slc35e1

Overview
Nameslc35e1 (AKN21650.1)
Smed IDSMED30006944
Length (bp)1436
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc35e1 (SMED30006944) t-SNE clustered cells

Violin plots show distribution of expression levels for slc35e1 (SMED30006944) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc35e1 (SMED30006944) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc35e1 (SMED30006944) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006944

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30006944SMESG000034003.1 dd_Smed_v4_5304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30006944SMESG000034003.1 dd_Smed_v4_5304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30006944SMESG000034003.1 dd_Smed_v4_5304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006944SMESG000034003.1 dd_Smed_v4_5304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006944SMESG000034003.1 dd_Smed_v4_5304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006944SMESG000034003.1 dd_Smed_v4_5304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006944SMESG000034003.1 dd_Smed_v4_5304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006944SMESG000034003.1 dd_Smed_v4_5304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30006944SMESG000034003.1 dd_Smed_v4_5304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006944SMESG000034003.1 dd_Smed_v4_5304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc35e1 vs. Ensembl Human
Match: SLC35E1 (solute carrier family 35 member E1 [Source:HGNC Symbol;Acc:HGNC:20803])

HSP 1 Score: 194.126 bits (492), Expect = 2.070e-56
Identity = 125/337 (37.09%), Postives = 193/337 (57.27%), Query Frame = 1
Query:  211 LCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKD-------------ISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATT---ILPIHKTKLNGSIVHNSRL--PH 1167
            LC +W  +S   N+++K +L+ FP+P+T +L  +LA      PL++ W++P                   +  ++  + ++PL FGK+ A+   H+S+ K+PVSYAHTVKA+MPI+VV+ S +  KEK S K+Y+SL  I SG+ LA++TE+SF+  GL+SA+ AT  F+  NI +K+ L  + +H   LL +L   +    +P W+  D   FL S           T+ LL   G  NFAQNVIAF+++  ++PLSY+V N  KR++VI +S++   NPVT  N++G   ++ GV +YN TK          +LP+    L+    H S L  PH
Sbjct:   33 LCLLWYALSAGGNVVNKVILSAFPFPVTVSLCHILALCAGLPPLLRAWRVPPAPPVSGPGPSPHPSSGPLLPPRFYPRYVLPLAFGKYFASVSAHVSIWKVPVSYAHTVKATMPIWVVLLSRIIMKEKQSTKVYLSLIPIISGVLLATVTELSFDMWGLVSALAATLCFSLQNIFSKKVLRDSRIHHLRLLNILGCHAVFFMIPTWVLVDLSAFLVSSDLTYVYQWPWTLLLLAVSGFCNFAQNVIAFSILNLVSPLSYSVANATKRIMVITVSLIMLRNPVTSTNVLGMMTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPH 369          
BLAST of slc35e1 vs. Ensembl Human
Match: SLC35E1 (solute carrier family 35 member E1 [Source:HGNC Symbol;Acc:HGNC:20803])

HSP 1 Score: 132.494 bits (332), Expect = 5.304e-34
Identity = 103/337 (30.56%), Postives = 161/337 (47.77%), Query Frame = 1
Query:  211 LCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKD-------------ISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATT---ILPIHKTKLNGSIVHNSRL--PH 1167
            LC +W  +S   N+++K +L+ FP+P+T +L  +LA      PL++ W++P                   +  ++  + ++PL FGK+ A+   H+S+ K+PVSYAHTVKA+MPI+VV+ S +  KEK S K+          +  + I  +                         R LN+   H           +    +P W+  D   FL S           T+ LL   G  NFAQNVIAF+++  ++PLSY+V N  KR++VI +S++   NPVT  N++G   ++ GV +YN TK          +LP+    L+    H S L  PH
Sbjct:   13 LCLLWYALSAGGNVVNKVILSAFPFPVTVSLCHILALCAGLPPLLRAWRVPPAPPVSGPGPSPHPSSGPLLPPRFYPRYVLPLAFGKYFASVSAHVSIWKVPVSYAHTVKATMPIWVVLLSRIIMKEKQSTKV----------LRDSRIHHL-------------------------RLLNILGCH-----------AVFFMIPTWVLVDLSAFLVSSDLTYVYQWPWTLLLLAVSGFCNFAQNVIAFSILNLVSPLSYSVANATKRIMVITVSLIMLRNPVTSTNVLGMMTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPH 303          
BLAST of slc35e1 vs. Ensembl Human
Match: SLC35E2B (solute carrier family 35 member E2B [Source:HGNC Symbol;Acc:HGNC:33941])

