ E+KP +CP+CQS GPFEIN E+TLY+NYQ+I IQESP  V AGRLPR KD IL+ DLVD CKPGDEI++TG Y I YD +LN    FPVF+T I  N++ K+D+++ ++ LTDED + I  L+KDER+ ERI+ SI PSIYGHE+IKRA+ALSLFGGV K  G  +++RGDINVLLCGDPGT KSQFLK+VE+ APR VFTTGQGASAVGLTAYV ++  TKEWTLEAGALVLADKG+CLIDEFDKMND DRTSIHEAMEQQSISISKAGIV SLQAR +I+AAANPIGGRYD +  F++NVDLT PILSRFDILCVVRD VD IQD +LA+FV+ SH+RHH      E  ++   +  L                IP DLL+KY+IYA++ + P LN  +++K+++++  LRK S   G I +TVR+ ESMIR++E+HAK+HLR+ V EDDVNMAIRV+LESFI T+K+S+M++++  F  YL Y++++ ELLLF LKQ+  +++T  R+        +IEI E+ F D+A+++NI ++  F +S + + N F  D  K+ I+ 
Sbjct:    1 MERDYRAIPALDTYDANNLDDDDYDDLAPE-QRAEAERLMRKRDREEAASQGRLRRG---ILYDDDDDEEESRPRHRR--RIAERAAEGEYLDEDEMIESIENLEDMKGHSVREWVSMQAPRLEIKNRFKQFLRTFVDDQGHSVYREKIRQMCEANKQSLVIDYNILANEQQVLAYFLPEAPTEMLQIFDEAAKEVVLAMFPNYDRITTEIHVRIAELPLMEELRSLRQLHVNQLIRTGGVVTSSTGIMPQLSVIKYDCPKCSFILGPFFQG-SDQEVKPGSCPECQSRGPFEINMEQTLYQNYQKIKIQESPSKVAAGRLPRYKDVILMADLVDSCKPGDEIELTGIYKINYDSSLNRSNGFPVFATIIEANFITKQDDKMAVTSLTDEDIKAINALSKDERIGERIIASIGPSIYGHEDIKRALALSLFGGVAKDPGGKHKIRGDINVLLCGDPGTAKSQFLKYVEKTAPRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADKGMCLIDEFDKMNDADRTSIHEAMEQQSISISKAGIVTSLQARCSILAAANPIGGRYDPSLTFAENVDLTEPILSRFDILCVVRDTVDAIQDELLARFVVNSHVRHHPNTPENEDEDMEVHMFTL------------RRNAIPQDLLKKYMIYARERVHPRLNNMDQDKVAKMFADLRKESMATGSIPITVRHIESMIRMAESHAKMHLREYVMEDDVNMAIRVMLESFIDTQKFSVMRNMKKAFSHYLAYRRDNNELLLFVLKQLIKEQITFYRS-RYHSEPDVIEIQEEEFTDRARQINIINLASFYDSPVFQANRFVHDKKKKLIIQ 821          
BLAST of DNA helicase vs. Ensembl Nematostella
Match: EDO33971 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQR1])

HSP 1 Score: 333.569 bits (854), Expect = 5.723e-101
Identity = 200/585 (34.19%), Postives = 312/585 (53.33%), Query Frame = 1
Query:  832 NDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTC--PDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYD------------------------------------RALNNKQCFPVFSTHILVNYVLKKD-------EQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRK---ASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTE 2436
            N   +V    LP   +IR L    +  L+R SG V     V P+L    + C+ C   I    Q       +P+ C  P CQ+   F ++  K+ Y ++Q++ IQE+   +P G +PRS + IL  + V+  + GD+ D TGT  +  D                                    R L  +  F   S          KD        + I   +T ++ + I  +++D+ L++ I+ SI P+I+G++ +KR + L LFGGVPK   +   LRGDIN+ + GDP T KSQFLK VE+ + R V+T+G+ +SA GLTA V K+  + E+ +EAGA++LAD GVC IDEFDKM+ +D+ +IHEAMEQQ+IS++KAG+ ASL AR++++AAANPIGGRYD T++   N+++++PI+SRFD+  ++ D  + + D  +A+ ++  H R       E+  E V  +D+                      +++Y+ +A+Q   P++ K+ ++ + E Y  LR+   +S       +TVR  ESMIRLSEA A+L+ +  V    V  A R+L +S I  E
Sbjct:  101 NKEFYVSFIDLPTRHKIRELTSQKIGSLLRISGQVVRTHPVHPELVTATFTCLDCQTVIKDVEQ--QFKYTQPTVCRNPICQNRARFALDINKSRYVDFQKVRIQETQAELPRGCIPRSVEVILRAEAVEQAQAGDKCDFTGTLIVVPDIAQLATPGTRSETGQRQTSGEGYEAEGVRGLKALGVRDLTYRLSFLACSVQATNPRFGGKDLDGDDMTAEAIKKQMTPQEWQKIYEMSRDKNLYQNIINSIFPTIHGNDEVKRGVLLMLFGGVPKKTLEKTSLRGDINICVVGDPSTAKSQFLKHVEEFSARAVYTSGKASSAAGLTAAVVKDEESSEFVIEAGAMMLADNGVCCIDEFDKMDPRDQVAIHEAMEQQTISLTKAGVKASLNARTSVLAAANPIGGRYDRTKSLKQNLNMSAPIMSRFDLFFILVDECNEVVDYAIARRIVDLHSRR------EQSVERVYAVDE----------------------VQRYLTFARQ-FKPTITKEAQDYMVEQYKHLRERDGSSTTKSAWRITVRQLESMIRLSEAMARLYCQDKVEPKHVKEAYRLLNKSIIRVE 654          
BLAST of DNA helicase vs. Ensembl Nematostella
Match: EDO34425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPE9])

