Telomerase protein component 1

Overview
NameTelomerase protein component 1
Smed IDSMED30006963
Length (bp)3870
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Telomerase protein component 1 (SMED30006963) t-SNE clustered cells

Violin plots show distribution of expression levels for Telomerase protein component 1 (SMED30006963) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Telomerase protein component 1 (SMED30006963) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Telomerase protein component 1 (SMED30006963) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006963

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30006963h1SMcG0016425 SmedASXL_016853SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30006963h1SMcG0004574 Contig55269newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006963h1SMcG0004574 Contig55269uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006963h1SMcG0016425 Contig55269newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006963h1SMcG0016425 Contig55269uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Telomerase protein component 1 vs. TrEMBL
Match: K1QBE1 (Telomerase protein component 1 OS=Crassostrea gigas OX=29159 GN=CGI_10009375 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 4.632e-23
Identity = 81/280 (28.93%), Postives = 126/280 (45.00%), Query Frame = 1
Query: 2248 LARTSMQVGQYTVAKEMARSLLKQLDYLATERSFCPPLDSNRNLLASCLHLLFCTLDERLKTFEFVTEQTTPIFRRTVHYGARALLLQHEIVTHIQRAIDNKDNHAIGDVRHVVISKLQQQLCHAEIRLAHIMTHFVFSLDGVEQTVINRHFVQSEIRSVTYACMSRAHEIATRLKDRQLLLEIQMTFGVIQPRENFKEKILLYKTPLRQALCIYGEGHIFVSRLYINIGISYEEQKKYIKAFEYFTLWSHVTHELLGRNHCKSLRSCGVFKEPIFKLTA 3087
            + R  +Q G+Y  A E+ ++ LK       E+     L +  + +     L+    DE+LK  +FV+    P  R T+HYG +++ L+  +  +  +                              +L        F+++  E           E  +V    + +A EI   L D     E QMT GV+ PR +  E++ LY T     + +YGE HI  SRLYINIGI YE+   Y KA+EYF  W+ V+ E+LG +H K+ R+ GV +E  +K  A
Sbjct:  747 VCRVVIQAGKYQEALELLKTALK-----IEEKE----LGARPHRMVELYALMAEIYDEKLKLNDFVSPSQIPDLRMTIHYGKKSIALRKTLPGNYHK-----------------------------FKLGMSFMKLAFNMESWEACGGGTELSGEEALAVGNKYIDKALEIFEELNDMGHYAEAQMTKGVLAPRGSM-EQLKLYNTAKDLCMQMYGEYHILTSRLYINIGIVYEDNNDYKKAYEYFKKWARVSEEILGPDHPKTQRAKGVLRETRYKRIA 987          