HSP 1 Score: 101.679 bits (252), Expect = 8.360e-23
Identity = 75/270 (27.78%), Postives = 131/270 (48.52%), Query Frame = 1
Query:  418 LGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXX---ARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEP 1218
            +G  +F       +S+  + VS+A TVK+S PIF VI S +   E   L + +SL  +  G+AL + TE+SFN +G  +A+         N+ +K+ L+    ++FS   L    +  +  M +P  +F   +  +    K    +  + + LL+ DG+L   Q+V A+ L+ KI+P++++V + +K  + I +S++ FGN +T L+ +GT     GVL+YN  +            +  L        R P  D  V   +P    + P
Sbjct:  149 VGLMRFATVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRMILGEYTGLLVNLSLIPVMGGLALCTATEISFNVLGFSAALSTNIMDCLQNVFSKKLLS-GDKYRFSAPELQFYTSAAAVAMLVPARVFFTDVPVIGRSGKSFSYNQDVVL-LLLTDGVLFHLQSVTAYALMGKISPVTFSVASTVKHALSIWLSVIVFGNKITSLSAVGTALVTVGVLLYNKARQH---------QQEALQSLAAATGRAP--DDTVEPLLPQDPRQHP 405          
BLAST of slc35e1 vs. Ensembl Human
Match: SLC35E2B (solute carrier family 35 member E2B [Source:HGNC Symbol;Acc:HGNC:33941])

HSP 1 Score: 101.679 bits (252), Expect = 8.360e-23
Identity = 75/270 (27.78%), Postives = 131/270 (48.52%), Query Frame = 1
Query:  418 LGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXX---ARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEP 1218
            +G  +F       +S+  + VS+A TVK+S PIF VI S +   E   L + +SL  +  G+AL + TE+SFN +G  +A+         N+ +K+ L+    ++FS   L    +  +  M +P  +F   +  +    K    +  + + LL+ DG+L   Q+V A+ L+ KI+P++++V + +K  + I +S++ FGN +T L+ +GT     GVL+YN  +            +  L        R P  D  V   +P    + P
Sbjct:  149 VGLMRFATVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRMILGEYTGLLVNLSLIPVMGGLALCTATEISFNVLGFSAALSTNIMDCLQNVFSKKLLS-GDKYRFSAPELQFYTSAAAVAMLVPARVFFTDVPVIGRSGKSFSYNQDVVL-LLLTDGVLFHLQSVTAYALMGKISPVTFSVASTVKHALSIWLSVIVFGNKITSLSAVGTALVTVGVLLYNKARQH---------QQEALQSLAAATGRAP--DDTVEPLLPQDPRQHP 405          
BLAST of slc35e1 vs. Ensembl Human
Match: SLC35E1 (solute carrier family 35 member E1 [Source:HGNC Symbol;Acc:HGNC:20803])

HSP 1 Score: 77.7962 bits (190), Expect = 8.328e-17
Identity = 42/105 (40.00%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  856 TISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATT---ILPIHKTKLNGSIVHNSRL 1161
            T+ LL   G  NFAQNVIAF+++  ++PLSY+V N  KR++VI +S++   NPVT  N++G   ++ GV +YN TK          +LP+    L+    H S L
Sbjct:   12 TLLLLAVSGFCNFAQNVIAFSILNLVSPLSYSVANATKRIMVITVSLIMLRNPVTSTNVLGMMTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPL 116          
BLAST of slc35e1 vs. Ensembl Celegans
Match: Y47G6A.7 (pep chromosome:WBcel235:I:3502738:3508421:1 gene:WBGene00021637.1 transcript:Y47G6A.7a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y47G6A.7)