HSP 1 Score: 327.405 bits (838), Expect = 4.909e-99
Identity = 214/546 (39.19%), Postives = 303/546 (55.49%), Query Frame = 1
Query:  883 RSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTC--PDCQSSG-PFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQ---CFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSH-MRHHGKLTAE-----EKSEVV-----------------KKLDKL--GAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGID------VTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAI 2403
            RSL   ++  ++   G+V+ C+ V P++    + C +   T+       ++ E  P++   P     G P E       YK++Q  TIQE P   PAG+LPRS D I  +DLVD CKPGD + V GTY     R L +K+       F T ++VN V    +++  +    + ++        + +FE +  S+APSI+GHE IK+A+   L GG  K    G RLRGDIN+LL GDP T KSQ L++V   APR + TTG+G+S VGLTA VT +  T +  LEAGA+VLAD+GV  IDEFDKM+D DRT+IHE MEQ  ++ISKAGI A L AR +++AAANP+ GRYD  +N  DN+ +   +LSRFD+L +V D +DP  D  +++ V+  H  R  G+   E     E+S+V+                 +K D +  G   +  D      + + +  ++KYI  AK  I P+L K   + +S+ Y  LR   QEN G D      VT R  E+MIRLS AHAK  + +T+ E D   A+
Sbjct:  111 RSLSSRYIGSMVCVEGIVTKCSLVRPKVVRSVHYCPKTKKTLIRKYTDMTSLEAVPTSSVYPTKDEDGNPLETEYGLCTYKDHQTFTIQEMPERAPAGQLPRSVDIIADNDLVDKCKPGDRVQVIGTY-----RCLPSKRSGFTSGTFRTVLIVNNVQVMSKEVAPNFSASDISKIKKFSKSKQDVFEVLAKSLAPSIHGHEFIKKAVLCLLLGGTEKVLENGTRLRGDINILLIGDPSTAKSQMLRYVLHSAPRAIPTTGRGSSGVGLTAAVTTDPETGDRRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHAKLNARCSVLAAANPVFGRYDEFKNPMDNIGMQDSLLSRFDLLFIVLDQMDPDNDRRISEHVLRIHRYRKPGEQEGEALPFGEESDVLATRDPDQEEEDEDTPVYEKHDPMLFGKQKDKKD------KFVSMAFMKKYIHVAK-AIKPALTKPAADLISKAYSELR--DQENIGNDKAKTTPVTARTLETMIRLSTAHAKARMSKTITEGDAQAAV 642          
BLAST of DNA helicase vs. Ensembl Nematostella
Match: EDO42446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1E9])

HSP 1 Score: 300.056 bits (767), Expect = 3.766e-91
Identity = 199/563 (35.35%), Postives = 306/563 (54.35%), Query Frame = 1
Query:  838 SIHVRISHLPLVDQIRSL---RQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEI-KPSTCPDCQ--SSGPF----EINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDE---DTRNILNLAKDERLFER--IVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVI-GSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKF 2472
            +IHVR+S+LP+  +++     +   + + +  SG V   +++    +  ++ C RC          E    I KP++CP  +  +S  F    E  S  T  ++YQ I IQE    +  G +PRS   +L DDLVD CK GD++ ++G     +   +   +C          N+V   +EQ I + +T+E   +     +  KD+ L  R  I+ S  P +YG   +K A+ L L GGV +    G R+RG+ ++LL GDPGTGKSQFLK+  ++ PR V TTG G+++ GLT    ++  + EW LEAGALVLAD G+C IDEF+ + + DR SIHEAMEQQ+IS++KAG+V  L  R+TI+AA NP  G+ D  ++ S N  L SP+LSRFD++ V++DV +   D +++ F++ G  +R    ++AE+ +E +  +D+L A                      YI +AK T+ P LN D+   L + Y   R+A   N     T+R  ES+IRL++AHA+L  R+ V   D  +A+  +  S  +T     M  L  +F
Sbjct:    6 NIHVRLSNLPICPELKRSTIPKSSDMGRFLAVSGTVIRVSSIKMLEHEREFICSRCKYVFSAQADFEQFYTIPKPTSCPSGEGCTSNKFNCLSEPGSNPTSCRDYQEIKIQEQVQKLAVGTIPRSMWVVLEDDLVDSCKAGDDVTISGVVMRRWWPVIAEVKCD--LEVVFKANHVSVNNEQRIGAIVTEEMKQEFDEFWSKHKDKPLSGRNHILASFCPQVYGLYAVKLAVTLILMGGVQRVDASGTRVRGESHMLLIGDPGTGKSQFLKYSAKIMPRSVLTTGIGSTSAGLTVAAVRD--SGEWQLEAGALVLADGGLCCIDEFNSIREHDRGSIHEAMEQQTISVAKAGMVCKLNTRTTILAATNP-KGQLDIDQSLSVNTALASPLLSRFDLVFVLQDVKNEDWDRIVSSFILEGKGVR----MSAEKPAEALWGMDRLQA----------------------YICHAK-TLEPQLNTDSNRVLRQYYQCQRQADTRNAA-RTTLRLLESLIRLAQAHARLMYREHVTVQDAVVAVTCVECSMQNTALLGCMNALHTRF 535          
BLAST of DNA helicase vs. Ensembl Nematostella
Match: EDO37946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEF9])

HSP 1 Score: 300.442 bits (768), Expect = 1.077e-89
Identity = 212/665 (31.88%), Postives = 330/665 (49.62%), Query Frame = 1
Query:  577 QEIKNRFFSFLRTFL--NDEGKSV-YAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQ---------------------------------------IRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSS---GPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYD---RALNNKQCFPVF-STHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTK-GNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYA--KQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVT-VRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVL 2412
            QE  ++   FL  F    DEGK   Y E++  +A    + L+I  + +    Q LA  + E  +    +F+    E+      R  Q  D++ + I H  L++Q                                       +R+++   + +L    G+V  CT V P + V  Y C +C       IQ ++   +      +C+++   G   + +  + +  +Q + IQE    VP G +PRS   I   +   +  PGD + VTG +        R +        F   H +V     +D+++    L+DE+ R    L+ +   ++++  S+AP IYGHE+IK+A+ L L GGV  T  G ++RG+IN+LL GDPG  KSQ L ++++LAPR  +TTG+G++ VGLTA V K+  T E  LE GALVLADKGVC IDEFDKM D DRT+IHE MEQQ++SI+KAGI+ +L AR +I+AAANP  GRY+  ++   N+ L + +LSRFD+L +++D  D   D  LA+ +   H       +A   S                        P+ ++L+R+YI     KQ I P    D    +   Y+ +RK ++ N     T  R   +++RL+ A A+L L   V ++DVN A+R++
Sbjct:    5 QEELDKAKRFLAEFYVQEDEGKEFKYGEQLIKIAHREQQELLIELDDIAEIDQDLAENVKENTRRYKRLFEDAIYEMLPEYKEREVQTKDALDIYIEHRLLLEQRNRQNEPGGAIDPRTKYPPELLRRFEVNFKHLSTQKHESVRNVKADCIGKLTVVRGIVMRCTEVKPVVEVATYTCDQCGAESYQTIQSQTFMPLLMCPSEECKTNRAGGRLYLQTRGSKFVKFQELKIQEHSDQVPVGHIPRSMTIIAKGENTRLATPGDHVSVTGIFLPMMKTGFRQMTQGLLSDTFLEAHRIVRMNKTEDDEMPTDDLSDEEIRA---LSTEADFYDKLASSLAPEIYGHEDIKKALLLLLVGGVDCTPHGMKIRGNINILLMGDPGVAKSQMLSYIDRLAPRSQYTTGRGSTGVGLTAAVMKDPLTGEMILEGGALVLADKGVCCIDEFDKMMDGDRTAIHEVMEQQTVSIAKAGIMTTLNARVSILAAANPAYGRYNPKKSAEQNIQLPAALLSRFDLLWLIQDKPDKENDLRLAQHITYVHQH-----SAHPPSH---------------------YDPLDMNLMRRYIAACKEKQPIVPGELSDY---IVSAYVEMRKDARNNHDTTFTSARTLLAVLRLATALARLRLADVVEKEDVNEAMRLM 637          
BLAST of DNA helicase vs. Ensembl Medaka
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:101173930])

