Small conductance calcium-activated potassium channel-like protein

Overview
NameSmall conductance calcium-activated potassium channel-like protein
Smed IDSMED30006961
Length (bp)2297
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Small conductance calcium-activated potassium channel-like protein (SMED30006961) t-SNE clustered cells

Violin plots show distribution of expression levels for Small conductance calcium-activated potassium channel-like protein (SMED30006961) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Small conductance calcium-activated potassium channel-like protein (SMED30006961) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Small conductance calcium-activated potassium channel-like protein (SMED30006961) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006961

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30006961h1SMcG0011537 SmedASXL_010467SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30006961h1SMcG0011537 dd_Smed_v4_19433_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006961h1SMcG0011537 dd_Smed_v4_19433_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006961h1SMcG0011537 dd_Smed_v4_19433_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30006961h1SMcG0011537 dd_Smed_v6_19433_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Human
Match: KCNN2 (potassium calcium-activated channel subfamily N member 2 [Source:HGNC Symbol;Acc:HGNC:6291])

HSP 1 Score: 348.591 bits (893), Expect = 3.111e-110
Identity = 176/368 (47.83%), Postives = 246/368 (66.85%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +   YS  LK LI LST++L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF + LEIL+CAIHP PGN  F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y ++  + +     +  I+ LE K+  L      LPGLI+
Sbjct:  162 KASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLIS 529          

HSP 2 Score: 56.6102 bits (135), Expect = 1.434e-7
Identity = 22/41 (53.66%), Postives = 34/41 (82.93%), Query Frame = 3
Query:  894 KTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            + +G++LG R+ L E+RK++SD+++ F +FGIVVMVIE EL
Sbjct:  115 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL 155          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Human
Match: KCNN3 (potassium calcium-activated channel subfamily N member 3 [Source:HGNC Symbol;Acc:HGNC:6292])

HSP 1 Score: 340.887 bits (873), Expect = 3.111e-109
Identity = 175/371 (47.17%), Postives = 246/371 (66.31%), Query Frame = 1
Query: 1039 KRLQKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            + ++   +S  LK LI LST++L+GLI+ YH  EV++  +D+  +DWR+ ++  RI  + LE+L+CAIHP PG   F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ PHT CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK+TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y L+ ++      ++  I  LE K+  L      LP LIA
Sbjct:    3 RPIKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIA 373          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Human
Match: KCNN3 (potassium calcium-activated channel subfamily N member 3 [Source:HGNC Symbol;Acc:HGNC:6292])

HSP 1 Score: 339.732 bits (870), Expect = 7.391e-109
Identity = 175/364 (48.08%), Postives = 243/364 (66.76%), Query Frame = 1
Query: 1060 YSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +S  LK LI LST++L+GLI+ YH  EV++  +D+  +DWR+ ++  RI  + LE+L+CAIHP PG   F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ PHT CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK+TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y L+ ++      ++  I  LE K+  L      LP LIA
Sbjct:    2 FSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIA 365          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Human
Match: KCNN2 (potassium calcium-activated channel subfamily N member 2 [Source:HGNC Symbol;Acc:HGNC:6291])

HSP 1 Score: 345.51 bits (885), Expect = 8.843e-109
Identity = 176/371 (47.44%), Postives = 247/371 (66.58%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKS---ELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +   YS  LK LI LST++L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF + LEIL+CAIHP PGN  F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK TKL + ++  K+ KHQRKFL+AI+  RK++S   E RKL D++N    L +  +  Y ++  + +     +  I+ LE K+  L      LPGLI+
Sbjct:  175 KASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQARKLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLIS 545          

HSP 2 Score: 56.6102 bits (135), Expect = 1.385e-7
Identity = 22/41 (53.66%), Postives = 34/41 (82.93%), Query Frame = 3
Query:  894 KTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            + +G++LG R+ L E+RK++SD+++ F +FGIVVMVIE EL
Sbjct:  128 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL 168          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Human
Match: KCNN2 (potassium calcium-activated channel subfamily N member 2 [Source:HGNC Symbol;Acc:HGNC:6291])

HSP 1 Score: 348.591 bits (893), Expect = 1.065e-107
Identity = 176/368 (47.83%), Postives = 246/368 (66.85%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +   YS  LK LI LST++L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF + LEIL+CAIHP PGN  F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y ++  + +     +  I+ LE K+  L      LPGLI+
Sbjct:  374 KASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLIS 741          

HSP 2 Score: 56.9954 bits (136), Expect = 1.315e-7
Identity = 22/41 (53.66%), Postives = 34/41 (82.93%), Query Frame = 3
Query:  894 KTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            + +G++LG R+ L E+RK++SD+++ F +FGIVVMVIE EL
Sbjct:  327 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL 367          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 266.929 bits (681), Expect = 4.059e-79
Identity = 138/331 (41.69%), Postives = 209/331 (63.14%), Query Frame = 1
Query: 1063 SYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDR-----LVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAY---DSFHA-DMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSY 2028
            S+ LK  I  +T  L+  + ++H IE+++    ++ +DW + LS RR  Q+ LE+LIC + P P   +  +         ++DR     L + ++ L I MF RLY   R MLLHSR+ +D  SRSI  +N+VNF+  F++KT+MT+ P  +L +F   + +I+ WIL  CE  Y   D ++  +  NSIWL+ ITFLS+GYGD+ P T CGR ++I  G++G   +++VVAV A++LELT+AE+HV +FM + QL+K LK+ AANVLRETW ++K+ KL E  +  KI KHQRKFL AIY +R+++ + RKL +     G + +    +Y
Sbjct:  251 SHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAPF---------MNDRFHDKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTY 572          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 266.544 bits (680), Expect = 5.159e-79
Identity = 138/331 (41.69%), Postives = 209/331 (63.14%), Query Frame = 1
Query: 1063 SYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDR-----LVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAY---DSFHA-DMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSY 2028
            S+ LK  I  +T  L+  + ++H IE+++    ++ +DW + LS RR  Q+ LE+LIC + P P   +  +         ++DR     L + ++ L I MF RLY   R MLLHSR+ +D  SRSI  +N+VNF+  F++KT+MT+ P  +L +F   + +I+ WIL  CE  Y   D ++  +  NSIWL+ ITFLS+GYGD+ P T CGR ++I  G++G   +++VVAV A++LELT+AE+HV +FM + QL+K LK+ AANVLRETW ++K+ KL E  +  KI KHQRKFL AIY +R+++ + RKL +     G + +    +Y
Sbjct:  258 SHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAPF---------MNDRFHDKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTY 579          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 266.544 bits (680), Expect = 5.432e-79
Identity = 138/331 (41.69%), Postives = 209/331 (63.14%), Query Frame = 1
Query: 1063 SYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDR-----LVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAY---DSFHA-DMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSY 2028
            S+ LK  I  +T  L+  + ++H IE+++    ++ +DW + LS RR  Q+ LE+LIC + P P   +  +         ++DR     L + ++ L I MF RLY   R MLLHSR+ +D  SRSI  +N+VNF+  F++KT+MT+ P  +L +F   + +I+ WIL  CE  Y   D ++  +  NSIWL+ ITFLS+GYGD+ P T CGR ++I  G++G   +++VVAV A++LELT+AE+HV +FM + QL+K LK+ AANVLRETW ++K+ KL E  +  KI KHQRKFL AIY +R+++ + RKL +     G + +    +Y
Sbjct:  258 SHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAPF---------MNDRFHDKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTY 579          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 267.7 bits (683), Expect = 5.525e-79
Identity = 138/331 (41.69%), Postives = 209/331 (63.14%), Query Frame = 1
Query: 1063 SYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDR-----LVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAY---DSFHA-DMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSY 2028
            S+ LK  I  +T  L+  + ++H IE+++    ++ +DW + LS RR  Q+ LE+LIC + P P   +  +         ++DR     L + ++ L I MF RLY   R MLLHSR+ +D  SRSI  +N+VNF+  F++KT+MT+ P  +L +F   + +I+ WIL  CE  Y   D ++  +  NSIWL+ ITFLS+GYGD+ P T CGR ++I  G++G   +++VVAV A++LELT+AE+HV +FM + QL+K LK+ AANVLRETW ++K+ KL E  +  KI KHQRKFL AIY +R+++ + RKL +     G + +    +Y
Sbjct:  278 SHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAPF---------MNDRFHDKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTY 599          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 266.929 bits (681), Expect = 5.812e-79
Identity = 138/331 (41.69%), Postives = 209/331 (63.14%), Query Frame = 1
Query: 1063 SYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDR-----LVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAY---DSFHA-DMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSY 2028
            S+ LK  I  +T  L+  + ++H IE+++    ++ +DW + LS RR  Q+ LE+LIC + P P   +  +         ++DR     L + ++ L I MF RLY   R MLLHSR+ +D  SRSI  +N+VNF+  F++KT+MT+ P  +L +F   + +I+ WIL  CE  Y   D ++  +  NSIWL+ ITFLS+GYGD+ P T CGR ++I  G++G   +++VVAV A++LELT+AE+HV +FM + QL+K LK+ AANVLRETW ++K+ KL E  +  KI KHQRKFL AIY +R+++ + RKL +     G + +    +Y
Sbjct:  258 SHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAPF---------MNDRFHDKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTY 579          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0300467)

HSP 1 Score: 369.392 bits (947), Expect = 4.193e-119
Identity = 176/369 (47.70%), Postives = 260/369 (70.46%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKI--LSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGK-KQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +  FYS  LK+LI +ST++L+GLIV YH +EV++    +D+  +DWR+ ++ +RI Q+ LE+ ICAIHP PG   F+W+  LA K K I   +V +D+ L + MF RLYL  R MLLHS+L +D  SRSIGA+N++NF+  F++KT+MT+ P  VL VF++++ +I+SW L  CE  +D  HA++ N++WLI ITFLS+G+GD+ P+T CGR +++S G+MG  CTAL+VAV +++LELT+AE+HV +FMM+ QL+K LK  AANVLRETWL+YK+T+L + VN  ++  HQRKFL AIY LRK+K + RKL D +N    + +  +  Y ++  +   Q  I+  +  LEDK+  +Q   + LP L++
Sbjct:  109 KASFYSTALKTLISVSTVILLGLIVAYHALEVQVRLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLS 477          

HSP 2 Score: 61.2326 bits (147), Expect = 2.343e-9
Identity = 29/58 (50.00%), Postives = 38/58 (65.52%), Query Frame = 3
Query:  843 TKSTEPRRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            T     R+P     K    VG+RLGKRK L E+RK+ISD+++   +FGI+VMVIE EL
Sbjct:   44 TGGNTSRKPSTNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENEL 101          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0301949)