BLAST of Telomerase protein component 1 vs. TrEMBL
Match: A0A2C9LUZ9 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106064807 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 6.406e-20
Identity = 71/280 (25.36%), Postives = 131/280 (46.79%), Query Frame = 1
Query: 2248 LARTSMQVGQYTVAKEMARSLLKQLDYLATERSFCPPLDSNRNLLASCLHLLFCTLDERLKTFEFVTEQTTPIFRRTVHYGARALLLQHEIVTHIQRAIDNKDNHAIGDVRHVVISKLQQQLCHAEIRLAHIMTHFVFSLDGVEQTVINRHFVQSEIRSVTYACMSRAHEIATRLKDRQLLLEIQMTFGVIQPRENFKEKILLYKTPLRQALCIYGEGHIFVSRLYINIGISYEEQKKYIKAFEYFTLWSHVTHELLGRNHCKSLRSCGVFKEPIFKLTA 3087
            + R ++Q G++  A E+ ++ +K       E+     LD+  + +     L+    DE+LK  +FV+    P  R+T+HY  +++        HI++++                        + + +L   +    F++   +           +  +     + RA +I   L D     E  MT GV+ PR +  E++ LY   +   + +YGE HI  SRLYINIGI YE+ K Y ++++YF  W+ ++ E++G +H K+LR+ GV +E  ++  A
Sbjct:  749 VCRVTIQAGKHQDALELLKTAMK-----IEEKE----LDARPHRMVELYALMSEIYDEKLKLNDFVSRSQLPDLRKTIHYAKKSI--------HIRKSLPG---------------------SYHKFKLGMSLMRLAFNMKSWDACGGGSELTGPDAVTEGNKYIDRALKIFMELNDMGHYAEALMTKGVLAPRGSM-EQLKLYNQAMELCMQMYGELHILTSRLYINIGIVYEDNKDYKRSYQYFKKWARLSEEIMGPDHPKTLRAKGVLRESRYRRIA 989          
BLAST of Telomerase protein component 1 vs. TrEMBL
Match: A0A210PJH8 (Telomerase protein component 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT03052 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 2.564e-18
Identity = 73/280 (26.07%), Postives = 125/280 (44.64%), Query Frame = 1
Query: 2248 LARTSMQVGQYTVAKEMARSLLKQLDYLATERSFCPPLDSNRNLLASCLHLLFCTLDERLKTFEFVTEQTTPIFRRTVHYGARALLLQHEIVTHIQRAIDNKDNHAIGDVRHVVISKLQQQLCHAEIRLAHIMTHFVFSLDGVEQTVINRHFVQSEIRSVTYACMSRAHEIATRLKDRQLLLEIQMTFGVIQPRENFKEKILLYKTPLRQALCIYGEGHIFVSRLYINIGISYEEQKKYIKAFEYFTLWSHVTHELLGRNHCKSLRSCGVFKEPIFKLTA 3087
            + R  +Q G+Y  A E+ R+ +K       E+     L +  + +     L+    DE+LK  +FV+    P  R+T+HYG +++ L+ ++                                + + +L   +    F+++  E              +     + +A +I   L D     E  MT GV+  R +  E++ LY   +   + +YGE HI  SRLYINIGI YE+   + KA+EYF  W+ V+ E+LG +H K+ R+ GV +E  ++  A