HSP 1 Score: 948.732 bits (2451), Expect = 0.000e+0
Identity = 499/872 (57.22%), Postives = 644/872 (73.85%), Query Frame = 1
Query:  124 PFEDETXXXXXXXXXXXXXXXXXXXXINDNMERDYRHIPELDTYETAGID-DDTDLIELSQSERIRVEEELNKRDRLEAIASGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETIENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKG--NRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            PFEDE+E LLG      EEE EGEELI D MERDYR IPELD YE  G+D DD DL ELS   R   EEE+ +RDR + + SG LRRG+     D   E +      R+     A + + +  E    E+IENLED +G TV +W+  P+ + EI NRF +FLRT +++ G +V+ E+I+ M  EN  SL++NYE L A +  LAYFLPEAP  ML +FD+ A E+ L+ Y +Y +I   IHVR+S+LPLV++IR+LRQ+H++QLIRTSGVVS CT V+PQL++V+YNC +CS  +GPF Q + N E+KP +CP+CQS GPFE+N E+T+Y+NYQRITIQESPG V AGRLPRSKDAILL DLVD CKPGDEI++TG Y   YD +LN    FPVF+T IL N++ ++DE + ++ LTDED + I+ L+KDE + ERI  S+APSIYGHE+IKRA+ALSLFGG PK  G  +++RGDINVLLCGDPGT KSQFLK+VE++A R VFTTGQGASAVGLTAYV ++  ++EWTLEAGALVLAD+GVCLIDEFDKMND DRTSIHEAMEQQSISISKAGIV SLQAR T++AAANPIGGRYD +  F++NVDLT PI+SRFD+LCVVRD VDP+QD MLA+FV+GSH++HH   + +E    ++++     + NT D     + PIP DLLRKYIIYAK+ + P LN+ +++K++ +Y  LRK S   G I +TVR+ ESMIR++EAHAK+HLR  V EDDVNMAIRV+LESFI T+K+S+M+ +   F +YL +++++ ELLLF LKQ+  +++   R     + N  +EI EK   DKA+++NI S+  F +S L R+N F  D  K+ IL Q
Sbjct:   33 PFEDESEGLLGGTPLPGEEEDEGEELIGDGMERDYRAIPELDRYEAEGLDLDDEDLSELSPGARAAAEEEMRRRDREQGV-SGRLRRGL---LYDSEDEDDERPAARRRRLAERAAEGIVDGEEEDMIESIENLEDMKGHTVREWVSMPAPRLEIYNRFKNFLRTHVDENGHNVFKEKISDMCKENKESLVVNYEDLAAREHVLAYFLPEAPAEMLKVFDEAAKEVVLAMYPKYDRIAHEIHVRVSNLPLVEEIRALRQLHLNQLIRTSGVVSCCTGVLPQLSMVKYNCSKCSFVLGPFFQSQ-NQEVKPGSCPECQSQGPFEVNMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNMANGFPVFATVILANHISRRDEGVAVAELTDEDVKAIVALSKDECIGERIFASVAPSIYGHEDIKRALALSLFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDADRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFAENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHP--STKEGGVALEEM----VLPNTTD-----VSPIPQDLLRKYIIYAKERVHPKLNQMDQDKVARIYSDLRKESMATGSIPITVRHIESMIRMAEAHAKMHLRDYVLEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLAFRRDNNELLLFILKQLVAEQVAYQR-NRYGVQNDAVEIPEKDLQDKARQINIHSLSAFYDSDLFRSNKFSHDGKKKLILQQ 887          
BLAST of DNA helicase vs. Ensembl Medaka
Match: mcm6 (minichromosome maintenance complex component 6 [Source:NCBI gene;Acc:101159855])

HSP 1 Score: 340.117 bits (871), Expect = 5.373e-103
Identity = 220/686 (32.07%), Postives = 351/686 (51.17%), Query Frame = 1
Query:  535 GMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTC--PDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYD---------------RALNNKQCFPV---------------FSTHILVNYV-----------LKKDEQL---ILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRK----ASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTE 2436
            G TV D + +   K      F +FL  F   +G+  Y      +      +L++++  L    Q LA  + E    +     +       +R      +    +V I  LP   +IR L  + +  L++ S  V     V P+L    + C+ C   I    Q        P+ C  P C +   F +++ K+ + ++Q++ IQE+   +P G +PRS + +L  + V+  + GD  D TGT  +  D               R    +Q +                 +    L   V           L+ +EQ    I S +T+++   +  +++D+ L+  +  S+ P+I+G++ +KR I L LFGGVPKT  +G  LRGD+NV + GDP T KSQFLK VE+ +PR V+T+G+ ++A GLTA V ++  + E+ +EAGAL+LAD GVC IDEFDKM+ +D+ +IHEAMEQQ+ISI+KAG+ A+L AR++I+AAANP+GGRYD +++   NV+LT+PI+SRFD+  ++ D  + + D  +A+ ++  H R            V + +D+L +                LD +R+Y+++A+Q   P ++K++E  + E Y  LR+     S       +TVR  ESMIRLSEA A++H    V    V  A R+L +S I  E
Sbjct:   12 GTTVKDELAEKCQKL-----FQAFLEEFQTADGEVKYLREGEELIRPERNTLVVSFTDLEGFNQELATTIQEEYYRVYPYLCRAVR--NFARDHGNVPLTKEFYVAIEDLPTRHKIRELSSMRIGTLVKISCQVVRTHPVHPELVSGTFVCMDCQMVIKDVPQQFKYS--PPTICRNPVCSNRSRFHLDTHKSKFIDFQKVRIQETQAELPRGSIPRSLEVVLRAEAVETAQAGDRCDFTGTLIVVPDVSQLSTPGLRAETSSRVGGGRQGYEAEGLRGLKALGVRELSYRLAFLACNVAPTNPRFGGKELRDEEQTAESIKSQMTEKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGILLMLFGGVPKTTMEGTSLRGDVNVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASTAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDIKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVGGRYDRSKSLKQNVNLTAPIMSRFDLFFILVDDCNEVTDYAIARRIVDLHSR------------VEESVDRLYS----------------LDEIRRYLLFARQ-FKPKISKESEEFIVEQYKRLRQRDSTGSVSKSAWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVE 659          
BLAST of DNA helicase vs. Ensembl Medaka
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:101173977])