HSP 1 Score: 368.237 bits (944), Expect = 1.031e-118
Identity = 174/367 (47.41%), Postives = 258/367 (70.30%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGK-KQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +  FYS  LK+LI +ST++L+GLIV YH +EV++  +D+  +DWR+ ++ +RI Q+ LE+ ICAIHP PG   F+W+  LA K K I   +V +D+ L + MF RLYL  R MLLHS+L +D  SRSIGA+N++NF+  F++KT+MT+ P  VL VF++++ +I+SW L  CE  +D  HA++ NS+WL  ITFL +GYGD+ P+T CGR ++++ G++G  CTAL+VAV +++LELT+AE+HV +FMM+ QL+K LK  AANVLRETWL+YK+T+L + VN  ++  HQRKFL AIY LRK+K + RKL D +N    + +  +  Y ++  +   Q  I+  +  LEDK+  +Q   + LP L++
Sbjct:  109 KASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLS 475          

HSP 2 Score: 61.2326 bits (147), Expect = 2.295e-9
Identity = 29/58 (50.00%), Postives = 38/58 (65.52%), Query Frame = 3
Query:  843 TKSTEPRRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            T     R+P     K    VG+RLGKRK L E+RK+ISD+++   +FGI+VMVIE EL
Sbjct:   44 TGGNTSRKPSTNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENEL 101          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0301952)

HSP 1 Score: 368.237 bits (944), Expect = 4.291e-118
Identity = 174/367 (47.41%), Postives = 258/367 (70.30%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGK-KQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +  FYS  LK+LI +ST++L+GLIV YH +EV++  +D+  +DWR+ ++ +RI Q+ LE+ ICAIHP PG   F+W+  LA K K I   +V +D+ L + MF RLYL  R MLLHS+L +D  SRSIGA+N++NF+  F++KT+MT+ P  VL VF++++ +I+SW L  CE  +D  HA++ NS+WL  ITFL +GYGD+ P+T CGR ++++ G++G  CTAL+VAV +++LELT+AE+HV +FMM+ QL+K LK  AANVLRETWL+YK+T+L + VN  ++  HQRKFL AIY LRK+K + RKL D +N    + +  +  Y ++  +   Q  I+  +  LEDK+  +Q   + LP L++
Sbjct:  109 KASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLS 475          

HSP 2 Score: 61.6178 bits (148), Expect = 1.697e-9
Identity = 29/58 (50.00%), Postives = 38/58 (65.52%), Query Frame = 3
Query:  843 TKSTEPRRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            T     R+P     K    VG+RLGKRK L E+RK+ISD+++   +FGI+VMVIE EL
Sbjct:   44 TGGNTSRKPSTNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENEL 101          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0301954)

HSP 1 Score: 369.777 bits (948), Expect = 2.824e-117
Identity = 174/367 (47.41%), Postives = 258/367 (70.30%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGK-KQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +  FYS  LK+LI +ST++L+GLIV YH +EV++  +D+  +DWR+ ++ +RI Q+ LE+ ICAIHP PG   F+W+  LA K K I   +V +D+ L + MF RLYL  R MLLHS+L +D  SRSIGA+N++NF+  F++KT+MT+ P  VL VF++++ +I+SW L  CE  +D  HA++ NS+WL  ITFL +GYGD+ P+T CGR ++++ G++G  CTAL+VAV +++LELT+AE+HV +FMM+ QL+K LK  AANVLRETWL+YK+T+L + VN  ++  HQRKFL AIY LRK+K + RKL D +N    + +  +  Y ++  +   Q  I+  +  LEDK+  +Q   + LP L++
Sbjct:  272 KASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLS 638          

HSP 2 Score: 61.6178 bits (148), Expect = 2.102e-9
Identity = 29/58 (50.00%), Postives = 38/58 (65.52%), Query Frame = 3
Query:  843 TKSTEPRRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            T     R+P     K    VG+RLGKRK L E+RK+ISD+++   +FGI+VMVIE EL
Sbjct:  207 TGGNTSRKPSTNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENEL 264          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0344555)

HSP 1 Score: 370.548 bits (950), Expect = 3.028e-117
Identity = 176/369 (47.70%), Postives = 260/369 (70.46%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKI--LSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGK-KQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +  FYS  LK+LI +ST++L+GLIV YH +EV++    +D+  +DWR+ ++ +RI Q+ LE+ ICAIHP PG   F+W+  LA K K I   +V +D+ L + MF RLYL  R MLLHS+L +D  SRSIGA+N++NF+  F++KT+MT+ P  VL VF++++ +I+SW L  CE  +D  HA++ N++WLI ITFLS+G+GD+ P+T CGR +++S G+MG  CTAL+VAV +++LELT+AE+HV +FMM+ QL+K LK  AANVLRETWL+YK+T+L + VN  ++  HQRKFL AIY LRK+K + RKL D +N    + +  +  Y ++  +   Q  I+  +  LEDK+  +Q   + LP L++
Sbjct:  109 KASFYSTALKTLISVSTVILLGLIVAYHALEVQVRLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLS 477          

HSP 2 Score: 61.6178 bits (148), Expect = 2.120e-9
Identity = 29/58 (50.00%), Postives = 38/58 (65.52%), Query Frame = 3
Query:  843 TKSTEPRRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            T     R+P     K    VG+RLGKRK L E+RK+ISD+++   +FGI+VMVIE EL
Sbjct:   44 TGGNTSRKPSTNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENEL 101          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Zebrafish
Match: kcnn1a (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1a [Source:ZFIN;Acc:ZDB-GENE-070912-703])

HSP 1 Score: 347.436 bits (890), Expect = 2.273e-110
Identity = 175/368 (47.55%), Postives = 250/368 (67.93%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            ++  YS+ LK LI LST++L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF ++LE+L+CAIHP PG  +F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF ++  +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ PHT CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL K +K  AANVLRETWL+YK+TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y L+ ++ +   ++   I  LEDK+  +    + LP LI+
Sbjct:  122 KESSYSFALKCLISLSTVILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQYVFTWTARLAFTYVPSVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGTLEDKLDAVTGSLQALPCLIS 489          

HSP 2 Score: 55.0694 bits (131), Expect = 2.670e-7
Identity = 23/45 (51.11%), Postives = 34/45 (75.56%), Query Frame = 3
Query:  882 NKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
             K  K +G++LG R+ L E+RK++SD+++ F +FGIVVMV E EL
Sbjct:   71 QKKNKDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETEL 115          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Zebrafish
Match: kcnn1b (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1b [Source:ZFIN;Acc:ZDB-GENE-060503-397])

HSP 1 Score: 343.969 bits (881), Expect = 5.249e-109
Identity = 172/368 (46.74%), Postives = 251/368 (68.21%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFH--ADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            ++  YS+ LK LI LST++L+ LI+ YH  E+++  +D+  +DWR+ ++  RI  ++LE+L+CAIHP PG  +F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF ++  +I++W +H CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL K +K  AANVLRETWL+YK+TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y L+ ++ +   +++  I  LE K+  + +  + LPGL++
Sbjct:  123 KESSYSFALKCLISLSTVILLCLIIMYHAREIQLFMVDNGADDWRIAMTYERILFIVLELLVCAIHPIPGQYVFTWTARLAFTYTPSVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVHVCERYHDKVEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELEKRIGHLETKLDSINSSLQALPGLLS 490          

HSP 2 Score: 57.7658 bits (138), Expect = 4.031e-8
Identity = 25/52 (48.08%), Postives = 38/52 (73.08%), Query Frame = 3
Query:  861 RRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            +RP    +K  K +G++LG R+ L E+RK++SD+++ F +FGIVVMV E EL
Sbjct:   65 QRPCSAPHKKNKDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETEL 116          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Zebrafish
Match: kcnn1b (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1b [Source:ZFIN;Acc:ZDB-GENE-060503-397])

HSP 1 Score: 339.347 bits (869), Expect = 3.515e-107
Identity = 171/371 (46.09%), Postives = 252/371 (67.92%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFH--ADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKS---ELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            ++  YS+ LK LI LST++L+ LI+ YH  E+++  +D+  +DWR+ ++  RI  ++LE+L+CAIHP PG  +F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF ++  +I++W +H CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL K +K  AANVLRETWL+YK+TKL + ++  K+ KHQRKFL+AI+  +K++S   E RKL D++N    L +  +  Y L+ ++ +   +++  I  LE K+  + +  + LPGL++
Sbjct:  123 KESSYSFALKCLISLSTVILLCLIIMYHAREIQLFMVDNGADDWRIAMTYERILFIVLELLVCAIHPIPGQYVFTWTARLAFTYTPSVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVHVCERYHDKVEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQAQKLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELEKRIGHLETKLDSINSSLQALPGLLS 493          

HSP 2 Score: 57.7658 bits (138), Expect = 3.943e-8
Identity = 25/52 (48.08%), Postives = 38/52 (73.08%), Query Frame = 3
Query:  861 RRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            +RP    +K  K +G++LG R+ L E+RK++SD+++ F +FGIVVMV E EL
Sbjct:   65 QRPCSAPHKKNKDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETEL 116          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Zebrafish
Match: kcnn1a (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1a [Source:ZFIN;Acc:ZDB-GENE-070912-703])

HSP 1 Score: 345.125 bits (884), Expect = 1.834e-105
Identity = 175/364 (48.08%), Postives = 248/364 (68.13%), Query Frame = 1
Query: 1060 YSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFH--ADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            YS+ LK LI LST++L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF ++LE+L+CAIHP PG  +F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF ++  +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ PHT CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL K +K  AANVLRETWL+YK+TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y L+ ++ +   ++   I  LEDK+  +    + LP LI+
Sbjct:  504 YSFALKCLISLSTVILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQYVFTWTARLAFTYVPSVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGTLEDKLDAVTGSLQALPCLIS 867          

HSP 2 Score: 56.6102 bits (135), Expect = 1.119e-7
Identity = 23/45 (51.11%), Postives = 34/45 (75.56%), Query Frame = 3
Query:  882 NKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
             K  K +G++LG R+ L E+RK++SD+++ F +FGIVVMV E EL
Sbjct:  449 QKKNKDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETEL 493          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Zebrafish
Match: kcnn2 (potassium calcium-activated channel subfamily N member 2 [Source:ZFIN;Acc:ZDB-GENE-091116-41])

HSP 1 Score: 331.643 bits (849), Expect = 4.193e-104
Identity = 178/368 (48.37%), Postives = 251/368 (68.21%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFH--ADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            ++  YS  LK LI LST++L+GLI+ YH  E+++  +D++ +DWR+ ++  RIF + LEIL+CAIHP PGN  F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D+    ++   ++WLI ITFL+IGYGD+ P+T CG+ V +  G+MG  CTALVVAV AK+LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK TKL   ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y L+  + +    ++  I LLE K+  L +  + LPGLI+
Sbjct:  148 KESLYSLALKCLISLSTIILLGLIIIYHAREIQLFMVDNAADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSKTDADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRACERYHDNMDVTSNFLGAMWLISITFLTIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVAKKLELTKAEKHVHNFMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRKMDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANSLVDLAKTQNVMYDLVSDLNERGEDMEKRIALLETKLETLLSNLQALPGLIS 515          