HSP 1 Score: 51.9878 bits (123), Expect = 6.317e-7
Identity = 48/251 (19.12%), Postives = 112/251 (44.62%), Query Frame = 1
Query:  382 ISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLP----IWIFNDGLV---FLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILP 1113
            +S++  ++ + P+G    M    ++ ++  + VS     K+S  +F+V FS L   E++   +     +I +G+ L +      +  GL+   +A A       +++  +          L ++A +   M +P    IW+F    +    ++S   H   D  + + L+   G+L F   +  + L+   + ++  +  ++K +  ++++ +   + +T LN+ G    + G+L++ M K   +A   LP
Sbjct:  140 VSFRDQLRWLAPIGICASMDIGLSNWALEYVTVSLYTMAKSSSILFIVAFSLLLRLERWRNSLGFETGLIAAGLFLFTWKSSQLDLTGLMLVELAAACTGIRWTVSQMVMQRDDSAVRHPLDMVAHVQPWMMIPIIPMIWLFEGAEINWNSVFSFKGH--YDPWLVMGLIAGGGLLAFCMEMSEYLLLVNTSGITLNIFGIVKEVATLLLAHIVNKDTLTELNICGLVLCLSGMLLHGMNKRHQRAHRPLP 388          
BLAST of slc35e1 vs. Ensembl Celegans
Match: Y47G6A.7 (pep chromosome:WBcel235:I:3502738:3508421:1 gene:WBGene00021637.1 transcript:Y47G6A.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y47G6A.7)

HSP 1 Score: 51.9878 bits (123), Expect = 6.317e-7
Identity = 48/251 (19.12%), Postives = 112/251 (44.62%), Query Frame = 1
Query:  382 ISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLP----IWIFNDGLV---FLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILP 1113
            +S++  ++ + P+G    M    ++ ++  + VS     K+S  +F+V FS L   E++   +     +I +G+ L +      +  GL+   +A A       +++  +          L ++A +   M +P    IW+F    +    ++S   H   D  + + L+   G+L F   +  + L+   + ++  +  ++K +  ++++ +   + +T LN+ G    + G+L++ M K   +A   LP
Sbjct:  140 VSFRDQLRWLAPIGICASMDIGLSNWALEYVTVSLYTMAKSSSILFIVAFSLLLRLERWRNSLGFETGLIAAGLFLFTWKSSQLDLTGLMLVELAAACTGIRWTVSQMVMQRDDSAVRHPLDMVAHVQPWMMIPIIPMIWLFEGAEINWNSVFSFKGH--YDPWLVMGLIAGGGLLAFCMEMSEYLLLVNTSGITLNIFGIVKEVATLLLAHIVNKDTLTELNICGLVLCLSGMLLHGMNKRHQRAHRPLP 388          
BLAST of slc35e1 vs. Ensembl Fly
Match: CG14621 (gene:FBgn0031183 transcript:FBtr0339557)