HSP 1 Score: 332.413 bits (851), Expect = 4.279e-100
Identity = 207/643 (32.19%), Postives = 336/643 (52.26%), Query Frame = 1
Query:  586 KNRFFSFLRTFLN-----------DEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYA----RYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRA-LNNKQCFPVFSTHILVNYVLKKDEQLILSGL---------TDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK-----TKGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESF 2424
            K +F  FL+ F++           D  + +Y +++  +++     L +N  H+ +    L   L   P+ ++  FD   NE+   R+      YQ     I VR  +      +R+L    + QLI   G+V   + ++P++    + C  C+ +    ++ +     +P+ C +C ++    +   ++++ + Q I IQESP  +PAG+ P +      +DLVD  +PGD +++TG Y     R          V+ THI   +  K DE+  L GL         T++  + +  LA    ++ER+  ++APSIY HE+IK+ I L LFGG  K      +GN  R ++N+LLCGDPGT KSQ L++V  L PR  +T+G+G+SAVGLTAYV K+  T++  L+ GALVL+D G+C IDEFDKM+D  R+ +HE MEQQ++SI+KAGI+  L AR+ ++AAANP+  +++  +   +N+ L   +LSRFD++ ++ D  D   D  LA  ++  + +   ++  E        LD                    + +L+ YI YA+  I P L+++    L E Y+ +RK     G +    R  ES+IRL+EAHAK+   + V   DV  A R+  E+ 
Sbjct:  122 KEKFQRFLQRFIDPTSTEDENAGLDLNEPLYMQKLEEISVVGDPVLNVNCRHVQSFDAELYRQLICYPQEVIPTFDMAVNELFFERFPDSVLEYQ-----IQVRPYNALKTKNMRNLNPEDIDQLITLGGMVIRTSQLIPEMQEAFFQCQVCAFSAR--VEVDRGRIAEPAVCRNCNNTHSMTLVHNRSVFSDKQMIKIQESPEDMPAGQTPHTTILYAHNDLVDKVQPGDRVNITGIYRAVPMRVHPRQSNVRSVYKTHIDAIHFRKTDEKR-LHGLDQDGEQKLFTEDRVQTLKELAAKPDVYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRGN-FRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTAVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQSEEQMEEE-------FLD--------------------MAVLKDYIAYARTYISPRLSEEASQALIEAYVDMRKIGSGRGMVSAYPRQLESLIRLAEAHAKVRFSEKVETIDVEEAKRLHREAL 728          
BLAST of DNA helicase vs. Ensembl Medaka
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:101173977])

HSP 1 Score: 331.643 bits (849), Expect = 1.261e-99
Identity = 208/646 (32.20%), Postives = 339/646 (52.48%), Query Frame = 1
Query:  586 KNRFFSFLRTFLN-----------DEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYA----RYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTY----CIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGL---------TDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK-----TKGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESF 2424
            K +F  FL+ F++           D  + +Y +++  +++     L +N  H+ +    L   L   P+ ++  FD   NE+   R+      YQ     I VR  +      +R+L    + QLI   G+V   + ++P++    + C  C+ +    ++ +     +P+ C +C ++    +   ++++ + Q I IQESP  +PAG+ P +      +DLVD  +PGD +++TG Y       + R  N +    V+ THI   +  K DE+  L GL         T++  + +  LA    ++ER+  ++APSIY HE+IK+ I L LFGG  K      +GN  R ++N+LLCGDPGT KSQ L++V  L PR  +T+G+G+SAVGLTAYV K+  T++  L+ GALVL+D G+C IDEFDKM+D  R+ +HE MEQQ++SI+KAGI+  L AR+ ++AAANP+  +++  +   +N+ L   +LSRFD++ ++ D  D   D  LA  ++  + +   ++  E        LD                    + +L+ YI YA+  I P L+++    L E Y+ +RK     G +    R  ES+IRL+EAHAK+   + V   DV  A R+  E+ 
Sbjct:  158 KEKFQRFLQRFIDPTSTEDENAGLDLNEPLYMQKLEEISVVGDPVLNVNCRHVQSFDAELYRQLICYPQEVIPTFDMAVNELFFERFPDSVLEYQ-----IQVRPYNALKTKNMRNLNPEDIDQLITLGGMVIRTSQLIPEMQEAFFQCQVCAFSAR--VEVDRGRIAEPAVCRNCNNTHSMTLVHNRSVFSDKQMIKIQESPEDMPAGQTPHTTILYAHNDLVDKVQPGDRVNITGIYRAVPMRVHPRQSNVRS---VYKTHIDAIHFRKTDEKR-LHGLDQDGEQKLFTEDRVQTLKELAAKPDVYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRGN-FRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTAVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQSEEQMEEE-------FLD--------------------MAVLKDYIAYARTYISPRLSEEASQALIEAYVDMRKIGSGRGMVSAYPRQLESLIRLAEAHAKVRFSEKVETIDVEEAKRLHREAL 764          
BLAST of DNA helicase vs. Ensembl Medaka
Match: mcm3 (minichromosome maintenance complex component 3 [Source:NCBI gene;Acc:101165859])