Sbjct:  747 VCRVVIQAGKYLEALELLRTAMK-----IEEKE----LGARPHRMVELYALMAEIYDEKLKLNDFVSPSQLPDLRKTIHYGRKSIALRKKLPG-----------------------------TYHKFKLGMSLMKLAFNMESWEACGGGPELTGEAALAEGNKYIDKALKIFEELNDMGHYAEALMTKGVLARRGSM-EQLKLYNEAMDLCMQMYGEYHILTSRLYINIGIVYEDNNDFKKAYEYFKKWARVSEEILGPDHPKTQRAKGVLRESRYQRIA 987          
BLAST of Telomerase protein component 1 vs. TrEMBL
Match: A0A0L8GC92 (TPR_REGION domain-containing protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22036690mg PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 2.766e-18
Identity = 65/224 (29.02%), Postives = 105/224 (46.88%), Query Frame = 1
Query: 2419 ERLKTFEFVTEQTTPIFRRTVHYGARALLLQHEIVTHIQRAIDNKDNHAIGDVRHVVISKLQQQLCHAEIRLAHIMTHFVFSLDGVEQTVINRHFVQSEIRSVTYACMSRAHEIATRLKDRQLLLEIQMTFGVIQPRENFKEKILLYKTPLRQALCIYGEGHIFVSRLYINIGISYEEQKKYIKAFEYFTLWSHVTHELLGRNHCKSLRSCGVFKEPIFKLTAE 3090
            E+LK  +FV+    P  R+ + YG +A+ L+ ++     +                              +L   +    F+++  E    +     SE  +    C+  A +I   L D     E  MT GV+  R +  E++ LY   +   + +YGE HI  SRLYINIGI YE+ K+Y KA+EYF  W+ V+ E+LG +H K+ R+ GV +E  ++  A+
Sbjct:  571 EKLKLNDFVSPSQLPDLRKAISYGKKAIALRKKLSGRYHK-----------------------------FKLGMSLMKLAFNMESWEACGGSTEMPGSEALAEGNRCIDVAIKIFQELNDIGHYAEALMTKGVLATRGSM-EQLKLYNQAMDLCMQMYGEYHILTSRLYINIGIVYEDNKEYRKAYEYFKKWARVSEEILGPDHPKTRRAKGVLQETRYRRIAQ 764          
BLAST of Telomerase protein component 1 vs. TrEMBL
Match: A0A2T7NQU6 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_16817 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 5.010e-18
Identity = 73/281 (25.98%), Postives = 124/281 (44.13%), Query Frame = 1
Query: 2248 LARTSMQVGQYTVAKEMARSLLKQLDYLATERSFCPPLDSNRNLLASCLHLLFCTLDERLKTFEFVTEQTTPIFRRTVHYGARALLLQHEIVTHIQRAIDNKDNHAIGDVRHVVISKLQQQLCHAEIRLAHIMTHFVFSLDGVEQTVINRHFVQSEIRSVTYACMSRAHEIATRLKDRQLLLEIQMTFGVIQPRENFKEKILLYKTPLRQALCIYGEGHIFVSRLYINIGISYEEQKKYIKAFEYFTLWSHVTHELLGRNHCKSLRSCGVFKEPIFKLTAE 3090
            + R  +Q G++  A E+ ++ +K       E+     L +  + +     L+    DE+LK  +FV+    P  R+T++YG +++ ++  +  +  R                              +LA  +    F+++  E                    + RA +I   L D     E  MT GV+ PR +  E++ LY   +   + +YGE HI  SRLYINIGI YE+   Y KA+ YF  W+ V+ E+LG  H K+ R+ GV +E  ++  A+