HSP 1 Score: 216.468 bits (550), Expect = 1.358e-65
Identity = 138/346 (39.88%), Postives = 222/346 (64.16%), Query Frame = 1
Query:  190 NIVTALVLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKM--KGKATTILPIHKTK-LNGSIVHNSRLPHIDSNVVLCIPNGLTEEP 1218
            +I   L++C  W +IS  NN+I K +LN FP+P+T TL QL +  + + P   +W+I +  ++DI   Y  ++I+PL  GK +A+  +HIS+ K+PVSYAHTVKA+MP+F V+ + +F+ EK    +Y+SL  I +G+ +A++TE+SF+ +GL+SA+I+T  F+  NI +K+ L  T++H   LL LL ++S  +FLP+W++ D    ++  T    LD  + I+LL ADG+LN+ QN+IAF++++ +TPL+YAV +  KR+ VI +S+L  GNPVT +N +G   ++ GVL YN  K   +G+    LP+ +T  +  S +     P+   +V   + NGL   P
Sbjct:   10 HIAVVLLMCLFWYVISSSNNVIGKMVLNEFPFPMTVTLVQLCSITLYSGPFFNLWRIRK--YQDIPRPYYYRLIVPLALGKLLASVTSHISLWKVPVSYAHTVKATMPLFTVVLTRVFFGEKQPTLVYLSLLPIITGVGIATVTEISFDMMGLISALISTMGFSMQNIFSKKVLKDTNIHHLRLLHLLGKLSLFIFLPLWLYMDSFA-VFRHTAIKNLDYRV-IALLFADGVLNWLQNIIAFSVLSLVTPLTYAVASASKRIFVIAVSLLILGNPVTWVNCVGMTLAIVGVLCYNRAKQLTRGREQPTLPLSQTSYVKYSPLEQQADPYYRGSVNGKLSNGLHRTP 351          
BLAST of slc35e1 vs. Ensembl Fly
Match: CG14621 (gene:FBgn0031183 transcript:FBtr0342876)

HSP 1 Score: 216.468 bits (550), Expect = 1.358e-65
Identity = 138/346 (39.88%), Postives = 222/346 (64.16%), Query Frame = 1
Query:  190 NIVTALVLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKM--KGKATTILPIHKTK-LNGSIVHNSRLPHIDSNVVLCIPNGLTEEP 1218
            +I   L++C  W +IS  NN+I K +LN FP+P+T TL QL +  + + P   +W+I +  ++DI   Y  ++I+PL  GK +A+  +HIS+ K+PVSYAHTVKA+MP+F V+ + +F+ EK    +Y+SL  I +G+ +A++TE+SF+ +GL+SA+I+T  F+  NI +K+ L  T++H   LL LL ++S  +FLP+W++ D    ++  T    LD  + I+LL ADG+LN+ QN+IAF++++ +TPL+YAV +  KR+ VI +S+L  GNPVT +N +G   ++ GVL YN  K   +G+    LP+ +T  +  S +     P+   +V   + NGL   P
Sbjct:   10 HIAVVLLMCLFWYVISSSNNVIGKMVLNEFPFPMTVTLVQLCSITLYSGPFFNLWRIRK--YQDIPRPYYYRLIVPLALGKLLASVTSHISLWKVPVSYAHTVKATMPLFTVVLTRVFFGEKQPTLVYLSLLPIITGVGIATVTEISFDMMGLISALISTMGFSMQNIFSKKVLKDTNIHHLRLLHLLGKLSLFIFLPLWLYMDSFA-VFRHTAIKNLDYRV-IALLFADGVLNWLQNIIAFSVLSLVTPLTYAVASASKRIFVIAVSLLILGNPVTWVNCVGMTLAIVGVLCYNRAKQLTRGREQPTLPLSQTSYVKYSPLEQQADPYYRGSVNGKLSNGLHRTP 351          
BLAST of slc35e1 vs. Ensembl Fly
Match: CG14621 (gene:FBgn0031183 transcript:FBtr0077344)