HSP 2 Score: 54.299 bits (129), Expect = 5.053e-7
Identity = 23/44 (52.27%), Postives = 34/44 (77.27%), Query Frame = 3
Query:  885 KSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            K  + +G +LG R+ L E+RK++SD+++ F +FGIVVMVIE EL
Sbjct:   98 KKNQNIGQKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL 141          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 347.436 bits (890), Expect = 1.749e-110
Identity = 177/368 (48.10%), Postives = 247/368 (67.12%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            ++  YS+ LK LI LST +L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF + LE+ +CAIHP PG   F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF ++  +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QLSK +K  AANVLRETWL+YK+TKL   ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y L+ ++ +    ++  I+ LE KI  L    + LPGLIA
Sbjct:  124 KESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQYSFTWTARLAFFYTTSVANADIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAKVRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLMSELQERNEDLEKRIITLETKIDSLNTSLQSLPGLIA 491          

HSP 2 Score: 55.0694 bits (131), Expect = 3.944e-7
Identity = 23/44 (52.27%), Postives = 34/44 (77.27%), Query Frame = 3
Query:  885 KSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            K  + VG++LG R+ L E+RK++SD+++ F +FGIVVMV E EL
Sbjct:   74 KKNQNVGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETEL 117          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 347.821 bits (891), Expect = 1.851e-110
Identity = 177/368 (48.10%), Postives = 247/368 (67.12%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            ++  YS+ LK LI LST +L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF + LE+ +CAIHP PG   F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF ++  +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QLSK +K  AANVLRETWL+YK+TKL   ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y L+ ++ +    ++  I+ LE KI  L    + LPGLIA
Sbjct:  116 KESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQYSFTWTARLAFFYTTSVANADIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAKVRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLMSELQERNEDLEKRIITLETKIDSLNTSLQSLPGLIA 483          

HSP 2 Score: 55.0694 bits (131), Expect = 3.842e-7
Identity = 23/44 (52.27%), Postives = 34/44 (77.27%), Query Frame = 3
Query:  885 KSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            K  + VG++LG R+ L E+RK++SD+++ F +FGIVVMV E EL
Sbjct:   66 KKNQNVGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETEL 109          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 347.051 bits (889), Expect = 4.481e-110
Identity = 177/368 (48.10%), Postives = 247/368 (67.12%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            ++  YS+ LK LI LST +L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF + LE+ +CAIHP PG   F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF ++  +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QLSK +K  AANVLRETWL+YK+TKL   ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y L+ ++ +    ++  I+ LE KI  L    + LPGLIA
Sbjct:  124 KESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQYSFTWTARLAFFYTTSVANADIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAKVRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLMSELQERNEDLEKRIITLETKIDSLNTSLQSLPGLIA 491          

HSP 2 Score: 55.0694 bits (131), Expect = 3.529e-7
Identity = 23/44 (52.27%), Postives = 34/44 (77.27%), Query Frame = 3
Query:  885 KSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            K  + VG++LG R+ L E+RK++SD+++ F +FGIVVMV E EL
Sbjct:   74 KKNQNVGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETEL 117          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 346.665 bits (888), Expect = 1.896e-109
Identity = 177/368 (48.10%), Postives = 247/368 (67.12%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            ++  YS+ LK LI LST +L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF + LE+ +CAIHP PG   F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF ++  +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QLSK +K  AANVLRETWL+YK+TKL   ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y L+ ++ +    ++  I+ LE KI  L    + LPGLIA
Sbjct:  161 KESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQYSFTWTARLAFFYTTSVANADIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAKVRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLMSELQERNEDLEKRIITLETKIDSLNTSLQSLPGLIA 528          

HSP 2 Score: 55.0694 bits (131), Expect = 3.741e-7
Identity = 23/44 (52.27%), Postives = 34/44 (77.27%), Query Frame = 3
Query:  885 KSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            K  + VG++LG R+ L E+RK++SD+++ F +FGIVVMV E EL
Sbjct:  111 KKNQNVGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETEL 154          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Xenopus
Match: KCNN2 (potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 2 [Source:NCBI gene;Acc:100145581])

HSP 1 Score: 348.977 bits (894), Expect = 2.147e-109
Identity = 175/366 (47.81%), Postives = 247/366 (67.49%), Query Frame = 1
Query: 1054 DFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDS--FHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
              YS  LK LI LST++L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF + LEIL+CAIHP PGN  F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK TKL + ++  ++ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y ++  + +     +  I++LE K+  L    + LPGLI+
Sbjct:  246 SLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYTPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHARVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVVLETKLETLIGSIQALPGLIS 611          

HSP 2 Score: 57.7658 bits (138), Expect = 6.192e-8
Identity = 31/75 (41.33%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  825 PKHST----PTKSTEPRRPKLCRNKSMKT-------VGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            P+H++    P  S E  RP   +N   K+       +G++LG R+ L E+RK++SD+++ F +FGIVVMVIE EL
Sbjct:  165 PEHNSNSLAPYGSGE--RPGGQQNNGAKSGKKKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL 237          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Mouse
Match: Kcnn2 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 [Source:MGI Symbol;Acc:MGI:2153182])

HSP 1 Score: 348.591 bits (893), Expect = 2.103e-110
Identity = 176/368 (47.83%), Postives = 246/368 (66.85%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +   YS  LK LI LST++L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF + LEIL+CAIHP PGN  F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y ++  + +     +  I+ LE K+  L      LPGLI+
Sbjct:  157 KASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLIS 524          

HSP 2 Score: 56.6102 bits (135), Expect = 9.879e-8
Identity = 22/41 (53.66%), Postives = 34/41 (82.93%), Query Frame = 3
Query:  894 KTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            + +G++LG R+ L E+RK++SD+++ F +FGIVVMVIE EL
Sbjct:  110 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL 150          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Mouse
Match: Kcnn2 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 [Source:MGI Symbol;Acc:MGI:2153182])

HSP 1 Score: 348.591 bits (893), Expect = 2.103e-110
Identity = 176/368 (47.83%), Postives = 246/368 (66.85%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +   YS  LK LI LST++L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF + LEIL+CAIHP PGN  F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y ++  + +     +  I+ LE K+  L      LPGLI+
Sbjct:  157 KASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLIS 524          

HSP 2 Score: 56.6102 bits (135), Expect = 9.879e-8
Identity = 22/41 (53.66%), Postives = 34/41 (82.93%), Query Frame = 3
Query:  894 KTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            + +G++LG R+ L E+RK++SD+++ F +FGIVVMVIE EL
Sbjct:  110 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL 150          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Mouse
Match: Kcnn2 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 [Source:MGI Symbol;Acc:MGI:2153182])

HSP 1 Score: 348.591 bits (893), Expect = 2.217e-107
Identity = 176/368 (47.83%), Postives = 246/368 (66.85%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDS--FHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +   YS  LK LI LST++L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF + LEIL+CAIHP PGN  F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y ++  + +     +  I+ LE K+  L      LPGLI+
Sbjct:  422 KASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLIS 789          

HSP 2 Score: 56.9954 bits (136), Expect = 7.713e-8
Identity = 22/41 (53.66%), Postives = 34/41 (82.93%), Query Frame = 3
Query:  894 KTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            + +G++LG R+ L E+RK++SD+++ F +FGIVVMVIE EL
Sbjct:  375 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL 415          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Mouse
Match: Kcnn1 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1 [Source:MGI Symbol;Acc:MGI:1933993])

HSP 1 Score: 333.183 bits (853), Expect = 4.938e-105
Identity = 163/368 (44.29%), Postives = 247/368 (67.12%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            ++   S+ LK LI LST++L+GL++ YH  E+++  +D+  +DWR+ ++  R+  + LE+++CAIHP PG+  F W+  LA     S      D++L I MF RLYL  R MLLHSR+ +D  SRSIGA+N+V F+  F+ KT+MT+ P  VL VF ++  ++++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ PHT CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK+T+L +  +  ++ KHQRKFL+AI+ LR +K E  K+ D++N    L +A   +Y ++ ++  +Q +++  +  LE ++  L    + LPGLIA
Sbjct:  132 KESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTWERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSAAEADLDVLLSIPMFLRLYLLARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGRVRKHQRKFLQAIHQLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQEELEARLAALESRLDVLGASLQALPGLIA 499          

HSP 2 Score: 52.7582 bits (125), Expect = 1.542e-6
Identity = 23/40 (57.50%), Postives = 31/40 (77.50%), Query Frame = 3
Query:  897 TVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            TV  RLG R+ L E+RK++SD+++ F +FGIVVMV E EL
Sbjct:   86 TVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETEL 125          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Mouse
Match: Kcnn1 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1 [Source:MGI Symbol;Acc:MGI:1933993])

HSP 1 Score: 333.183 bits (853), Expect = 4.938e-105
Identity = 163/368 (44.29%), Postives = 247/368 (67.12%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            ++   S+ LK LI LST++L+GL++ YH  E+++  +D+  +DWR+ ++  R+  + LE+++CAIHP PG+  F W+  LA     S      D++L I MF RLYL  R MLLHSR+ +D  SRSIGA+N+V F+  F+ KT+MT+ P  VL VF ++  ++++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ PHT CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK+T+L +  +  ++ KHQRKFL+AI+ LR +K E  K+ D++N    L +A   +Y ++ ++  +Q +++  +  LE ++  L    + LPGLIA
Sbjct:  132 KESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTWERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSAAEADLDVLLSIPMFLRLYLLARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGRVRKHQRKFLQAIHQLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQEELEARLAALESRLDVLGASLQALPGLIA 499          

HSP 2 Score: 52.7582 bits (125), Expect = 1.542e-6
Identity = 23/40 (57.50%), Postives = 31/40 (77.50%), Query Frame = 3
Query:  897 TVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            TV  RLG R+ L E+RK++SD+++ F +FGIVVMV E EL
Sbjct:   86 TVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETEL 125          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. UniProt/SwissProt
Match: sp|Q7KVW5|KCNN_DROME (Small conductance calcium-activated potassium channel protein OS=Drosophila melanogaster OX=7227 GN=SK PE=2 SV=2)

HSP 1 Score: 369.777 bits (948), Expect = 1.938e-114
Identity = 174/367 (47.41%), Postives = 258/367 (70.30%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGK-KQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +  FYS  LK+LI +ST++L+GLIV YH +EV++  +D+  +DWR+ ++ +RI Q+ LE+ ICAIHP PG   F+W+  LA K K I   +V +D+ L + MF RLYL  R MLLHS+L +D  SRSIGA+N++NF+  F++KT+MT+ P  VL VF++++ +I+SW L  CE  +D  HA++ NS+WL  ITFL +GYGD+ P+T CGR ++++ G++G  CTAL+VAV +++LELT+AE+HV +FMM+ QL+K LK  AANVLRETWL+YK+T+L + VN  ++  HQRKFL AIY LRK+K + RKL D +N    + +  +  Y ++  +   Q  I+  +  LEDK+  +Q   + LP L++
Sbjct:  514 KASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLS 880          