Sbjct: 1021 VCRVVIQAGKHYEALELLKTAMK-----IEEKE----LGARPHRMVELYALMSEIYDEKLKLNDFVSPSQLPDLRKTIYYGRKSIAIRKTLPGNYHR-----------------------------FKLAMSLMKLAFNMESWEACGGGPELTGEAAIVEGNKYIDRALKIFMELNDMGHYAEALMTKGVLAPRGSM-EQLKLYNQAMELCMQMYGEYHILTSRLYINIGIVYEDNNDYRKAYAYFKRWARVSEEILGPEHPKTQRAKGVLRESRYRRIAQ 1262          
BLAST of Telomerase protein component 1 vs. Planmine SMEST
Match: SMESG000049038.1 (SMESG000049038.1)

HSP 1 Score: 2325.05 bits (6024), Expect = 0.000e+0
Identity = 1201/1207 (99.50%), Postives = 1201/1207 (99.50%), Query Frame = 1
Query:   43 MDKCHVIIVDTIXXXXXXXXXXXXILNEVLISNSHFLINEGNYLSKHIEFFDLDMKCDKMAIEKALMKDHLFXXXXXXXXXXXPDKEAKEGFVKKIQNHIQNSLSFRYYNLLKHAFISRNRNALFLLVDDDNESEFLVTVDNNDKFDDYNCVNRNFCEVNWMGLTSVILNDQKIGISPGQSYERKMQIWLLTKLIALDGNLAFYSMPILAKLISLYSGIVQMRLSSFDSCESALTERYGTAVAGKLAETVRNRCAHVPSVPIFIHGDKSVDWNVIRKCVHELFSSSSTFIGHYKSRLHPICQDVNFLLVSLLKYFKAYPKDNELPFTSPQMATLVSECLMSEASVQTGKFLVIFIEDIDWVLSPSLTNNACSWLPEKCAHNIQVIVTAAKDSVHEKCLKCRLNPPKFIDVSHQESWIRNTGNEIVCPCQQSWCLSKLFCLPIKLRDLISDWHNDNVKLYMTELLSIFTCSVVCGLTRSQIDWLFSFGISQSHKDKYIDFDEKDEWESSEKLQLNSSQEGRLXXXXXXXXXXXXXXXXXXDIGIIQQINLNHCDEPCYSLTAPQLNQYLXXXXXXXXXXXXXXXXXXXXAAVQITKCRLGAYYVYQATDLHSEMLFVPSLLQYLPMAAGMNDTALQDWLLDWPVFMKLKDEFCVPVKLLSLWRAVLGPTTDYTPMINAYISAHLPDKRDLGDCSSCRRSFNTPLQPAAPINLAVLRQSSSEFPKSYCKHRYRVLLDLARTSMQVGQYTVAKEMARSLLKQLDYLATERSFCPPLDSNRNLLASCLHLLFCTLDERLKTFEFVTEQTTPIFRRTVHYGARALLLQHEIVTHIQRAIDNKDNHAIGDVRHVVISKLQQQLCHAEIRLAHIMTHFVFSLDGVEQTVINRHFVQSEIRSVTYACMSRAHEIATRLKDRQLLLEIQMTFGVIQPRENFKEKILLYKTPLRQALCIYGEGHIFVSRLYINIGISYEEQKKYIKAFEYFTLWSHVTHELLGRNHCKSLRSCGVFKEPIFKLTAEFXXXXXXXXXXXXXXXXXSDCINNIDSDNQDHLHGTVMSVAGVGILPASIMHQQTSDNISYENMFMMRSTLEHESDWEIHSSDDETPNYTNAFEEVIGKFKKRPYHAIAKELLQSILSNPLIDSNDLSKDDIESLIQSQDVPNEIDANSGMESTATDSSNSEAFRITRMFRDLRELAQWIPTTNLSPSDIS 3663
            MDKCHVIIVDTINSKKFNSKNVKNILNEVLISNSHFLINEGNYLSKHIEFFDLDMKCDKMAIEKALMKDHLFINIISTSTISSPDKEAKEGFVKKIQNHIQNSLSFRYYNLLKHAFISRNRNALFLLVDDDNESEFLVTVDNNDKFDDYNCVNRNFCEVNWMGLTSVILNDQKIGISPGQSYERKMQIWLLTKLIALDGNLAFYSMPILAKLISLYSGIVQMRLSSFDSCESALTERYGTAVAGKLAETVRNRCAHVPSVPIFIHGDKSVDWNVIRKCVHELFSSSSTFIGHYKSRLHPICQDVNFLLVSLLKYFKAYPKDNELPFTSPQMATLVSECLMSEASVQTGKFLVIFIEDIDWVLSPSLTNNACSWLPEKCAHNIQVIVTAAKDSVHEKCLKCRLNPPKFIDVSHQESWIRNTGNEIVCPCQQSWCLSKLFCLPIKLRDLISDWHNDNVKLYMTELLSIFTCSVVCGLTRSQIDWLFSFGISQSHKDKYIDFDEKDEWESSEKLQLNSSQEGRLPLPASEAIIISAAINELIDIGIIQQINLNHCDEPCYSLTAPQLNQYL      