HSP 1 Score: 216.468 bits (550), Expect = 1.358e-65
Identity = 138/346 (39.88%), Postives = 222/346 (64.16%), Query Frame = 1
Query:  190 NIVTALVLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKM--KGKATTILPIHKTK-LNGSIVHNSRLPHIDSNVVLCIPNGLTEEP 1218
            +I   L++C  W +IS  NN+I K +LN FP+P+T TL QL +  + + P   +W+I +  ++DI   Y  ++I+PL  GK +A+  +HIS+ K+PVSYAHTVKA+MP+F V+ + +F+ EK    +Y+SL  I +G+ +A++TE+SF+ +GL+SA+I+T  F+  NI +K+ L  T++H   LL LL ++S  +FLP+W++ D    ++  T    LD  + I+LL ADG+LN+ QN+IAF++++ +TPL+YAV +  KR+ VI +S+L  GNPVT +N +G   ++ GVL YN  K   +G+    LP+ +T  +  S +     P+   +V   + NGL   P
Sbjct:   10 HIAVVLLMCLFWYVISSSNNVIGKMVLNEFPFPMTVTLVQLCSITLYSGPFFNLWRIRK--YQDIPRPYYYRLIVPLALGKLLASVTSHISLWKVPVSYAHTVKATMPLFTVVLTRVFFGEKQPTLVYLSLLPIITGVGIATVTEISFDMMGLISALISTMGFSMQNIFSKKVLKDTNIHHLRLLHLLGKLSLFIFLPLWLYMDSFA-VFRHTAIKNLDYRV-IALLFADGVLNWLQNIIAFSVLSLVTPLTYAVASASKRIFVIAVSLLILGNPVTWVNCVGMTLAIVGVLCYNRAKQLTRGREQPTLPLSQTSYVKYSPLEQQADPYYRGSVNGKLSNGLHRTP 351          
BLAST of slc35e1 vs. Ensembl Fly
Match: CG14621 (gene:FBgn0031183 transcript:FBtr0339558)

HSP 1 Score: 154.066 bits (388), Expect = 3.661e-43
Identity = 92/240 (38.33%), Postives = 151/240 (62.92%), Query Frame = 1
Query:  508 MPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKM--KGKATTILPIHKTK-LNGSIVHNSRLPHIDSNVVLCIPNGLTEEP 1218
            MP+F V+ + +F+ EK    +Y+SL  I +G+ +A++TE+SF+ +GL+SA+I+T  F+  NI +K+ L  T++H   LL LL ++S  +FLP+W++ D    ++  T    LD  + I+LL ADG+LN+ QN+IAF++++ +TPL+YAV +  KR+ VI +S+L  GNPVT +N +G   ++ GVL YN  K   +G+    LP+ +T  +  S +     P+   +V   + NGL   P
Sbjct:    1 MPLFTVVLTRVFFGEKQPTLVYLSLLPIITGVGIATVTEISFDMMGLISALISTMGFSMQNIFSKKVLKDTNIHHLRLLHLLGKLSLFIFLPLWLYMDSFA-VFRHTAIKNLDYRV-IALLFADGVLNWLQNIIAFSVLSLVTPLTYAVASASKRIFVIAVSLLILGNPVTWVNCVGMTLAIVGVLCYNRAKQLTRGREQPTLPLSQTSYVKYSPLEQQADPYYRGSVNGKLSNGLHRTP 238          
BLAST of slc35e1 vs. Ensembl Zebrafish
Match: slc35e1 (solute carrier family 35 member E1 [Source:ZFIN;Acc:ZDB-GENE-040426-2033])

HSP 1 Score: 199.904 bits (507), Expect = 4.183e-59
Identity = 133/339 (39.23%), Postives = 198/339 (58.41%), Query Frame = 1
Query:  208 VLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKM-------KG----KATTILPIHKTKLN--GSIVHNSRLPHIDSNVV 1185
            VLC  W  +S   N+I+K +LN+FPYP+T +L  +++  +   PL++ W +P     ++  +Y    I+PL FGK+ A+   H S+ K+PVSYAHTVKA+MPI+VV+ S +  KEK + K+Y+SL  I  G+ LA++TE+SF+  GL+SA+ AT  F+  NI +K+ L  T +H   LL +L   + L  LP WI  D   FL           + T+ LL+  G  NFAQN+IAF+++  ++PLSYAV N  KR++VI +S+L   NPV   N+IG   ++ GV +YN  K        KG     A  ++   K + N  G+  H+S   H  S V+
Sbjct:   18 VLCLCWYTVSSGGNVINKIILNSFPYPVTVSLFHIVSIIVFLPPLLRAWGVPR---TELPARYYRWYILPLAFGKYFASVSAHFSIWKVPVSYAHTVKATMPIWVVLLSRIIMKEKQTTKVYVSLIPIIGGVLLATVTELSFDMSGLISALAATLCFSLQNIFSKKVLRDTRIHHLHLLNILGFNALLFMLPTWILVDLSSFLMDGDLSEVSSWTGTLMLLLISGFCNFAQNMIAFSVLNLVSPLSYAVANATKRIMVISISLLMLRNPVNTSNIIGMMTAILGVFLYNKAKYDSNQEAKKGLLPVSAQDVVSFDKPQSNGTGAFTHSSDFQHGRSTVL 353          
BLAST of slc35e1 vs. Ensembl Zebrafish
Match: SLC35E2A (solute carrier family 35 member E2B [Source:NCBI gene;Acc:100331662])