HSP 1 Score: 324.709 bits (831), Expect = 2.553e-97
Identity = 220/630 (34.92%), Postives = 337/630 (53.49%), Query Frame = 1
Query:  640 VYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQI--RSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCP---DCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQ---CFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKDERL--FERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVI------------GSHMRHHGKL---------TAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGID------VTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVL 2412
            +Y  ++  M  EN   LI+N   L    +A A  L       L  F +   ++  S  A Y + ++   V +        +  R+L    +  ++   G+++ C+ V P++    + C     T+       ++ +  PS+       + + P E     ++YK++Q IT+QE P   PAG+LPRS D IL +DLVD+ KPGD + V GTY     R L  K+       F T I++   +K+  + +    + +D   I N ++   +  F+++  S+APSI+GHE IK+AI   L GGV K    G+R+RGDIN+LL GDP   KSQ L++V   APR + TTG+G+S VGLTA VT +  T E  LEAGA+VLAD+GV  IDEFDKM+D DRT+IHE MEQ  ++I+KAGI A L AR +++AAANP+ GRYD  +   +N+ L   +LSRFD+L +V D +DP QD  ++  V+            G+ M   G +          A ++ E ++  +K   +++ +  +   +  +  + +RKYI  AK  + P L ++  N ++E Y  LR   QE  G D      VT R  E++IRLS AHAK  + + V   D  +A+ ++
Sbjct:   30 IYQSKVRDMINENKARLIVNINDLRRRNEARAAKLMTNAFEELVAFQRALKDLVASVDATYAKQHEEFFVGLEGSFGAKHVSPRTLTSRLLGSMVCVEGIITKCSLVRPKVVRSVHYCPATKKTMERKYTDLTSLDAFPSSASYPTKDEENNPLETEFGLSIYKDHQTITVQEMPEKAPAGQLPRSVDIILDNDLVDMVKPGDRVQVIGTY-----RCLPGKKGGFTSGTFRT-IMIACNVKQMSKEVSPCFSADDAAKIRNFSQTRSINVFDQLARSLAPSIHGHEYIKKAILCMLLGGVEKVLENGSRIRGDINILLIGDPSVAKSQLLRYVLHTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIVLDQMDPEQDREVSDHVLRMHRYRDPREQEGTAMALGGTVDVLTTEDPDAAADEREELQIYEKHNVLLHGSRRKKDKI--LSKEFMRKYIHIAK-AVTPVLTEEAANHIAEEYSRLR--GQEQLGSDMARTSPVTARTLETLIRLSTAHAKSRISKVVERVDSEVAVELV 648          
BLAST of DNA helicase vs. Planmine SMEST
Match: SMESG000052872.1 (SMESG000052872.1)

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 320/320 (100.00%), Postives = 320/320 (100.00%), Query Frame = 1
Query: 1771 MNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            MNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGKSISNSIIEISEKSFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ
Sbjct:    1 MNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGKSISNSIIEISEKSFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 320          
BLAST of DNA helicase vs. Planmine SMEST
Match: SMESG000023403.1 (SMESG000023403.1)

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 320/320 (100.00%), Postives = 320/320 (100.00%), Query Frame = 1
Query: 1771 MNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGXXXXXXXXXXXXXXFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 2730
            MNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGKSISNSIIEISEKSFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ
Sbjct:    1 MNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLENKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGKSISNSIIEISEKSFFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ 320          
BLAST of DNA helicase vs. Planmine SMEST
Match: SMESG000060238.1 (SMESG000060238.1)

HSP 1 Score: 341.273 bits (874), Expect = 6.355e-104
Identity = 215/607 (35.42%), Postives = 329/607 (54.20%), Query Frame = 1
Query:  640 VYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRYARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCS-CTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCF--PVFSTHILVNYVLKKDEQLI---LSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGG-VPKTK----GNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGG-IDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESF 2424
            +Y +++  M+L     + I+  HL    ++L   L   PK ++   D VA+ +  S Y  + +    I  R  +  +   +R+L    + QL+  +G+V   + ++P++    + C  C+  T  P  +G     I P  C  CQ+    +I      + + Q + +QESP  +PAG  P +       DLVD  +PGD + VTG Y     R  N+KQ     VF T++ V +  K   +LI    + L+ E    I  L++   L+ER+  +IAP+IYG+E IK+ + + LFGG V +TK    G  +R +I+VLLCGDPGT KSQ L++V  L PR  +T+G+G+S VGLTAY+TK+  T   TL++GAL L+D G+C IDEFDKM D  R+ +HE MEQQS+SI+KAGI+  L AR++++AAANPIG  +D  +   +N+ L   +LSRFD++ ++ D  D   D  LA+ ++G +  H+                          +E GT   +   +LR YI YAK+ I P L+++ EN ++E Y+ +RK      G I    R  ES+IRL+EAHA++ L   V   D   A R+  E+ 
Sbjct:  107 LYIQKMKEMSLLRRAWMNIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHE---PILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRI---IDPEFCNQCQAKHTQQIVHNCCEFIDKQMVKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRE-NSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHN------------------------KTTEPGT---VDTAMLRDYIAYAKENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREAL 679          
BLAST of DNA helicase vs. Planmine SMEST
Match: SMESG000005389.1 (SMESG000005389.1)

HSP 1 Score: 310.457 bits (794), Expect = 7.041e-93
Identity = 216/645 (33.49%), Postives = 334/645 (51.78%), Query Frame = 1
Query:  604 FLRTFLNDEGKSVYAERIAAMALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLS-RYARYQQIN-DSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRC-----SCTIGPFIQGESNDEIKPSTCPDCQSSG--------------PFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGL-----TDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPK--TKGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQE-------NGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFIST 2433
            FL+++ + +   VY + +          L + ++HL      LA  L E P   L IF+ V NE+     Y R +  N  SI + +        +R ++   + +LI+ SGVV S + +  +   +   C  C     S ++ P + G     + P  C    SS               P+ I  +K    ++Q + +QE+P  VP G +PR     +   L +   PG+ + V G   I    ++N  +   V  ++I V  V  ++     SG+     TD++ +     +    + E I  SIAP IYG+ +IK+AIA  LFGG  K   +G  LRGDIN+++ GDPGT KSQ LKFVEQ AP  V+T+G+G+SA GLTA V ++  T+ + +E GA+VLAD GV  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI   L +R +++AAAN + G +D T+   +N+D    I+SRFD++ VV+DV D  +D  + + V+  HM   G   A + +E +  LD L A       E G +   P+  L+KYI + +    P L  +    ++  Y+S+R  + E       N  I +T+R  E+++R++E+ AK+ L     E D   AIR+   S +S+
Sbjct:   35 FLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGY----VLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPK-DGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHM---GDGQAADVNENI-SLDSLTA-------ETGIM---PVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSS 659          
BLAST of DNA helicase vs. Planmine SMEST
Match: SMESG000038798.1 (SMESG000038798.1)