HQHQHQHQHQHQHQAAVQITKCRLGAYYVYQATDLHSEMLFVPSLLQYLPMAAGMNDTALQDWLLDWPVFMKLKDEFCVPVKLLSLWRAVLGPTTDYTPMINAYISAHLPDKRDLGDCSSCRRSFNTPLQPAAPINLAVLRQSSSEFPKSYCKHRYRVLLDLARTSMQVGQYTVAKEMARSLLKQLDYLATERSFCPPLDSNRNLLASCLHLLFCTLDERLKTFEFVTEQTTPIFRRTVHYGARALLLQHEIVTHIQRAIDNKDNHAIGDVRHVVISKLQQQLCHAEIRLAHIMTHFVFSLDGVEQTVINRHFVQSEIRSVTYACMSRAHEIATRLKDRQLLLEIQMTFGVIQPRENFKEKILLYKTPLRQALCIYGEGHIFVSRLYINIGISYEEQKKYIKAFEYFTLWSHVTHELLGRNHCKSLRSCGVFKEPIFKLTAEFLKNLNDEEPNDNLEEELSDCINNIDSDNQDHLHGTVMSVAGVGILPASIMHQQTSDNISYENMFMMRSTLEHESDWEIHSSDDETPNYTNAFEEVIGKFKKRPYHAIAKELLQSILSNPLIDSNDLSKDDIESLIQSQDVPNEIDANSGMESTATDSSNSEAFRITRMFRDLRELAQWIPTTNLSPSDIS
Sbjct:    1 MDKCHVIIVDTINSKKFNSKNVKNILNEVLISNSHFLINEGNYLSKHIEFFDLDMKCDKMAIEKALMKDHLFINIISTSTISSPDKEAKEGFVKKIQNHIQNSLSFRYYNLLKHAFISRNRNALFLLVDDDNESEFLVTVDNNDKFDDYNCVNRNFCEVNWMGLTSVILNDQKIGISPGQSYERKMQIWLLTKLIALDGNLAFYSMPILAKLISLYSGIVQMRLSSFDSCESALTERYGTAVAGKLAETVRNRCAHVPSVPIFIHGDKSVDWNVIRKCVHELFSSSSTFIGHYKSRLHPICQDVNFLLVSLLKYFKAYPKDNELPFTSPQMATLVSECLMSEASVQTGKFLVIFIEDIDWVLSPSLTNNACSWLPEKCAHNIQVIVTAAKDSVHEKCLKCRLNPPKFIDVSHQESWIRNTGNEIVCPCQQSWCLSKLFCLPIKLRDLISDWHNDNVKLYMTELLSIFTCSVVCGLTRSQIDWLFSFGISQSHKDKYIDFDEKDEWESSEKLQLNSSQEGRLPLPASEAIIISAAINELIDIGIIQQINLNHCDEPCYSLTAPQLNQYL------HQHQHQHQHQHQHQAAVQITKCRLGAYYVYQATDLHSEMLFVPSLLQYLPMAAGMNDTALQDWLLDWPVFMKLKDEFCVPVKLLSLWRAVLGPTTDYTPMINAYISAHLPDKRDLGDCSSCRRSFNTPLQPAAPINLAVLRQSSSEFPKSYCKHRYRVLLDLARTSMQVGQYTVAKEMARSLLKQLDYLATERSFCPPLDSNRNLLASCLHLLFCTLDERLKTFEFVTEQTTPIFRRTVHYGARALLLQHEIVTHIQRAIDNKDNHAIGDVRHVVISKLQQQLCHAEIRLAHIMTHFVFSLDGVEQTVINRHFVQSEIRSVTYACMSRAHEIATRLKDRQLLLEIQMTFGVIQPRENFKEKILLYKTPLRQALCIYGEGHIFVSRLYINIGISYEEQKKYIKAFEYFTLWSHVTHELLGRNHCKSLRSCGVFKEPIFKLTAEFLKNLNDEEPNDNLEEELSDCINNIDSDNQDHLHGTVMSVAGVGILPASIMHQQTSDNISYENMFMMRSTLEHESDWEIHSSDDETPNYTNAFEEVIGKFKKRPYHAIAKELLQSILSNPLIDSNDLSKDDIESLIQSQDVPNEIDANSGMESTATDSSNSEAFRITRMFRDLRELAQWIPTTNLSPSDIS 1201          
The following BLAST results are available for this feature:
BLAST of Telomerase protein component 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Telomerase protein component 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Telomerase protein component 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QBE14.632e-2328.93Telomerase protein component 1 OS=Crassostrea giga... [more]
A0A2C9LUZ96.406e-2025.36Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A210PJH82.564e-1826.07Telomerase protein component 1 OS=Mizuhopecten yes... [more]
A0A0L8GC922.766e-1829.02TPR_REGION domain-containing protein (Fragment) OS... [more]
A0A2T7NQU65.010e-1825.98Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Telomerase protein component 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Telomerase protein component 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000049038.10.000e+099.50SMESG000049038.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006963 ID=SMED30006963|Name=Telomerase protein component 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3870bp
ATTTTAAATTGCCTAATTTTCTAATTTTTATTATTTGACATAATGGATAA
ATGTCATGTAATAATAGTTGACACAATTAATTCAAAAAAATTTAATTCCA
AAAATGTTAAAAATATTTTAAACGAAGTTCTTATTTCCAATTCACACTTC
CTAATTAATGAAGGGAATTATTTATCAAAGCACATAGAATTTTTTGATTT
AGACATGAAATGTGATAAAATGGCAATCGAAAAGGCATTAATGAAGGATC
ATTTATTTATAAATATAATTAGCACATCTACAATCTCTTCTCCCGACAAA
GAGGCAAAAGAAGGATTTGTTAAGAAAATTCAAAATCATATTCAAAATTC
ATTATCGTTTCGCTATTATAATTTGCTGAAACATGCATTTATTTCCAGAA
ATAGAAATGCGTTATTTTTATTAGTCGATGATGACAATGAGAGCGAATTT
TTGGTTACAGTGGATAATAATGACAAGTTCGATGATTATAATTGCGTTAA
TAGGAATTTTTGTGAAGTTAATTGGATGGGATTGACATCAGTTATTCTGA
ACGACCAGAAAATCGGCATCTCCCCCGGGCAGTCCTACGAAAGAAAGATG
CAAATCTGGCTGCTGACAAAGCTGATCGCGCTCGATGGCAATTTAGCATT
CTACAGCATGCCGATTCTAGCTAAATTGATCTCATTGTACAGCGGCATCG
TGCAGATGAGGTTGAGCTCATTTGACAGCTGCGAGTCGGCACTCACTGAG
AGATATGGGACCGCAGTGGCAGGGAAACTGGCGGAGACTGTCAGGAATCG
ATGCGCACATGTTCCCAGCGTGCCGATATTCATTCACGGGGACAAATCGG
TCGATTGGAATGTCATCAGGAAATGTGTCCACGAGCTGTTCAGCTCGAGC
TCAACGTTCATTGGCCATTACAAATCGCGCCTCCACCCGATTTGCCAGGA
CGTCAATTTCCTGCTGGTGTCACTGCTGAAATATTTCAAGGCATATCCGA
AGGACAACGAGCTGCCATTCACGAGCCCTCAAATGGCCACCCTGGTCAGT
GAGTGTCTCATGTCTGAGGCATCGGTCCAGACCGGGAAATTCCTCGTCAT
TTTCATTGAGGATATCGATTGGGTCCTCTCTCCCTCGCTCACCAATAACG