HSP 2 Score: 67.0106 bits (162), Expect = 1.938e-114
Identity = 53/155 (34.19%), Postives = 75/155 (48.39%), Query Frame = 3
Query:  552 GIDAISLDYMRANGNLRGFRQLRNAKELISQSKAASFSMERSSLYPSSMFKKANISLPSXXXXXXXXXXXXSTTLLIADRKILKSSEQFPIPKHSTPTKSTEPRRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            GI  I+ D +R NG +R F+QLR          A++ S+  S   PS +  +  IS            NEE+   L+         E +   +    T     R+P     K    VG+RLGKRK L E+RK+ISD+++   +FGI+VMVIE EL
Sbjct:  372 GIAGIAADSLRINGGMRPFKQLRK--------PASTLSIPGSMKTPS-IANREQIS---------SGCNEEAAEALVGIHSDYPRYEMYM--EERALTGGNTSRKPSTNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENEL 506          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. UniProt/SwissProt
Match: sp|Q9H2S1|KCNN2_HUMAN (Small conductance calcium-activated potassium channel protein 2 OS=Homo sapiens OX=9606 GN=KCNN2 PE=1 SV=2)

HSP 1 Score: 348.591 bits (893), Expect = 1.494e-109
Identity = 176/368 (47.83%), Postives = 246/368 (66.85%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +   YS  LK LI LST++L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF + LEIL+CAIHP PGN  F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y ++  + +     +  I+ LE K+  L      LPGLI+
Sbjct:  162 KASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLIS 529          

HSP 2 Score: 56.6102 bits (135), Expect = 6.888e-7
Identity = 22/41 (53.66%), Postives = 34/41 (82.93%), Query Frame = 3
Query:  894 KTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            + +G++LG R+ L E+RK++SD+++ F +FGIVVMVIE EL
Sbjct:  115 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL 155          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. UniProt/SwissProt
Match: sp|P70604|KCNN2_RAT (Small conductance calcium-activated potassium channel protein 2 OS=Rattus norvegicus OX=10116 GN=Kcnn2 PE=1 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 1.691e-109
Identity = 176/368 (47.83%), Postives = 246/368 (66.85%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +   YS  LK LI LST++L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF + LEIL+CAIHP PGN  F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y ++  + +     +  I+ LE K+  L      LPGLI+
Sbjct:  163 KASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLIS 530          

HSP 2 Score: 56.6102 bits (135), Expect = 6.955e-7
Identity = 22/41 (53.66%), Postives = 34/41 (82.93%), Query Frame = 3
Query:  894 KTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            + +G++LG R+ L E+RK++SD+++ F +FGIVVMVIE EL
Sbjct:  116 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL 156          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. UniProt/SwissProt
Match: sp|P58390|KCNN2_MOUSE (Small conductance calcium-activated potassium channel protein 2 OS=Mus musculus OX=10090 GN=Kcnn2 PE=1 SV=2)

HSP 1 Score: 348.591 bits (893), Expect = 1.551e-106
Identity = 176/368 (47.83%), Postives = 246/368 (66.85%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDS--FHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +   YS  LK LI LST++L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF + LEIL+CAIHP PGN  F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ P+T CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y ++  + +     +  I+ LE K+  L      LPGLI+
Sbjct:  422 KASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLIS 789          

HSP 2 Score: 56.9954 bits (136), Expect = 5.395e-7
Identity = 22/41 (53.66%), Postives = 34/41 (82.93%), Query Frame = 3
Query:  894 KTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            + +G++LG R+ L E+RK++SD+++ F +FGIVVMVIE EL
Sbjct:  375 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL 415          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. UniProt/SwissProt
Match: sp|P58392|KCNN3_PIG (Small conductance calcium-activated potassium channel protein 3 OS=Sus scrofa OX=9823 GN=KCNN3 PE=2 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 4.715e-104
Identity = 175/368 (47.55%), Postives = 244/368 (66.30%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +   +S  LK LI LST++L+GLI+ YH  EV++  +D+  +DWR+ ++  RI  + LE+L+CAIHP PG   F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ PHT CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK+TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y L+ ++      ++  I  LE K+  L      LP LIA
Sbjct:  304 KDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIA 671          

HSP 2 Score: 58.5362 bits (140), Expect = 1.898e-7
Identity = 28/59 (47.46%), Postives = 43/59 (72.88%), Query Frame = 3
Query:  867 PKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELELCDNMKLYEK 1043
            PK  + K+ + +G++LG R+ L E+RK++SD+++ F +FGIVVMVIE EL  +  LY K
Sbjct:  249 PKANKRKN-QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL--SWGLYSK 304          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. TrEMBL
Match: A0A2T7NDV0 (CaMBD domain-containing protein (Fragment) OS=Pomacea canaliculata OX=400727 GN=C0Q70_19833 PE=4 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 7.538e-122
Identity = 187/366 (51.09%), Postives = 262/366 (71.58%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            + DF S F+KSLI LST++L+GLI+ YH +EVK+ ++D+ +EDWR+ +S RR+ QL +EILICAIHP PGN  F+W++  A  K    R+VS D++L I MF RLYL  R MLLHSRL +D  SRSIGA+N+++FD  F++KT+MT+ P  VL VF+LT+ +I+ W+L  CE  +D  HA++ NS W+I ITFLSIGYGD+ P+T CGR ++IS G MG   TALVVAV A++LEL++AE+HV +FMM+ QL+K LK  AANVLRETWL+YKYTKL + VN  K+  HQRKFL+AI+ LR++K + RKLE+  +    + +     + ++ ++   Q  ++  +  +EDK+  LQ     LP LI+
Sbjct:  211 KSDFASLFIKSLISLSTVILLGLILAYHALEVKLFAVDNCVEDWRIAISWRRMIQLFVEILICAIHPIPGNFTFEWTVIKAEDKASVARVVSVDVLLSIPMFLRLYLICRVMLLHSRLFTDASSRSIGALNRIHFDTKFVLKTLMTICPGTVLLVFMLTLWIIAGWLLRACERHHDENHANILNSFWMIAITFLSIGYGDIVPNTYCGRFIAISVGTMGAGVTALVVAVIARKLELSRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKYTKLVKKVNPSKVRSHQRKFLQAIHSLRRVKMDQRKLEENQSTLVDMAKTQTNIHEMVSEMHTNQTNLEKRVNKIEDKLATLQIHLDALPELIS 576          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. TrEMBL
Match: R7TXT1 (CaMBD domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_155299 PE=4 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 7.978e-122
Identity = 181/366 (49.45%), Postives = 263/366 (71.86%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +  FYS  LKSLI +ST++L+GLI+ YH +EV++ + D+ +EDWR+ LS++R+ Q+++E+ +CAIHP PG+  F W+   A    ++ R    D++L + MF RLYL  R MLLHS+L +D  SRSIGA+N++NF+  F++KT+MT+ P  VL VF+L++ +I+SW+L  CE+ +D  H ++ NS+W+I ITFLSIGYGD+ P+T CGR V+++ G+MG   TALVVAV A++LELT+AE+HV +FMM+ QL+K LK  AANVLRETWL+YKYTKL   VN  K+  HQRKFL AI+ LRK+K + RKL D +N    + +     Y L++++ Q Q  + + + L+E+ + QLQNQ   LP +IA
Sbjct:   94 KDSFYSIALKSLISVSTIILLGLILAYHALEVQLFATDNCVEDWRIALSMQRVAQILVELTVCAIHPIPGSFSFTWTTVHANGVTVTSRPTPVDLLLSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMLSLWIIASWVLRACESYHDVKHKNLLNSMWMISITFLSIGYGDIVPNTYCGRGVAVATGVMGAGVTALVVAVLARKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKYTKLVRKVNASKVRTHQRKFLHAIHSLRKVKMDQRKLNDNANTLVDMAKTQTNMYELVLEMSQRQNSVDSRVDLIEENLRQLQNQLDALPSIIA 459          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. TrEMBL
Match: A0A1I8HIS4 (CaMBD domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.011e-119
Identity = 168/324 (51.85%), Postives = 245/324 (75.62%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHH 2019
            + D YS  L+SLI +ST++L+GLI+ YH +E+++ S+D+ IEDWR+ ++ RR+ Q+++E+++CAIHP P ++ F W  Y+   ++    LV  D+ L + MF RLYL +R MLLHS+L +D  SRSIGA+N+++F+  F++KT+MT++P  VL VFIL++ + +SW+L  CE+ +D+ H ++ NS+WLI ITFLSIGYGD+ P+T CGR +SI+ G+MG +CTALVVAVFA++LEL++AE+HV +FMM+  L+K LK  AANVLRETWL+YKYTKL + VN  K+  HQRKFL AI+ LRK+K + RKL D +N    L + +H
Sbjct:   21 KADIYSKVLRSLISISTVILVGLILGYHMLEIQLFSIDNCIEDWRIAITTRRLTQMLMEVIVCAIHPVPNDLTFNWETYVPHDRKKVSVLVPIDLFLSLPMFLRLYLIFRVMLLHSKLFTDASSRSIGALNRISFNTRFVLKTLMTMFPGTVLLVFILSLWITASWLLRACESYHDALHGNILNSMWLISITFLSIGYGDIVPNTYCGRGISIATGVMGSSCTALVVAVFARKLELSRAEKHVHNFMMDTALTKRLKNSAANVLRETWLIYKYTKLVKRVNPSKVRTHQRKFLHAIHSLRKVKRDQRKLMDNANTLVDLAKTNH 344          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. TrEMBL
Match: A0A5N4AVT1 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_05793 PE=4 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 1.015e-118
Identity = 176/367 (47.96%), Postives = 262/367 (71.39%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQ-ISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            + +FYS  LK+LI +ST++L+GLIV YH +EV++  +D+  +DWR+ ++ +RI Q+ +E+ ICA+HP PGN  F W+  LA K   I  + V +D+ L + MF RLYL  R MLLHS+L +D  SRSIGA+N++NF+  F++KT+MT+ P  VL VF++++ +I+SW L  CE  +D  HA++ N++WLI ITFLS+G+GD+ P+T CGR +++S G+MG  CTAL+VAV +++LELT+AE+HV +FMM+ QL+K LK  AANVLRETWL+YK+T+L + VN  ++  HQRKFL AIY LRK+K + RKL D +N    + +  +  Y ++  +   Q  +++ +  +EDK++ LQ Q   LP LIA
Sbjct:   71 KDEFYSIALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRIGQISMELAICAVHPIPGNNQFVWTTKLANKNGGIGKKCVPYDVPLSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIVSDMSTRQDTLEDRLATVEDKLVTLQEQLDLLPDLIA 437          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. TrEMBL
Match: D6W6Z2 (Small conductance calcium-activated potassium channel protein-like Protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC014196 PE=4 SV=1)