HSP 1 Score: 82.8037 bits (203), Expect = 8.521e-17
Identity = 68/226 (30.09%), Postives = 111/226 (49.12%), Query Frame = 1
Query:  418 LGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFS---XXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKM 1086
            +G  +F       +S+  + VS+A TVK+S PIF VI S L   E Y+  + +SLSV                             F+  N+ +K+ L+    ++FS   L    +  + +M +P WIF      +    +  KL   I + LL+ DG L   Q+V A+ L+ +I+P++++V + +K  + I +SI+ F NP+TV++ IGT     GVL+YN  K 
Sbjct:  128 VGLMRFTTVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRLILGE-YT-GVMLSLSV-----------------------------FSLQNVFSKKLLS-GDKYKFSPPELQFYTSAFAVIMLIPAWIFLMDFPGIGKSERSFKLSQDIVV-LLLLDGALFHLQSVTAYALMGRISPVTFSVASTVKHALSIWLSIIVFSNPITVVSAIGTLMVFVGVLLYNKAKQ 320          
BLAST of slc35e1 vs. Ensembl Xenopus
Match: slc35e1 (solute carrier family 35 member E1 [Source:NCBI gene;Acc:549138])

HSP 1 Score: 163.31 bits (412), Expect = 3.217e-45
Identity = 127/372 (34.14%), Postives = 190/372 (51.08%), Query Frame = 1
Query:  196 VTALVLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAY--PLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKAT---TILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNG----------LTEE-PYLRKPEKRFHNAIDI 1263
            V   VLC +W  +S   N+++K +LN FPYP+T +L  +LA  IC +  PL++ W +P      +  +Y    IIPL FGK+ A+   H S+ K+PVSYAHTV A +                   +Y+SL  I  G+ LA++TE+SF+  GL+SA+ AT  F+  NI +K+ L  + +H   LL LL   +    +P W+  D   FL      S      T+ LL+  G  NFAQN+IAF+++  I+PLSY+V N  KR++VI +S++   NPVT  N++G   ++ GV +YN  K          +LP+   +L     H+   P    N +     G          LT+   Y R+     HN  D+
Sbjct:   22 VRVAVLCLLWYSVSSGGNVVNKIILNGFPYPVTVSLFHILA--ICCFLPPLLRAWGVPH---TQLPTRYYRWYIIPLAFGKYFASVSAHFSIWKVPVSYAHTVWAPL-------------------VYLSLVPIIGGVLLATVTEISFDMWGLISALAATLCFSLQNIFSKKVLRDSRIHHLRLLNLLGCHAIFFMIPTWVLLDLSSFLVESDLSSVSQWPWTLLLLVISGTCNFAQNLIAFSILNLISPLSYSVANATKRIMVITVSLIMLRNPVTGTNVLGMMTAILGVFLYNKAKYDANQEAKKQLLPVTSGELQD---HHHGPPEKQQNGMATFSPGRDYQYGRTNVLTDHFQYSRQSHPTAHNRYDV 366          
BLAST of slc35e1 vs. Ensembl Xenopus
Match: SLC35E2B (solute carrier family 35 member E2B [Source:HGNC Symbol;Acc:HGNC:33941])