CGTGCTCCTGGTTACCAGAGAAATGCGCACACAACATACAGGTAATTGTG
ACCGCTGCCAAGGATTCAGTGCACGAGAAATGCTTAAAGTGCCGCTTGAA
TCCTCCAAAGTTTATCGATGTGTCGCACCAAGAGTCATGGATCAGGAATA
CTGGTAACGAGATCGTCTGTCCTTGCCAACAGTCCTGGTGTCTCAGCAAA
TTGTTTTGTTTGCCGATCAAACTTAGAGATCTGATTTCCGACTGGCACAA
TGATAACGTCAAGCTCTACATGACAGAACTGTTATCAATTTTCACTTGCT
CCGTTGTATGTGGCTTAACGCGGTCACAAATCGATTGGTTATTTTCTTTC
GGCATTTCACAGTCGCACAAGGATAAATATATCGATTTTGATGAGAAAGA
TGAATGGGAAAGTTCCGAAAAGCTCCAATTGAATTCAAGCCAGGAGGGGC
GGTTGCCATTGCCAGCAAGCGAAGCAATTATCATTTCCGCTGCGATCAAT
GAGCTAATCGACATTGGGATCATTCAACAGATCAATCTGAACCATTGCGA
TGAACCGTGTTACTCGCTGACCGCTCCGCAATTGAATCAATATCTCCACC
AGCACCAGCACCAGCACCAGCACCAGCACCAGCACCAGCACCAGCACCAG
CACCAGGCAGCGGTGCAGATCACCAAATGCCGTCTCGGTGCATATTATGT
GTATCAGGCAACCGATCTGCACTCGGAAATGCTGTTTGTGCCGAGCTTGC
TCCAGTACCTGCCGATGGCGGCGGGAATGAATGACACGGCGCTCCAGGAT
TGGCTGCTCGACTGGCCGGTATTCATGAAGCTGAAGGATGAGTTCTGCGT
GCCAGTGAAGCTGCTGTCGCTGTGGCGGGCCGTGCTGGGCCCCACCACCG
ATTACACGCCCATGATCAATGCCTACATATCGGCACATCTGCCCGATAAG
CGGGACCTTGGGGACTGCTCCAGTTGCAGGCGCTCCTTCAACACCCCGCT
ACAGCCCGCCGCTCCAATCAACCTCGCAGTTCTCCGCCAATCCTCGTCCG
AGTTTCCCAAATCCTATTGCAAGCACCGATATCGAGTGCTACTCGATCTC
GCCCGCACCTCGATGCAAGTCGGTCAATATACCGTTGCGAAGGAGATGGC
TCGATCTCTCCTCAAGCAGTTGGACTACCTGGCAACCGAGCGCTCCTTCT
GCCCGCCGCTGGACTCCAACCGGAACCTGCTTGCATCTTGTCTGCATCTG
TTGTTCTGCACCCTCGATGAGCGCCTGAAAACCTTTGAATTCGTCACGGA
GCAAACGACACCGATATTCCGCAGGACCGTCCATTATGGAGCTCGTGCAC
TCCTGCTACAGCACGAGATTGTCACCCATATCCAGCGGGCAATCGACAAC
AAGGACAATCACGCCATCGGTGATGTCAGGCACGTTGTCATATCGAAACT
GCAACAGCAGTTGTGTCACGCAGAGATCCGATTGGCACATATTATGACTC
ATTTCGTGTTCTCATTGGATGGCGTCGAGCAGACCGTTATCAATCGGCAT
TTTGTACAATCAGAGATTCGATCGGTCACTTACGCATGCATGAGTCGGGC
TCATGAGATTGCCACTCGGTTGAAAGACCGGCAGTTACTGCTGGAGATCC
AAATGACATTCGGTGTCATACAGCCGCGAGAAAATTTCAAGGAAAAGATA
TTGCTGTACAAAACACCTCTGCGCCAGGCACTGTGTATCTATGGAGAAGG
ACACATCTTCGTTTCCAGACTCTACATCAATATCGGGATTTCTTATGAAG
AGCAAAAGAAGTACATAAAAGCTTTTGAATATTTCACTCTGTGGTCTCAT
GTTACCCACGAGCTATTGGGTCGAAATCACTGCAAATCCCTACGCAGTTG
CGGGGTATTTAAAGAGCCAATATTTAAATTAACCGCTGAATTTCTCAAAA
ATTTGAATGATGAAGAACCGAATGATAATCTGGAAGAGGAATTGAGTGAT
TGTATTAACAATATAGATTCTGATAATCAAGATCACCTTCATGGAACTGT
GATGAGCGTAGCGGGAGTGGGAATCCTTCCTGCTTCTATAATGCATCAGC