HSP 1 Score: 376.326 bits (965), Expect = 5.256e-118
Identity = 176/368 (47.83%), Postives = 263/368 (71.47%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQ--ISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            + DFYS  LK+LI +ST++L+GLIV YH +EV++  +D+  +DWR+ ++ +RI Q+ +E++ICA+HP PG+  F W+  L+  K   I  + V +D+ L + MF RLYL  R MLLHS+L +D  SRSIGA+N++NF+  F++KT+MT+ P  VL VF++++ +I+SW L  CE  +D  HA++ N++WLI ITFLS+G+GD+ P+T CGR +++S G+MG  CTAL+VAV +++LELT+AE+HV +FMM+ QL+K LK  AANVLRETWL+YK+T+L + VN  ++  HQRKFL AIY LRK+K + RKL D +N    + +  +  Y ++  +   Q  +++ +  +EDKI+ LQ Q   LP LIA
Sbjct:  127 KDDFYSIALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRICQITMELVICAVHPIPGHYRFVWTTKLSNHKDGGIGSKCVPYDVPLSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIVSDMSTRQDTLEDRLTTMEDKIVALQEQLDLLPDLIA 494          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Cavefish
Match: kcnn2 (potassium calcium-activated channel subfamily N member 2 [Source:ZFIN;Acc:ZDB-GENE-091116-41])

HSP 1 Score: 333.183 bits (853), Expect = 4.840e-105
Identity = 175/368 (47.55%), Postives = 249/368 (67.66%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDS--FHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            ++  YS  LK LI LST++L+GLI+ YH  E+++  +D++ +DWR+ ++  RIF + LEIL+CAIHP PG   F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D+    ++   ++WLI ITFL+IGYGD+ P+T CG+ V +  G+MG  CTALVVAV AK+LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK TKL   ++  ++ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y L+  + +     +  I +LE K+  L +  + LPGLI+
Sbjct:  131 KESLYSLALKCLISLSTIILLGLIIIYHAREIQLFMVDNAADDWRIAMTYERIFFICLEILVCAIHPIPGKYTFTWTARLAFYYTSSKTDADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRACERYHDNQDVTSNFLGAMWLISITFLTIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVAKKLELTKAEKHVHNFMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRKMDHARVRKHQRKFLQAIHQLRSVKMEQRKLNDQANSLVDLAKTQNIMYDLISDLNERGEDTEKRIAVLETKLETLLSNLQALPGLIS 498          

HSP 2 Score: 53.5286 bits (127), Expect = 7.317e-7
Identity = 23/44 (52.27%), Postives = 34/44 (77.27%), Query Frame = 3
Query:  885 KSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            K  + +G +LG R+ L E+RK++SD+++ F +FGIVVMVIE EL
Sbjct:   81 KKNQNIGQKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL 124          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Cavefish
Match: kcnn3 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [Source:ZFIN;Acc:ZDB-GENE-100921-56])

HSP 1 Score: 334.339 bits (856), Expect = 2.198e-103
Identity = 166/365 (45.48%), Postives = 243/365 (66.58%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDS--FHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPG 2136
            +   YS  LK LI LST++L+GLI+ YH  EV++  +D+  +DWR+ +++ R+  + LE+L+ A+HP PG+  F W   LA     S      D++L + MF RLYL  R MLLHS+L +D  SRSIGA+NKV+F+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D+    ++   ++WLI ITFLSIGYGD+ PHT CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK+TKL + ++  ++ KHQRKFL+AI+ LR +K E RKL D++N    L +     Y L+ ++      ++  +L LE ++ QL      LP 
Sbjct:  291 KSSMYSLALKCLISLSTIILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVHPVPGDFKFVWRARLAFTYIPSQAEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQSVMYELMSELNDRSEDLERQMLSLEQRVEQLTAGFSALPA 655          

HSP 2 Score: 56.9954 bits (136), Expect = 6.467e-8
Identity = 22/41 (53.66%), Postives = 34/41 (82.93%), Query Frame = 3
Query:  894 KTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            + +G++LG R+ L E+RK++SD+++ F +FGIVVMVIE EL
Sbjct:  244 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL 284          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Cavefish
Match: kcnn1b (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1b [Source:ZFIN;Acc:ZDB-GENE-060503-397])

HSP 1 Score: 268.855 bits (686), Expect = 2.608e-81
Identity = 154/362 (42.54%), Postives = 229/362 (63.26%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELP 2133
            ++  YS+ LK LI LSTL+L+GLI+ YH  E+++  +D+  +DWR+ ++  RI  ++LE+L+CAIHP PG+ +F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF ++  +I++W +      Y      +  ++WL+ + F  +  G   P      +  +     G  CTALVVAV A++LELTKAE+HV +FMM+ QL K +K  AANVLRETWL+YK+TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y L+ ++ +   ++   I  LE+K+  + +  + LP
Sbjct:  123 KESSYSFALKCLISLSTLILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERILFIVLELLVCAIHPIPGHYVFTWTARLAFTYAPSVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVFLFWYPQNILPI--ALWLVYVIFSKLQTGSSVP--FWKAVAFLLQPFRGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGQLEEKLDSITSSLQALP 480          

HSP 2 Score: 54.6842 bits (130), Expect = 2.608e-81
Identity = 22/41 (53.66%), Postives = 33/41 (80.49%), Query Frame = 3
Query:  894 KTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            K +G++LG R+ L E+RK++SD+++ F +FGIVVMV E EL
Sbjct:   76 KDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETEL 116          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Cavefish
Match: kcnn4 (potassium calcium-activated channel subfamily N member 4 [Source:NCBI gene;Acc:103046778])

HSP 1 Score: 237.269 bits (604), Expect = 1.573e-69
Identity = 123/323 (38.08%), Postives = 195/323 (60.37%), Query Frame = 1
Query: 1060 YSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNI---------LFKWSIYLAG---KKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQ 1992
            Y+  +  LI  ST  L+ LI+ +H+ ++++  +D +  DWR+ ++  R+  + LE+L+CA+HP    +         + KW+  +      +   +  +  +++L   MF RLYL +R++LLHS++L     RSIG++N +NF   F++K +M  YP R L VFI+   L ++W+L  CE   +    DM  ++WLI ITFL++GYGDV P T CG++V +  G+MG ACTA++VAV  K+L L K E+HV  FMM+ Q+SK ++  AANVLRE WLL++ T+   N    +   HQR  L AI   R ++ + RKL D +++
Sbjct:  102 YAISINGLISFSTGCLLILIIAFHYKDIRLFIIDHNQVDWRIAMTTNRVLGISLELLVCAVHPVASYLGPDVGVQVPVLKWNSSVTPICLCQSHRETWLEIELLLSGLMFLRLYLVHRAILLHSKVLLSASYRSIGSLNNINFTFRFVLKVLMNKYPARTLLVFIMLFWLSAAWMLRLCERQAEVETGDMGTALWLIAITFLTVGYGDVSPCTSCGKVVCLFTGVMGVACTAMLVAVVTKKLALNKGEKHVHFFMMDIQISKEIRNAAANVLRECWLLHRTTQAKNNNGEHR--HHQRCLLEAIRVFRHLRLKQRKLRDYTSE 422          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Cavefish
Match: KCNQ4 (potassium voltage-gated channel subfamily Q member 4 [Source:NCBI gene;Acc:103034244])

HSP 1 Score: 55.4546 bits (132), Expect = 2.009e-7
Identity = 30/112 (26.79%), Postives = 55/112 (49.11%), Query Frame = 1
Query: 1525 VILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLY 1860
            V++ +S++++  E   ++  +   +S+W   IT  +IGYGD  PHT  GR+++    L+G +  AL   +      L   E+H      + +        AAN+++  W LY
Sbjct:  245 VLIFASFLVYLAEKDINTEFSTYADSLWWGTITLTTIGYGDKTPHTWLGRLLAAGFALLGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRTP------AANLIQAAWRLY 350          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010066.1 (pep scaffold:Pmarinus_7.0:GL480376:18291:27660:1 gene:ENSPMAG00000009109.1 transcript:ENSPMAT00000010066.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.415 bits (459), Expect = 2.856e-53
Identity = 87/184 (47.28%), Postives = 124/184 (67.39%), Query Frame = 1
Query: 1156 LDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDS--FHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLM 1701
            +D+  +DWR+ ++ +RIF + LE+LICAIHP PGN  F W+  LA     S +    DI+L I MF RLYL  R MLLHS+L +D  SRSIGA+NK+ F+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D     ++   ++WLI ITFL+IGYGD+ PHT CGR V +  G+M
Sbjct:    5 VDNGADDWRIAMTYQRIFNIGLELLICAIHPIPGNYTFMWTARLAFTYVSSVKEADVDIVLSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDPQDITSNFLAAMWLISITFLTIGYGDMVPHTYCGRGVCLLTGIM 188          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004465.1 (pep scaffold:Pmarinus_7.0:GL499141:545:1291:-1 gene:ENSPMAG00000004066.1 transcript:ENSPMAT00000004465.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 1.346e-9
Identity = 24/50 (48.00%), Postives = 39/50 (78.00%), Query Frame = 3
Query:  894 KTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELELCDNMKLYEK 1043
            + +G++LG R+ L E+RK++SD+++ F +FGIVVMVIE EL  +  +Y+K
Sbjct:  104 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL--SWSVYDK 151          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Nematostella
Match: EDO47580 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLC8])

HSP 1 Score: 52.373 bits (124), Expect = 3.952e-7
Identity = 32/87 (36.78%), Postives = 47/87 (54.02%), Query Frame = 1
Query: 1501 VLFVFILTVILISSWILHTCENAYDSFHADMFNSI----WLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRL 1749
            ++F   L V+LISS +L+  E   D    DMFNSI    W   +T  + GYGD+ PHT  G+I+     ++G    AL V +  K++
Sbjct:  288 IVFSLSLGVVLISS-MLYYVEK--DGTGGDMFNSIPATMWYSVVTMTTTGYGDLVPHTALGKIIGSVGCIIGVLMIALPVPIIQKKV 371          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Nematostella
Match: EDO47671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLC9])

HSP 1 Score: 50.8322 bits (120), Expect = 1.282e-6
Identity = 45/178 (25.28%), Postives = 84/178 (47.19%), Query Frame = 1
Query: 1201 RIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAV 1734
            R F  I+++L  AI P+ G+++ +   Y+ G K  S+  + F  IL I    R++     +L HSR L D+     G+  ++                  +LF++ + VI+ SS +++  E   +     +  ++W   IT  + GYGD+ P T  G+++  +  ++G    AL V +
Sbjct:  216 RKFMSIIDLL--AILPYYGDLVLR---YVIGFK--SNLGIEFLEILRILRIVRIF----KLLRHSRRLQDLTQTVRGSTTELGL----------------ILFIYFVLVIVFSS-VMYYAEMQDNPKFVSIPEAMWYAVITTTTTGYGDIVPETALGKVIGSACCILGVLVVALPVPI 365          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Medaka
Match: kcnn1a (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101164003])