HSP 1 Score: 303.523 bits (776), Expect = 6.410e-90
Identity = 189/579 (32.64%), Postives = 302/579 (52.16%), Query Frame = 1
Query:  862 LPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQLNVVQYNCIRCSCTIGPFIQGESNDEI--KPSTC--PDCQSSGPFEINSEKTLYKNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCIFYD---------RALNNKQC------------------------FPVFSTHI-LVNYVLKKDEQL----------ILSGLTDEDTRNILNLAKDERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKT--KGNRLRGDINVLLCGDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLEAGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQARSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQDGMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPIPLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRK---ASQENGGIDVTVRYFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEK 2439
             P +  +R+LR  ++ +L++  G V     V P+L +  + C  C    G  ++      I  KP+ C  P C +   FE+  E++ Y ++Q++ +QE+   +P G +PR  D IL ++ V+  +PGD+ + TG+  I  D         R L  KQ                             + H+  VN    + E +          ++  LT+++   +L + +D  L + +   + P+ YG++ +KR + L LFGGVPK   +G +LRGDIN+ + GDP T KSQFLK +   +PR V+T+G+ +SA GLTA V ++  + E+ +EAGAL+LA+ GVC IDEFDKM  +D+ +IHEAMEQQ+IS++KAGI A+L A+++++AAANP+GGRYD +R+   N+ L++PI+SRFD+  V+ D      D  +AK +  S                              D E    +    D +++YI +A+    P + ++    +   Y  +R+   AS       +TVR  ES++RLSEA A++     V E DV  A R+L +S I  E+
Sbjct:  113 FPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDC----GTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQ--------------------------RPVDPEKSDTRIYNEDDIQRYITFAR-CFEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIRVEQ 660          
The following BLAST results are available for this feature:
BLAST of DNA helicase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MCM20.000e+056.03minichromosome maintenance complex component 2 [So... [more]
MCM22.224e-17059.31minichromosome maintenance complex component 2 [So... [more]
MCM49.586e-10734.06minichromosome maintenance complex component 4 [So... [more]
MCM42.165e-10634.06minichromosome maintenance complex component 4 [So... [more]
MCM42.165e-10634.06minichromosome maintenance complex component 4 [So... [more]
back to top
BLAST of DNA helicase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm-20.000e+049.82DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6][more]
mcm-20.000e+049.82DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6][more]
mcm-41.173e-10735.70DNA replication licensing factor mcm-4 [Source:Un... [more]
mcm-41.173e-10735.70DNA replication licensing factor mcm-4 [Source:Un... [more]
mcm-54.505e-9530.75DNA replication licensing factor mcm-5 [Source:Un... [more]
back to top
BLAST of DNA helicase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcm20.000e+052.41gene:FBgn0014861 transcript:FBtr0081827[more]
dpa5.012e-10134.68gene:FBgn0015929 transcript:FBtr0345797[more]
dpa5.012e-10134.68gene:FBgn0015929 transcript:FBtr0088982[more]
Mcm52.923e-9734.47gene:FBgn0017577 transcript:FBtr0082279[more]
Mcm32.953e-9735.99gene:FBgn0284442 transcript:FBtr0340476[more]
back to top
BLAST of DNA helicase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm20.000e+056.45minichromosome maintenance complex component 2 [So... [more]
mcm47.580e-10032.92minichromosome maintenance complex component 4 [So... [more]
mcm68.558e-10032.19minichromosome maintenance complex component 6 [So... [more]
mcm6l6.548e-9832.23MCM6 minichromosome maintenance deficient 6, like ... [more]
mcm6l8.290e-9832.23MCM6 minichromosome maintenance deficient 6, like ... [more]
back to top
BLAST of DNA helicase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adat30.000e+056.09adenosine deaminase, tRNA-specific 3 [Source:Xenba... [more]
adat30.000e+056.09adenosine deaminase, tRNA-specific 3 [Source:Xenba... [more]
adat30.000e+056.09adenosine deaminase, tRNA-specific 3 [Source:Xenba... [more]
mcm43.076e-10433.54minichromosome maintenance complex component 4 [So... [more]
mcm43.285e-10433.75minichromosome maintenance complex component 4 [So... [more]
back to top
BLAST of DNA helicase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcm20.000e+055.67minichromosome maintenance complex component 2 [So... [more]
Mcm42.512e-10333.44minichromosome maintenance complex component 4 [So... [more]
Mcm61.553e-9831.06minichromosome maintenance complex component 6 [So... [more]
Mcm63.101e-9831.06minichromosome maintenance complex component 6 [So... [more]
Mcm81.646e-9035.27minichromosome maintenance 8 homologous recombinat... [more]
back to top
BLAST of DNA helicase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P55861|MCM2_XENLA0.000e+055.86DNA replication licensing factor mcm2 OS=Xenopus l... [more]
sp|P49736|MCM2_HUMAN0.000e+056.03DNA replication licensing factor MCM2 OS=Homo sapi... [more]
sp|Q6DIH3|MCM2_XENTR0.000e+055.98DNA replication licensing factor mcm2 OS=Xenopus t... [more]
sp|P97310|MCM2_MOUSE0.000e+055.67DNA replication licensing factor MCM2 OS=Mus muscu... [more]
sp|P49735|MCM2_DROME0.000e+052.41DNA replication licensing factor Mcm2 OS=Drosophil... [more]
back to top
BLAST of DNA helicase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q9BI220.000e+077.43DNA helicase (Fragment) OS=Dugesia japonica OX=616... [more]
A0A0X3NPY10.000e+058.93DNA helicase OS=Schistocephalus solidus OX=70667 G... [more]
A0A183T5Q60.000e+058.07DNA helicase OS=Schistocephalus solidus OX=70667 G... [more]
A0A0R3U8Y30.000e+059.66DNA helicase OS=Mesocestoides corti OX=53468 GN=MC... [more]
A0A0R3T6260.000e+057.72DNA helicase OS=Rodentolepis nana OX=102285 GN=HNA... [more]
back to top