AGACCAGTGACAACATCTCGTATGAGAACATGTTTATGATGCGGAGCACA
TTAGAGCATGAATCTGATTGGGAGATCCATTCCAGTGACGATGAGACTCC
TAACTACACCAATGCGTTTGAGGAAGTCATTGGGAAATTCAAAAAGCGAC
CATATCACGCAATCGCAAAGGAATTGTTGCAGTCCATTCTCAGCAATCCA
TTGATTGATTCCAATGACCTTTCCAAGGATGACATAGAGAGCCTGATTCA
ATCTCAAGATGTGCCTAATGAAATCGATGCAAACTCAGGGATGGAATCAA
CTGCTACTGACAGCTCTAACTCCGAGGCTTTTAGAATTACTCGAATGTTT
CGTGATCTTCGGGAACTTGCTCAATGGATTCCCACAACCAATTTATCTCC
ATCAGATATTAGTCTTTCTAGGAGACTTCTAGAACTCCAGCGAGAATTGG
AGGAATTTCTGGATAATTGATACCGGTTTATAATTCATTTGGTGCTGAAT
ACAAGCTGAAATTGATATTTGATCTGATAGGATTATTTTGATTGGCTGTT
GGTTGTAATTGGATATTATTGGATTGGCTAATTATGTTTATGGATGATTT
GACAGGCTAACTATTTTAGA
back to top

protein sequence of SMED30006963-orf-1

>SMED30006963-orf-1 ID=SMED30006963-orf-1|Name=SMED30006963-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1226bp
MDKCHVIIVDTINSKKFNSKNVKNILNEVLISNSHFLINEGNYLSKHIEF
FDLDMKCDKMAIEKALMKDHLFINIISTSTISSPDKEAKEGFVKKIQNHI
QNSLSFRYYNLLKHAFISRNRNALFLLVDDDNESEFLVTVDNNDKFDDYN
CVNRNFCEVNWMGLTSVILNDQKIGISPGQSYERKMQIWLLTKLIALDGN
LAFYSMPILAKLISLYSGIVQMRLSSFDSCESALTERYGTAVAGKLAETV
RNRCAHVPSVPIFIHGDKSVDWNVIRKCVHELFSSSSTFIGHYKSRLHPI
CQDVNFLLVSLLKYFKAYPKDNELPFTSPQMATLVSECLMSEASVQTGKF
LVIFIEDIDWVLSPSLTNNACSWLPEKCAHNIQVIVTAAKDSVHEKCLKC
RLNPPKFIDVSHQESWIRNTGNEIVCPCQQSWCLSKLFCLPIKLRDLISD
WHNDNVKLYMTELLSIFTCSVVCGLTRSQIDWLFSFGISQSHKDKYIDFD
EKDEWESSEKLQLNSSQEGRLPLPASEAIIISAAINELIDIGIIQQINLN
HCDEPCYSLTAPQLNQYLHQHQHQHQHQHQHQHQHQHQAAVQITKCRLGA
YYVYQATDLHSEMLFVPSLLQYLPMAAGMNDTALQDWLLDWPVFMKLKDE
FCVPVKLLSLWRAVLGPTTDYTPMINAYISAHLPDKRDLGDCSSCRRSFN
TPLQPAAPINLAVLRQSSSEFPKSYCKHRYRVLLDLARTSMQVGQYTVAK
EMARSLLKQLDYLATERSFCPPLDSNRNLLASCLHLLFCTLDERLKTFEF
VTEQTTPIFRRTVHYGARALLLQHEIVTHIQRAIDNKDNHAIGDVRHVVI
SKLQQQLCHAEIRLAHIMTHFVFSLDGVEQTVINRHFVQSEIRSVTYACM
SRAHEIATRLKDRQLLLEIQMTFGVIQPRENFKEKILLYKTPLRQALCIY
GEGHIFVSRLYINIGISYEEQKKYIKAFEYFTLWSHVTHELLGRNHCKSL
RSCGVFKEPIFKLTAEFLKNLNDEEPNDNLEEELSDCINNIDSDNQDHLH
GTVMSVAGVGILPASIMHQQTSDNISYENMFMMRSTLEHESDWEIHSSDD
ETPNYTNAFEEVIGKFKKRPYHAIAKELLQSILSNPLIDSNDLSKDDIES
LIQSQDVPNEIDANSGMESTATDSSNSEAFRITRMFRDLRELAQWIPTTN
LSPSDISLSRRLLELQRELEEFLDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002111X2 cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1021..1041