HSP 1 Score: 346.665 bits (888), Expect = 3.454e-109
Identity = 174/366 (47.54%), Postives = 248/366 (67.76%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYD--SFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGL 2139
            ++  YS+ LK LI LST++L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF ++LE+L+CAIHP PG  +F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF ++  +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ PHT CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL K +K  AANVLRETWL+YK+TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y L+ ++ +   ++   I  LEDK+  +    + LP L
Sbjct:  193 KESSYSFALKCLISLSTVILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQYVFTWTARLAFTYTPSVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGTLEDKLDSVTGSLQALPCL 558          

HSP 2 Score: 54.299 bits (129), Expect = 4.148e-7
Identity = 22/45 (48.89%), Postives = 34/45 (75.56%), Query Frame = 3
Query:  882 NKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
             K  + +G++LG R+ L E+RK++SD+++ F +FGIVVMV E EL
Sbjct:  142 QKKNRDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETEL 186          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Medaka
Match: KCNN1 (small conductance calcium-activated potassium channel protein 3 [Source:NCBI gene;Acc:101154856])

HSP 1 Score: 338.191 bits (866), Expect = 4.987e-107
Identity = 167/364 (45.88%), Postives = 244/364 (67.03%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFH--ADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELP 2133
            ++  YSY LKSLI +ST  L+GLI+ YH  E+++  +D+  +DWR+ ++L RI  + LE+++CAIHP PG  +F W+  LA     S     FDIIL + MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +T  +I++WI+  CE  +D+    +    ++WL+ ITFLSIGYGD+ PHT CG+ V +  G+MG  CTALVVAV A++ ELT+AE+HV +FMM+ QL K +K  AANVL+ETWL+YK TKL + ++   +  HQRKFL+AI+ LR++K E RKL D++N    + +  +  Y L+  +     ++   +++LE+K+  L    + LP
Sbjct:  119 KESTYSYTLKSLISVSTAFLLGLILMYHAREIQLFMVDNGADDWRIAMTLERILFIALELVVCAIHPIPGQYVFSWTARLAFNYTSSPSDDDFDIILSVPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSVTCWIIAAWIVRICERYHDTQEVTSTFLGAMWLVSITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKSELTRAEKHVHNFMMDTQLLKKIKNTAANVLQETWLIYKNTKLVKKIDHATVRHHQRKFLQAIHQLRRVKMEQRKLTDQANTVADVAKTQNMMYDLVSDLQHRSSELDRRVVVLEEKLDSLLLDMQSLP 482          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Medaka
Match: KCNN1 (small conductance calcium-activated potassium channel protein 3 [Source:NCBI gene;Acc:101154856])

HSP 1 Score: 336.265 bits (861), Expect = 1.564e-106
Identity = 165/356 (46.35%), Postives = 241/356 (67.70%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDS--FHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQL 2109
            ++  YSY LKSLI +ST  L+GLI+ YH  E+++  +D+  +DWR+ ++L RI  + LE+++CAIHP PG  +F W+  LA     S     FDIIL + MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF +T  +I++WI+  CE  +D+    +    ++WL+ ITFLSIGYGD+ PHT CG+ V +  G+MG  CTALVVAV A++ ELT+AE+HV +FMM+ QL K +K  AANVL+ETWL+YK TKL + ++   +  HQRKFL+AI+ LR++K E RKL D++N    + +  +  Y L+  +     ++   +++LE+K+  L
Sbjct:  117 KESTYSYTLKSLISVSTAFLLGLILMYHAREIQLFMVDNGADDWRIAMTLERILFIALELVVCAIHPIPGQYVFSWTARLAFNYTSSPSDDDFDIILSVPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSVTCWIIAAWIVRICERYHDTQEVTSTFLGAMWLVSITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKSELTRAEKHVHNFMMDTQLLKKIKNTAANVLQETWLIYKNTKLVKKIDHATVRHHQRKFLQAIHQLRRVKMEQRKLTDQANTVADVAKTQNMMYDLVSDLQHRSSELDRRVVVLEEKLDSL 472          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Medaka
Match: kcnn1a (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101164003])

HSP 1 Score: 345.51 bits (885), Expect = 6.671e-105
Identity = 174/366 (47.54%), Postives = 248/366 (67.76%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFH--ADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGL 2139
            ++  YS+ LK LI LST++L+GLI+ YH  E+++  +D+  +DWR+ ++  RIF ++LE+L+CAIHP PG  +F W+  LA     S      DIIL I MF RLYL  R MLLHS+L +D  SRSIGA+NK+NF+  F++KT+MT+ P  VL VF ++  +I++W +  CE  +D     ++   ++WLI ITFLSIGYGD+ PHT CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL K +K  AANVLRETWL+YK+TKL + ++  K+ KHQRKFL+AI+ LR +K E RKL D++N    L +  +  Y L+ ++ +   ++   I  LEDK+  +    + LP L
Sbjct:  583 KESSYSFALKCLISLSTVILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQYVFTWTARLAFTYTPSVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGTLEDKLDSVTGSLQALPCL 948          

HSP 2 Score: 55.4546 bits (132), Expect = 2.105e-7
Identity = 22/45 (48.89%), Postives = 34/45 (75.56%), Query Frame = 3
Query:  882 NKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
             K  + +G++LG R+ L E+RK++SD+++ F +FGIVVMV E EL
Sbjct:  532 QKKNRDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETEL 576          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Medaka
Match: kcnn3 (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101156116])

HSP 1 Score: 337.421 bits (864), Expect = 2.237e-104
Identity = 166/365 (45.48%), Postives = 244/365 (66.85%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDS--FHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPG 2136
            +   YS  LK LI LST++L+GLI+ YH  EV++  +D+  +DWR+ +++ R+  + LE+L+ A+HP PG+  F+W   LA     S      D++L + MF RLYL  R MLLHS+L +D  SRSIGA+NKV+F+  F++KT+MT+ P  VL VF +++ +I++W +  CE  +D+    ++   ++WLI ITFLSIGYGD+ PHT CG+ V +  G+MG  CTALVVAV A++LELTKAE+HV +FMM+ QL+K +K  AANVLRETWL+YK+TKL + ++  ++ KHQRKFL+AI+ LR +K E RKL D++N    L +     Y L+ ++      ++  +L LE ++ QL      LP 
Sbjct:  276 KSSMYSLALKCLISLSTVILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVHPVPGDFKFQWRARLAFSYAPSQAEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQSVMYELMSELNDRSEDLERQMLSLEQRVEQLTAGFNALPA 640          

HSP 2 Score: 57.3806 bits (137), Expect = 5.569e-8
Identity = 22/41 (53.66%), Postives = 34/41 (82.93%), Query Frame = 3
Query:  894 KTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            + +G++LG R+ L E+RK++SD+++ F +FGIVVMVIE EL
Sbjct:  229 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETEL 269          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Planmine SMEST
Match: SMESG000063214.1 (SMESG000063214.1)

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 365/366 (99.73%), Postives = 366/366 (100.00%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +KDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYLLLVQVCQEQLQIKNNILLLEDKIIQLQNQTKELPGLIA
Sbjct:  313 KKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYLLLVQVCQEQLQIKNNILLLEDKIIQLQNQTKELPGLIA 678          

HSP 2 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 313/313 (100.00%), Postives = 313/313 (100.00%), Query Frame = 3
Query:  105 MMHESNDLIFIDQSVNSTPXXXXXXXXCQIIYPKDVPKISLSIPEQHSYFPTRHSVSFEIPKIRLENMANKISCHSDETDNGCRRFSDLSRGLKTSSRNVKPVHLVKQEAICESQAASKESLRLIKSMNNSPNLSGSIIEFYKKKFSLTGIDAISLDYMRANGNLRGFRQLRNAKELISQSKAASFSMERSSLYPSSMFKKANISLPSXXXXXXXXXXXXSTTLLIADRKILKSSEQFPIPKHSTPTKSTEPRRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELELCDNMKLYEK 1043
            MMHESNDLIFIDQSVNSTPKKFFKQQQCQIIYPKDVPKISLSIPEQHSYFPTRHSVSFEIPKIRLENMANKISCHSDETDNGCRRFSDLSRGLKTSSRNVKPVHLVKQEAICESQAASKESLRLIKSMNNSPNLSGSIIEFYKKKFSLTGIDAISLDYMRANGNLRGFRQLRNAKELISQSKAASFSMERSSLYPSSMFKKANISLPSEEEERNEHINEESTTLLIADRKILKSSEQFPIPKHSTPTKSTEPRRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELELCDNMKLYEK
Sbjct:    1 MMHESNDLIFIDQSVNSTPKKFFKQQQCQIIYPKDVPKISLSIPEQHSYFPTRHSVSFEIPKIRLENMANKISCHSDETDNGCRRFSDLSRGLKTSSRNVKPVHLVKQEAICESQAASKESLRLIKSMNNSPNLSGSIIEFYKKKFSLTGIDAISLDYMRANGNLRGFRQLRNAKELISQSKAASFSMERSSLYPSSMFKKANISLPSEEEERNEHINEESTTLLIADRKILKSSEQFPIPKHSTPTKSTEPRRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELELCDNMKLYEK 313          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Planmine SMEST
Match: SMESG000063214.1 (SMESG000063214.1)

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 365/366 (99.73%), Postives = 366/366 (100.00%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +KDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYLLLVQVCQEQLQIKNNILLLEDKIIQLQNQTKELPGLIA
Sbjct:  312 KKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYLLLVQVCQEQLQIKNNILLLEDKIIQLQNQTKELPGLIA 677          

HSP 2 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 312/312 (100.00%), Postives = 312/312 (100.00%), Query Frame = 3
Query:  108 MHESNDLIFIDQSVNSTPXXXXXXXXCQIIYPKDVPKISLSIPEQHSYFPTRHSVSFEIPKIRLENMANKISCHSDETDNGCRRFSDLSRGLKTSSRNVKPVHLVKQEAICESQAASKESLRLIKSMNNSPNLSGSIIEFYKKKFSLTGIDAISLDYMRANGNLRGFRQLRNAKELISQSKAASFSMERSSLYPSSMFKKANISLPSXXXXXXXXXXXXSTTLLIADRKILKSSEQFPIPKHSTPTKSTEPRRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELELCDNMKLYEK 1043
            MHESNDLIFIDQSVNSTPKKFFKQQQCQIIYPKDVPKISLSIPEQHSYFPTRHSVSFEIPKIRLENMANKISCHSDETDNGCRRFSDLSRGLKTSSRNVKPVHLVKQEAICESQAASKESLRLIKSMNNSPNLSGSIIEFYKKKFSLTGIDAISLDYMRANGNLRGFRQLRNAKELISQSKAASFSMERSSLYPSSMFKKANISLPSEEEERNEHINEESTTLLIADRKILKSSEQFPIPKHSTPTKSTEPRRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELELCDNMKLYEK
Sbjct:    1 MHESNDLIFIDQSVNSTPKKFFKQQQCQIIYPKDVPKISLSIPEQHSYFPTRHSVSFEIPKIRLENMANKISCHSDETDNGCRRFSDLSRGLKTSSRNVKPVHLVKQEAICESQAASKESLRLIKSMNNSPNLSGSIIEFYKKKFSLTGIDAISLDYMRANGNLRGFRQLRNAKELISQSKAASFSMERSSLYPSSMFKKANISLPSEEEERNEHINEESTTLLIADRKILKSSEQFPIPKHSTPTKSTEPRRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELELCDNMKLYEK 312          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Planmine SMEST
Match: SMESG000076156.1 (SMESG000076156.1)