BLAST of DNA helicase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm20.000e+056.09minichromosome maintenance complex component 2 [So... [more]
mcm20.000e+056.09minichromosome maintenance complex component 2 [So... [more]
mcm20.000e+057.67minichromosome maintenance complex component 2 [So... [more]
mcm47.470e-10332.60minichromosome maintenance complex component 4 [So... [more]
mcm61.676e-10231.90minichromosome maintenance complex component 6 [So... [more]
back to top
BLAST of DNA helicase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm25.519e-9048.20minichromosome maintenance complex component 2 [So... [more]
mcm81.126e-8432.61minichromosome maintenance 8 homologous recombinat... [more]
ENSPMAT00000008164.12.057e-8241.41pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:... [more]
mcm55.325e-7834.45minichromosome maintenance complex component 5 [So... [more]
ENSPMAT00000006035.14.554e-7329.79pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 g... [more]
back to top
BLAST of DNA helicase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MCM20.000e+046.00Protein involved in DNA replication; component of ... [more]
MCM45.886e-10938.86Essential helicase component of heterohexameric MC... [more]
MCM53.523e-9532.42Component of the Mcm2-7 hexameric helicase complex... [more]
MCM62.414e-9432.73Protein involved in DNA replication; component of ... [more]
MCM33.957e-9336.67Protein involved in DNA replication; component of ... [more]
back to top
BLAST of DNA helicase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO350600.000e+055.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339715.723e-10134.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344254.909e-9939.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424463.766e-9135.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379461.077e-8931.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA helicase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm20.000e+057.22minichromosome maintenance complex component 2 [So... [more]
mcm65.373e-10332.07minichromosome maintenance complex component 6 [So... [more]
mcm44.279e-10032.19minichromosome maintenance complex component 4 [So... [more]
mcm41.261e-9932.20minichromosome maintenance complex component 4 [So... [more]
mcm32.553e-9734.92minichromosome maintenance complex component 3 [So... [more]
back to top
BLAST of DNA helicase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052872.10.000e+0100.00SMESG000052872.1[more]
SMESG000023403.10.000e+0100.00SMESG000023403.1[more]
SMESG000060238.16.355e-10435.42SMESG000060238.1[more]
SMESG000005389.17.041e-9333.49SMESG000005389.1[more]
SMESG000038798.16.410e-9032.64SMESG000038798.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006979 ID=SMED30006979|Name=DNA helicase|organism=Schmidtea mediterranea sexual|type=transcript|length=2780bp
TGAAACTGTGTTTTCGTTTTAATATATATATTTTTTAAATCCTACTTTGA
AAACTTAATTAAGATGACCAGCCAAAATAATAGAAATCGATTGGTAAGTA
TTGAAGCTTCTGATGATGAAATTCCTTTTGAAGATGAGACTGAATTACTT
CTCGGGGCCGAAGATGACGAAAATGAAGAAGAAGTTGAAGGCGAAGAACT
TATAAATGACAATATGGAAAGAGATTACAGACATATTCCTGAACTTGATA
CTTACGAAACAGCTGGTATTGATGATGATACTGATTTGATTGAATTGTCA
CAAAGTGAACGAATTCGTGTGGAAGAAGAATTAAATAAACGAGACAGGCT
AGAAGCAATCGCTTCTGGTAATTTAAGAAGAGGGATGCATGATATATTTG
AAGATGAAAGTAGTGAAGCTGAAGCTTCTTATAGGCGACATAGAAAAGCA
GATAAAATAGCTGCCTATGATTCTGTTGGAGAAAATTTCGAATCCCAATC
TTACGAAACTATTGAGAATCTTGAAGATACGAGAGGCATGACTGTTGCTG
ATTGGATTCAACAACCATCCACTAAACAAGAAATTAAAAATAGATTTTTC
TCATTTCTGAGAACTTTTTTAAATGATGAAGGAAAATCAGTTTATGCTGA
ACGAATTGCAGCGATGGCACTTGAAAATGGACGAAGTTTAATCATTAATT
ATGAGCACCTAGTAGCTGCTCAACAAGCGTTAGCATATTTCTTGCCAGAA
GCTCCAAAAGGAATGCTTGATATATTTGACAAAGTTGCCAATGAAATTAC
ATTATCCAGATATGCTCGTTATCAACAAATAAATGACTCGATTCACGTGA
GAATAAGTCACTTACCCCTGGTTGATCAAATTCGGTCTCTACGACAAGTT
CACGTCCATCAATTAATTCGTACATCAGGAGTTGTGTCTAGTTGTACGAA
TGTAATGCCGCAATTAAATGTAGTGCAATACAATTGCATAAGATGCTCGT
GTACAATTGGTCCATTTATACAAGGTGAATCGAATGATGAAATAAAGCCG
TCAACTTGTCCAGACTGTCAATCCAGTGGGCCATTCGAAATCAATAGTGA
GAAAACATTATATAAAAATTATCAACGAATTACAATTCAAGAGAGTCCCG
GTACTGTTCCGGCTGGAAGGTTACCAAGAAGCAAGGATGCCATACTATTG
GATGATTTGGTGGATATTTGCAAGCCTGGAGATGAAATTGATGTTACTGG
TACATATTGCATCTTTTATGACCGGGCTTTAAACAATAAGCAATGCTTCC
CTGTGTTCTCCACACATATTCTTGTTAATTATGTATTGAAAAAGGACGAG
CAATTGATTCTAAGTGGATTGACTGATGAAGACACCAGAAATATTCTAAA
TCTTGCAAAAGACGAGAGGTTATTTGAACGAATTGTCTGTAGCATTGCTC
CAAGCATATATGGGCATGAAAATATCAAAAGAGCAATAGCACTATCTCTT
TTTGGAGGCGTGCCAAAAACAAAAGGAAATCGACTGAGAGGTGATATAAA
TGTGTTGCTGTGTGGAGATCCTGGAACAGGCAAGTCGCAATTTTTAAAAT
TCGTCGAACAGTTAGCGCCTAGATGCGTGTTCACAACAGGACAAGGTGCC
AGTGCTGTCGGTTTAACTGCATATGTAACCAAGAATTTCACCACTAAGGA
GTGGACTCTTGAAGCGGGAGCACTAGTGTTAGCTGATAAAGGCGTGTGTT
TGATTGATGAATTTGATAAGATGAATGATCAAGATCGAACATCAATTCAT
GAGGCTATGGAGCAGCAGAGTATTTCGATTAGTAAAGCTGGCATAGTAGC
AAGTCTTCAAGCTCGATCGACCATTATAGCAGCTGCCAATCCGATTGGTG
GTCGATATGATACAACCCGAAATTTCTCCGATAACGTCGACTTGACAAGT
CCAATTTTGTCACGATTTGATATTTTGTGTGTTGTCCGAGATGTTGTTGA
TCCAATACAAGATGGCATGCTAGCCAAATTTGTGATCGGCAGTCATATGC
GGCATCACGGTAAATTAACTGCTGAAGAAAAATCAGAAGTTGTGAAGAAA
CTTGATAAACTTGGTGCTATGGTCAATACAGCGGACAGTGAAGCAGGAAC
TCTTCAACCGATTCCATTGGATCTATTGCGAAAATATATCATTTACGCCA
AGCAAACTATATTTCCAAGTCTGAATAAAGACAACGAAAATAAATTGTCT
GAGGTTTATTTGAGTTTAAGAAAAGCATCTCAAGAAAATGGCGGTATCGA
TGTGACGGTGCGTTATTTCGAGTCAATGATACGCTTATCGGAAGCTCATG
CTAAATTGCATCTACGTCAAACTGTTAATGAAGACGATGTGAATATGGCC
ATACGAGTATTGCTGGAGTCATTTATCTCAACGGAAAAATATAGTTTAAT
GAAGCACTTGGAAAACAAATTCCGGCAATATTTAAATTACAAAAAGAATG
ATTACGAATTACTGCTTTTCACGTTGAAACAAATGTTCCATGACAAATTG
ACTGAAATGAGAGCTGGGGGAAAATCAATTAGTAATTCTATTATAGAAAT
TTCGGAAAAATCATTTTTTGACAAGGCTAAAAGAATGAATATAACTTCGG
TTAAAGGATTTTTAAATTCATCGTTATTGCGAACTAACAATTTCTATTTC
GATGCTGGCAAACGAGCAATTTTGCATCAGTAATAGATTATTAAGAGATT
ATTTAGATGTGCATTTATAGATGTAATTAT
back to top