HSP 1 Score: 112.464 bits (280), Expect = 1.288e-26
Identity = 74/229 (32.31%), Postives = 128/229 (55.90%), Query Frame = 1
Query:  418 LGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFS---XXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGK 1095
            +G  +F+      IS+  + VS+A TVK+S PIF VI S L   E   + + +SL  + +G+AL + TE+SFN VG  +A+         N+ +K+ L+    ++FS   L    +  + +M +P WIF   +  +    K    +  I + LLI DG+L   Q++ A+ L+ KI+P++++V + +K  + I +SI+ FGN +T L+ +GT   + GVL+YN  + + +
Sbjct:  145 VGLMRFVTVVLGLISLKNVAVSFAETVKSSAPIFTVIMSRLILGEYTGMMVNLSLLPVMAGLALCTATELSFNIVGFSAALSTNIMDCLQNVFSKKLLS-GDKYRFSPPELQFYTSAAAVIMLIPAWIFMMDMPLIGKSGKSFHYNWDIIVLLLI-DGVLFHLQSITAYALMGKISPVTFSVASTVKHALSIWLSIIIFGNKITSLSAVGTVLVIIGVLLYNKARQRQR 371          
BLAST of slc35e1 vs. Ensembl Xenopus
Match: SLC35E2B (solute carrier family 35 member E2B [Source:HGNC Symbol;Acc:HGNC:33941])

HSP 1 Score: 112.464 bits (280), Expect = 1.710e-26
Identity = 74/230 (32.17%), Postives = 128/230 (55.65%), Query Frame = 1
Query:  418 LGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFS---XXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKA 1098
            +G  +F+      IS+  + VS+A TVK+S PIF VI S L   E   + + +SL  + +G+AL + TE+SFN VG  +A+         N+ +K+ L+    ++FS   L    +  + +M +P WIF   +  +    K    +  I + LLI DG+L   Q++ A+ L+ KI+P++++V + +K  + I +SI+ FGN +T L+ +GT   + GVL+YN  + + + 
Sbjct:  152 VGLMRFVTVVLGLISLKNVAVSFAETVKSSAPIFTVIMSRLILGEYTGMMVNLSLLPVMAGLALCTATELSFNIVGFSAALSTNIMDCLQNVFSKKLLS-GDKYRFSPPELQFYTSAAAVIMLIPAWIFMMDMPLIGKSGKSFHYNWDIIVLLLI-DGVLFHLQSITAYALMGKISPVTFSVASTVKHALSIWLSIIIFGNKITSLSAVGTVLVIIGVLLYNKARQRQRE 379          
BLAST of slc35e1 vs. Ensembl Xenopus
Match: SLC35E2B (solute carrier family 35 member E2B [Source:HGNC Symbol;Acc:HGNC:33941])

HSP 1 Score: 112.079 bits (279), Expect = 1.780e-26
Identity = 74/229 (32.31%), Postives = 128/229 (55.90%), Query Frame = 1
Query:  418 LGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFS---XXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGK 1095
            +G  +F+      IS+  + VS+A TVK+S PIF VI S L   E   + + +SL  + +G+AL + TE+SFN VG  +A+         N+ +K+ L+    ++FS   L    +  + +M +P WIF   +  +    K    +  I + LLI DG+L   Q++ A+ L+ KI+P++++V + +K  + I +SI+ FGN +T L+ +GT   + GVL+YN  + + +
Sbjct:  141 VGLMRFVTVVLGLISLKNVAVSFAETVKSSAPIFTVIMSRLILGEYTGMMVNLSLLPVMAGLALCTATELSFNIVGFSAALSTNIMDCLQNVFSKKLLS-GDKYRFSPPELQFYTSAAAVIMLIPAWIFMMDMPLIGKSGKSFHYNWDIIVLLLI-DGVLFHLQSITAYALMGKISPVTFSVASTVKHALSIWLSIIIFGNKITSLSAVGTVLVIIGVLLYNKARQRQR 367          
BLAST of slc35e1 vs. Ensembl Mouse
Match: Slc35e1 (solute carrier family 35, member E1 [Source:MGI Symbol;Acc:MGI:2142403])