HSP 1 Score: 384.415 bits (986), Expect = 2.533e-125
Identity = 191/373 (51.21%), Postives = 262/373 (70.24%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKK-----QISDRLVSF-DIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSF-HADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +   YS  LKSLI +ST++L+GLI+ YH + +++ S DD IEDWR+ ++ + + QL+LE+LIC+IHP PGN  F  S Y    K      + DRL S  + IL + M  R Y+ +RS+LLHSR+  D GSRSIGAMNKV+FD  F++KT+MT+ P  VL  FILT+ ++ SW +  CE   DS  HA+M N +WLI +TFLSIGYGD+ PHT CGR ++IS G+MG ACTAL+VAVFA++LEL+KAE+HV  FM+ENQ++K LKYYAANVLRETWL+YKYTKL ++VN  K+  HQRKFL+AI+GLRK+K + RK +D SN    L +  +  Y  + ++      ++N I  +ED ++ L +Q K LP ++ 
Sbjct:  325 KSSIYSILLKSLISISTIILLGLILAYHALVIQLFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGN--FNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGTVLLTFILTLWILLSWTMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVTLHDQLKSLPEILT 695          

HSP 2 Score: 85.5001 bits (210), Expect = 2.533e-125
Identity = 58/157 (36.94%), Postives = 87/157 (55.41%), Query Frame = 3
Query:  552 GIDAISLDYMRANGNLRGFRQLRNAKELISQSKAASFSMERSSLYPSSMFKKANISLPSXXXXXXXXXXXXSTTLLIADRKILKSSEQFPIPKHSTPTKSTE--PRRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            GID I LDYMRANG + GF+QL       ++ K++  S+   +++  + F  A+ S            N ES      + K   S ++ P      P + +    R  +   ++SMK+VG+RLG+RK L E+R +ISDFS+ FA+FGI+VMVI+ EL
Sbjct:  167 GIDEIGLDYMRANGAIPGFKQLHQPMSNGNEQKSSVASL--INIFTKNPFSSASHSFDKSHSCNYLQSNMESND----NSKDPSSKDKTPQTYLPNPNQKSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTEL 317          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Planmine SMEST
Match: SMESG000076156.1 (SMESG000076156.1)

HSP 1 Score: 378.637 bits (971), Expect = 1.327e-123
Identity = 191/373 (51.21%), Postives = 260/373 (69.71%), Query Frame = 1
Query: 1048 QKDFYSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKK-----QISDRLVSF-DIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSF-HADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLIA 2145
            +   YS  LKSLI +ST++L+GLI+ YH +   + S DD IEDWR+ ++ + + QL+LE+LIC+IHP PGN  F  S Y    K      + DRL S  + IL + M  R Y+ +RS+LLHSR+  D GSRSIGAMNKV+FD  F++KT+MT+ P  VL  FILT+ ++ SW +  CE   DS  HA+M N +WLI +TFLSIGYGD+ PHT CGR ++IS G+MG ACTAL+VAVFA++LEL+KAE+HV  FM+ENQ++K LKYYAANVLRETWL+YKYTKL ++VN  K+  HQRKFL+AI+GLRK+K + RK +D SN    L +  +  Y  + ++      ++N I  +ED ++ L +Q K LP ++ 
Sbjct:  324 KSSIYSILLKSLISISTIILLGLILAYHAL---LFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGN--FNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGTVLLTFILTLWILLSWTMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVTLHDQLKSLPEILT 691          

HSP 2 Score: 85.5001 bits (210), Expect = 1.327e-123
Identity = 58/157 (36.94%), Postives = 87/157 (55.41%), Query Frame = 3
Query:  552 GIDAISLDYMRANGNLRGFRQLRNAKELISQSKAASFSMERSSLYPSSMFKKANISLPSXXXXXXXXXXXXSTTLLIADRKILKSSEQFPIPKHSTPTKSTE--PRRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            GID I LDYMRANG + GF+QL       ++ K++  S+   +++  + F  A+ S            N ES      + K   S ++ P      P + +    R  +   ++SMK+VG+RLG+RK L E+R +ISDFS+ FA+FGI+VMVI+ EL
Sbjct:  166 GIDEIGLDYMRANGAIPGFKQLHQPMSNGNEQKSSVASL--INIFTKNPFSSASHSFDKSHSCNYLQSNMESND----NSKDPSSKDKTPQTYLPNPNQKSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTEL 316          
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Planmine SMEST
Match: SMESG000046614.1 (SMESG000046614.1)

HSP 1 Score: 366.696 bits (940), Expect = 4.917e-117
Identity = 189/361 (52.35%), Postives = 260/361 (72.02%), Query Frame = 1
Query: 1060 YSYFLKSLIGLSTLMLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPFPGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRLLSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWILHTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLMGCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETWLLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGYLIQAHHRSYXXXXXXXXXXXXIKNNILLLEDKIIQLQNQTKELPGLI 2142
            YS  +K LI +ST++L+GLI+ YH +E+KI S DDSIEDWR+ ++ +RI Q+I E+ IC++ P PG   FKW +    K       V+ +I+L + M  RLYL  R +LLHS+L SD GSRSIGAMNKV+F+ISF++KT+MT  P  VL VFIL + L+ SW +  CE  YD  H ++FNS+WLI +TFLSIGYGD+ PHT CGR ++I+ G+ G ACTALVVAVFA+RLEL+KAE+HV+ FM ENQL+K LK YAANVLRETWL+YKYTKL +++N MK+  HQRKFLRAI+G+R++K + RKL+D SN    L +     Y  + ++  EQ  + + + +L+  +++LQ   + LP ++
Sbjct:  308 YSITMKGLILISTVILVGLIMAYHVLEIKIFSWDDSIEDWRIAITWQRIAQMIAEVFICSVQPIPGYYTFKWRVRNVEKD------VNLNIVLSLPMLLRLYLILRVLLLHSKLFSDAGSRSIGAMNKVSFNISFVLKTVMTTNPGTVLLVFILFIWLVFSWTMRICEVVYDDQHGNLFNSMWLISVTFLSIGYGDIVPHTYCGRGIAIATGVTGSACTALVVAVFARRLELSKAEKHVIHFMFENQLTKQLKNYAANVLRETWLIYKYTKLVKHINPMKVRVHQRKFLRAIHGMRQVKIDQRKLQDNSNTLVDLAKTQSSIYETVTEMRIEQNYLHHTLEILDQNLLKLQECIECLPKVM 662          