protein sequence of SMED30006979-orf-1

>SMED30006979-orf-1 ID=SMED30006979-orf-1|Name=SMED30006979-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=890bp
MTSQNNRNRLVSIEASDDEIPFEDETELLLGAEDDENEEEVEGEELINDN
MERDYRHIPELDTYETAGIDDDTDLIELSQSERIRVEEELNKRDRLEAIA
SGNLRRGMHDIFEDESSEAEASYRRHRKADKIAAYDSVGENFESQSYETI
ENLEDTRGMTVADWIQQPSTKQEIKNRFFSFLRTFLNDEGKSVYAERIAA
MALENGRSLIINYEHLVAAQQALAYFLPEAPKGMLDIFDKVANEITLSRY
ARYQQINDSIHVRISHLPLVDQIRSLRQVHVHQLIRTSGVVSSCTNVMPQ
LNVVQYNCIRCSCTIGPFIQGESNDEIKPSTCPDCQSSGPFEINSEKTLY
KNYQRITIQESPGTVPAGRLPRSKDAILLDDLVDICKPGDEIDVTGTYCI
FYDRALNNKQCFPVFSTHILVNYVLKKDEQLILSGLTDEDTRNILNLAKD
ERLFERIVCSIAPSIYGHENIKRAIALSLFGGVPKTKGNRLRGDINVLLC
GDPGTGKSQFLKFVEQLAPRCVFTTGQGASAVGLTAYVTKNFTTKEWTLE
AGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVASLQA
RSTIIAAANPIGGRYDTTRNFSDNVDLTSPILSRFDILCVVRDVVDPIQD
GMLAKFVIGSHMRHHGKLTAEEKSEVVKKLDKLGAMVNTADSEAGTLQPI
PLDLLRKYIIYAKQTIFPSLNKDNENKLSEVYLSLRKASQENGGIDVTVR
YFESMIRLSEAHAKLHLRQTVNEDDVNMAIRVLLESFISTEKYSLMKHLE
NKFRQYLNYKKNDYELLLFTLKQMFHDKLTEMRAGGKSISNSIIEISEKS
FFDKAKRMNITSVKGFLNSSLLRTNNFYFDAGKRAILHQ*
back to top
Aliases
The feature 'DNA helicase' has the following synonyms
Synonym
mcm2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1905775negative regulation of DNA helicase activity
GO:0006270DNA replication initiation
GO:0006260DNA replication
GO:0032508DNA duplex unwinding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR033762MCM_OB
IPR041562MCM_lid
IPR008045MCM2
IPR001208MCM_dom
IPR003593AAA+_ATPase
IPR031327MCM
IPR027925MCM_N
IPR012340NA-bd_OB-fold
IPR027417P-loop_NTPase
IPR018525MCM_CS
Vocabulary: molecular function
TermDefinition
GO:0003678DNA helicase activity
GO:0005524ATP binding
GO:0003677DNA binding
GO:0000166nucleotide binding
GO:0004386helicase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0042555MCM complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001208MCM domainPRINTSPR01657MCMFAMILYcoord: 580..593
score: 78.49
coord: 552..566
score: 77.63
coord: 492..507
score: 72.51
coord: 604..616
score: 67.91
coord: 631..639
score: 64.87
IPR001208MCM domainPFAMPF00493MCMcoord: 441..661
e-value: 6.9E-97
score: 322.9
IPR001208MCM domainPROSITEPS50051MCM_2coord: 453..657
score: 89.956
IPR008045DNA replication licensing factor Mcm2PRINTSPR01658MCMPROTEIN2coord: 417..428
score: 50.0
coord: 282..299
score: 57.54
coord: 305..317
score: 40.66
coord: 341..355
score: 64.29
coord: 402..413
score: 52.98
IPR008045DNA replication licensing factor Mcm2PFAMPF12619MCM2_Ncoord: 33..151
e-value: 8.6E-16
score: 58.6
IPR008045DNA replication licensing factor Mcm2PANTHERPTHR11630:SF44DNA REPLICATION LICENSING FACTOR MCM2coord: 32..888
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 493..645
e-value: 3.0E-4
score: 30.1
IPR031327Mini-chromosome maintenance proteinSMARTSM00350mcmcoord: 269..788
e-value: 4.3E-270
score: 913.2
IPR031327Mini-chromosome maintenance proteinPANTHERPTHR11630DNA REPLICATION LICENSING FACTORcoord: 32..888
IPR033762MCM OB domainPFAMPF17207MCM_OBcoord: 272..401
e-value: 4.8E-37
score: 126.6
IPR027925MCM N-terminal domainPFAMPF14551MCM_Ncoord: 175..263
e-value: 4.0E-14
score: 53.1
NoneNo IPR availableGENE3DG3DSA:3.30.1640.10coord: 168..269
e-value: 4.5E-31
score: 108.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 437..792
e-value: 4.4E-132
score: 442.3
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 276..424
e-value: 1.9E-40
score: 139.8
NoneNo IPR availableGENE3DG3DSA:2.20.28.10coord: 300..351
e-value: 1.9E-40
score: 139.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 30..47
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 30..53
NoneNo IPR availableCDDcd17753MCM2coord: 456..786
e-value: 0.0
score: 571.699
IPR041562MCM, AAA-lid domainPFAMPF17855MCM_lidcoord: 703..787
e-value: 3.0E-27
score: 94.9
IPR018525Mini-chromosome maintenance, conserved sitePROSITEPS00847MCM_1coord: 560..568
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 463..799
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 177..422