HSP 2 Score: 75.485 bits (184), Expect = 4.917e-117
Identity = 53/164 (32.32%), Postives = 84/164 (51.22%), Query Frame = 3
Query:  549 TGIDAISLDYMRANGNLRGFRQLRNAKELISQSKAASFSMERSSLYPSSMFKKANISLPSXXXXXXXXXXXXSTTLLIADRKILKSSEQFPIPK----HSTPTKSTEPRRPKLCRN----KSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVIELEL 1016
            TG++ I +D+MR NG + GF+QL+ A+E  +  +        S           N S P  + +     ++  T+        LKS E     K    HS  + +   RR     N    K+ K VG+RLGKRK L E+RK+++D+S+ FA+FG+ +M+++LEL
Sbjct:  149 TGLETIGVDFMRVNGAVSGFKQLKRAEEFKTAHRQKKLIKSIS-----------NASQPQNDVKFKPSDSDYRTSF-----GTLKSEEVQEECKVQNDHSGESAALCRRRDDYNNNNRTHKTNKNVGYRLGKRKELFEKRKRVTDYSLMFAVFGVFIMILDLEL 296          
The following BLAST results are available for this feature:
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNN23.111e-11047.83potassium calcium-activated channel subfamily N me... [more]
KCNN33.111e-10947.17potassium calcium-activated channel subfamily N me... [more]
KCNN37.391e-10948.08potassium calcium-activated channel subfamily N me... [more]
KCNN28.843e-10947.44potassium calcium-activated channel subfamily N me... [more]
KCNN21.065e-10747.83potassium calcium-activated channel subfamily N me... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnl-24.059e-7941.69KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-25.159e-7941.69KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-25.432e-7941.69KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-25.525e-7941.69KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-25.812e-7941.69KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SK4.193e-11947.70gene:FBgn0029761 transcript:FBtr0300467[more]
SK1.031e-11847.41gene:FBgn0029761 transcript:FBtr0301949[more]
SK4.291e-11847.41gene:FBgn0029761 transcript:FBtr0301952[more]
SK2.824e-11747.41gene:FBgn0029761 transcript:FBtr0301954[more]
SK3.028e-11747.70gene:FBgn0029761 transcript:FBtr0344555[more]
back to top
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnn1a2.273e-11047.55potassium intermediate/small conductance calcium-a... [more]
kcnn1b5.249e-10946.74potassium intermediate/small conductance calcium-a... [more]
kcnn1b3.515e-10746.09potassium intermediate/small conductance calcium-a... [more]
kcnn1a1.834e-10548.08potassium intermediate/small conductance calcium-a... [more]
kcnn24.193e-10448.37potassium calcium-activated channel subfamily N me... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr171.749e-11048.10WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
wdr171.851e-11048.10WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
wdr174.481e-11048.10WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
wdr171.896e-10948.10WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
KCNN22.147e-10947.81potassium channel, calcium activated intermediate/... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnn22.103e-11047.83potassium intermediate/small conductance calcium-a... [more]
Kcnn22.103e-11047.83potassium intermediate/small conductance calcium-a... [more]
Kcnn22.217e-10747.83potassium intermediate/small conductance calcium-a... [more]
Kcnn14.938e-10544.29potassium intermediate/small conductance calcium-a... [more]
Kcnn14.938e-10544.29potassium intermediate/small conductance calcium-a... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7KVW5|KCNN_DROME1.938e-11447.41Small conductance calcium-activated potassium chan... [more]
sp|Q9H2S1|KCNN2_HUMAN1.494e-10947.83Small conductance calcium-activated potassium chan... [more]
sp|P70604|KCNN2_RAT1.691e-10947.83Small conductance calcium-activated potassium chan... [more]
sp|P58390|KCNN2_MOUSE1.551e-10647.83Small conductance calcium-activated potassium chan... [more]
sp|P58392|KCNN3_PIG4.715e-10447.55Small conductance calcium-activated potassium chan... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NDV07.538e-12251.09CaMBD domain-containing protein (Fragment) OS=Poma... [more]
R7TXT17.978e-12249.45CaMBD domain-containing protein OS=Capitella telet... [more]
A0A1I8HIS41.011e-11951.85CaMBD domain-containing protein OS=Macrostomum lig... [more]
A0A5N4AVT11.015e-11847.96Uncharacterized protein OS=Photinus pyralis OX=705... [more]
D6W6Z25.256e-11847.83Small conductance calcium-activated potassium chan... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnn24.840e-10547.55potassium calcium-activated channel subfamily N me... [more]
kcnn32.198e-10345.48potassium intermediate/small conductance calcium-a... [more]
kcnn1b2.608e-8142.54potassium intermediate/small conductance calcium-a... [more]
kcnn41.573e-6938.08potassium calcium-activated channel subfamily N me... [more]
KCNQ42.009e-726.79potassium voltage-gated channel subfamily Q member... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000010066.12.856e-5347.28pep scaffold:Pmarinus_7.0:GL480376:18291:27660:1 g... [more]
ENSPMAT00000004465.11.346e-948.00pep scaffold:Pmarinus_7.0:GL499141:545:1291:-1 gen... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO475803.952e-736.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476711.282e-625.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnn1a3.454e-10947.54small conductance calcium-activated potassium chan... [more]
KCNN14.987e-10745.88small conductance calcium-activated potassium chan... [more]
KCNN11.564e-10646.35small conductance calcium-activated potassium chan... [more]
kcnn1a6.671e-10547.54small conductance calcium-activated potassium chan... [more]
kcnn32.237e-10445.48small conductance calcium-activated potassium chan... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063214.10.000e+099.73SMESG000063214.1[more]
SMESG000063214.10.000e+099.73SMESG000063214.1[more]
SMESG000076156.12.533e-12551.21SMESG000076156.1[more]
SMESG000076156.11.327e-12351.21SMESG000076156.1[more]
SMESG000046614.14.917e-11752.35SMESG000046614.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006961 ID=SMED30006961|Name=Small conductance calcium-activated potassium channel-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2297bp
CTCATTCTATACGATGGATTATTATTGGAATATTAACCAATCAGAATTGA
CTGTGAATCCCTTTAATAAACAATGCATTTATTCTTTCAATATATACTTT
TTTAATGATGCATGAATCAAACGATTTGATTTTCATAGATCAATCCGTAA
ATTCAACACCGAAAAAATTCTTCAAACAACAACAATGTCAAATAATCTAT
CCGAAAGACGTTCCGAAAATTTCACTGTCAATTCCTGAGCAGCATTCGTA
TTTTCCAACTAGACACTCTGTCAGTTTCGAAATACCGAAAATCCGATTGG
AAAACATGGCAAATAAAATTTCCTGTCATTCTGACGAAACCGACAACGGA
TGCAGACGATTCAGTGATTTGAGTAGAGGCTTGAAAACCAGTTCAAGAAA
TGTCAAGCCAGTCCATCTCGTGAAGCAGGAAGCGATCTGTGAGTCTCAAG
CAGCCTCCAAGGAAAGTCTACGACTAATTAAATCCATGAATAACAGTCCG
AATCTCTCTGGGTCGATCATTGAATTTTACAAAAAGAAATTTTCATTAAC
TGGCATTGATGCCATTAGTTTGGATTATATGAGAGCAAATGGAAATCTTA
GAGGCTTTAGACAATTGAGAAATGCGAAAGAACTGATATCACAAAGCAAG
GCCGCGTCTTTCAGTATGGAACGCTCATCTTTATATCCTAGCTCAATGTT
TAAGAAAGCAAACATAAGTCTTCCTTCGGAAGAAGAAGAAAGAAACGAAC
ACATCAATGAAGAATCAACGACATTACTAATCGCAGATCGTAAAATTCTA
AAATCATCAGAACAATTCCCAATTCCAAAGCATTCAACACCAACAAAGTC
AACTGAACCCCGAAGACCAAAATTATGCCGTAACAAATCAATGAAGACGG
TCGGATTTCGACTAGGAAAACGAAAAACTTTATTAGAGCAACGAAAAAAA
ATTTCAGATTTTTCTGTTGGTTTTGCTTTGTTTGGCATTGTAGTAATGGT
CATCGAATTGGAACTTTGTGACAATATGAAACTTTACGAAAAGATTACAG
AAAGATTTCTATTCTTATTTTTTGAAGTCTTTAATTGGATTGTCAACCCT
TATGCTCATCGGATTGATAGTATTTTATCACTTCATTGAAGTCAAGATAC
TTTCTCTGGATGATTCAATTGAAGACTGGAGACTTACGTTATCATTGAGG
CGGATTTTTCAATTAATATTAGAAATTCTAATTTGTGCAATTCACCCGTT
CCCTGGCAACATTTTGTTTAAATGGTCAATTTATTTAGCTGGTAAAAAGC
AAATTTCAGATAGACTCGTTTCGTTTGATATCATATTGGGTATATGTATG
TTTTCTCGGCTTTATCTCTTTTACAGAAGTATGCTCTTACATTCTCGCCT
CCTTTCAGATGTCGGTTCTAGATCAATCGGAGCCATGAACAAAGTCAATT
TTGATATATCTTTTTTAATCAAAACCATGATGACCTTGTATCCAGTTCGA
GTGTTATTCGTATTCATTCTAACTGTCATTTTAATTTCCTCTTGGATTTT
GCACACATGCGAAAATGCTTATGATTCATTTCATGCTGACATGTTTAATT
CTATATGGCTTATTTGCATTACTTTCTTGAGCATCGGCTATGGGGATGTT
TTTCCCCATACGGTCTGTGGGAGAATCGTTTCCATTTCCAATGGTTTAAT
GGGTTGTGCTTGCACGGCACTCGTCGTGGCCGTTTTTGCGAAGCGTTTGG
AACTAACAAAAGCCGAAAGACATGTAATGGATTTTATGATGGAAAATCAG
TTATCGAAAAATTTAAAATACTATGCCGCTAATGTTTTGCGGGAAACTTG
GTTACTTTATAAATATACCAAGTTAACAGAAAATGTAAATATAATGAAAA
TTTGGAAACATCAAAGAAAATTTTTAAGAGCAATTTATGGATTGAGAAAA
ATGAAATCAGAACTCCGAAAATTGGAAGACGAATCTAACCAAACTGGTTA
TTTGATTCAGGCTCACCACAGGTCCTACTTATTGCTTGTTCAAGTTTGTC
AAGAACAGTTGCAAATCAAAAACAATATTCTCTTATTAGAAGACAAAATC
ATTCAACTACAAAATCAAACGAAAGAATTGCCTGGACTTATTGCTCAACA
GATTATCCAATCTAGGAATCAGTCAATAATATAACACAATTCTTAAGTCC
AGAATTTCACCTGATTAAAACCATTTTATTTTTAATTTATTTTACTTAAT
ACCATTTTTGGTTCACATCTTTTCATTTTATAAATTAACTTAATATT
back to top

protein sequence of SMED30006961-orf-1

>SMED30006961-orf-1 ID=SMED30006961-orf-1|Name=SMED30006961-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=345bp
MMHESNDLIFIDQSVNSTPKKFFKQQQCQIIYPKDVPKISLSIPEQHSYF
PTRHSVSFEIPKIRLENMANKISCHSDETDNGCRRFSDLSRGLKTSSRNV
KPVHLVKQEAICESQAASKESLRLIKSMNNSPNLSGSIIEFYKKKFSLTG
IDAISLDYMRANGNLRGFRQLRNAKELISQSKAASFSMERSSLYPSSMFK
KANISLPSEEEERNEHINEESTTLLIADRKILKSSEQFPIPKHSTPTKST
EPRRPKLCRNKSMKTVGFRLGKRKTLLEQRKKISDFSVGFALFGIVVMVI
ELELCDNMKLYEKITERFLFLFFEVFNWIVNPYAHRIDSILSLH*
back to top

protein sequence of SMED30006961-orf-2

>SMED30006961-orf-2 ID=SMED30006961-orf-2|Name=SMED30006961-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=361bp
MLIGLIVFYHFIEVKILSLDDSIEDWRLTLSLRRIFQLILEILICAIHPF
PGNILFKWSIYLAGKKQISDRLVSFDIILGICMFSRLYLFYRSMLLHSRL
LSDVGSRSIGAMNKVNFDISFLIKTMMTLYPVRVLFVFILTVILISSWIL
HTCENAYDSFHADMFNSIWLICITFLSIGYGDVFPHTVCGRIVSISNGLM
GCACTALVVAVFAKRLELTKAERHVMDFMMENQLSKNLKYYAANVLRETW
LLYKYTKLTENVNIMKIWKHQRKFLRAIYGLRKMKSELRKLEDESNQTGY
LIQAHHRSYLLLVQVCQEQLQIKNNILLLEDKIIQLQNQTKELPGLIAQQ
IIQSRNQSII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036122CaM-bd_dom_sf
IPR001442Collagen_IV_NC
IPR004178CaM-bd_dom
IPR013099K_chnl_dom
IPR015449K_chnl_Ca-activ_SK
Vocabulary: molecular function
TermDefinition
GO:0005201extracellular matrix structural constituent
GO:0015269calcium-activated potassium channel activity
GO:0005516calmodulin binding
GO:0016286small conductance calcium-activated potassium channel activity
GO:0009881photoreceptor activity
Vocabulary: cellular component
TermDefinition
GO:0005581collagen trimer
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0016020membrane
GO:0043025neuronal cell body
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0007165signal transduction
GO:0016057regulation of membrane potential in photoreceptor cell
GO:0071805potassium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004178Calmodulin-binding domainSMARTSM01053CaMBD_2coord: 231..307
e-value: 2.4E-24
score: 96.9
IPR004178Calmodulin-binding domainPFAMPF02888CaMBDcoord: 231..297
e-value: 2.0E-24
score: 85.5
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 217..310
e-value: 6.0E-33
score: 114.9
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 119..216
e-value: 3.0E-14
score: 54.6
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 86..255
NoneNo IPR availableTMHMMTMhelixcoord: 191..213
NoneNo IPR availableTMHMMTMhelixcoord: 72..90
NoneNo IPR availableTMHMMTMhelixcoord: 38..60
NoneNo IPR availableTMHMMTMhelixcoord: 164..181
NoneNo IPR availableTMHMMTMhelixcoord: 129..151
IPR013099Potassium channel domainPFAMPF07885Ion_trans_2coord: 139..216
e-value: 3.7E-15
score: 55.6
IPR015449Potassium channel, calcium-activated, SKPFAMPF03530SK_channelcoord: 1..53
e-value: 1.2E-16
score: 60.7
IPR015449Potassium channel, calcium-activated, SKPANTHERPTHR10153SMALL CONDUCTANCE CALCIUM-ACTIVATED POTASSIUM CHANNELcoord: 2..354
IPR036122SK, calmodulin-binding domain superfamilySUPERFAMILYSSF81327Small-conductance potassium channelcoord: 214..298