HSP 1 Score: 190.274 bits (482), Expect = 5.255e-55
Identity = 132/384 (34.38%), Postives = 206/384 (53.65%), Query Frame = 1
Query:  208 VLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKD-------------ISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATT---ILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEPYLRKPEKRFHNAIDII*HGNY-YQNYWFIEH 1308
            VLC +W  +S   N+++K +L+ FP+P+T +L  +LA      PL++ W++P                   +  ++  + ++PL FGK+ A+   H+S+ K+PVSYAHTVKA+MPI+VV+ S +  KEK S K+Y+SL  I SG+ LA++TE+SF+  GL+SA+ AT  F+  NI +K+ L  + +H   LL +L   +    +P W+  D   FL S           T+ LL   G  NFAQNVIAF+++  I+PLSY+V N  KR++VI +S++   NPVT  N++G   ++ GV +YN TK          +LPI  +                          L+   +LR P ++ HN       G++ Y+N    +H
Sbjct:   32 VLCLLWYALSAGGNVVNKVILSAFPFPVTVSLCHILALCAGLPPLLRAWRVPPAPPVSGPGPGPHPASGPLLPPRFYPRYVLPLAFGKYFASVSAHVSIWKVPVSYAHTVKATMPIWVVLLSRIIMKEKQSTKVYLSLVPIISGVLLATVTELSFDVWGLVSALAATLCFSLQNIFSKKVLRDSRIHHLRLLNILGCHAVFFMIPTWVLVDLSTFLVSSDLAYVSQWPWTLLLLAVSGFCNFAQNVIAFSILNLISPLSYSVANATKRIMVITVSLIMLRNPVTSTNVLGMMTAILGVFLYNKTKYDANQQARRHLLPISTSD-------------------------LSSREHLRSPVEKPHNGALFPQQGDFQYRNILLTDH 390          
BLAST of slc35e1 vs. Ensembl Mouse
Match: Slc35e2 (solute carrier family 35, member E2 [Source:MGI Symbol;Acc:MGI:2444240])

HSP 1 Score: 102.834 bits (255), Expect = 2.109e-23
Identity = 82/296 (27.70%), Postives = 140/296 (47.30%), Query Frame = 1
Query:  394 YIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSX---XXXXARISTLMFLPIWIF--------NDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEPYLRKPEKRFH 1248
            +I+ M+  +G  +F       +S+  + VS+A TVK+S PIF VI S +   E   L + +SL  +  G+AL + TE+SFN +G  +A+         N+ +K+ L+    ++FS        +  +  + +P W F          G  F YS+           + LL+ DG L   Q+V A+ L+ KI+P++++V + +K  + I +SI+ FGN +T L+ IGT     GVL+YN  +   + T         +   +   SR P  D+            EP + +  ++ H
Sbjct:  142 FIMTMLF-VGLMRFATVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRMILGEYTGLLVNLSLIPVMGGLALCTATEISFNILGFSAALSTNIMDCLQNVFSKKLLS-GDKYRFSAPELQFYTSAAAVALLIPAWTFFMDIPVIGRSGKSFSYSQD---------IVLLLLTDGALFHLQSVTAYALMGKISPVTFSVASTVKHALSIWLSIIVFGNKITSLSAIGTILVTLGVLLYNKARQYQQET---------MQSLVTATSRNPEDDT------------EPLVPQDSRQHH 405          
BLAST of slc35e1 vs. Ensembl Mouse
Match: Slc35e2 (solute carrier family 35, member E2 [Source:MGI Symbol;Acc:MGI:2444240])

HSP 1 Score: 102.834 bits (255), Expect = 2.109e-23
Identity = 82/296 (27.70%), Postives = 140/296 (47.30%), Query Frame = 1
Query:  394 YIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSX---XXXXARISTLMFLPIWIF--------NDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEPYLRKPEKRFH 1248
            +I+ M+  +G  +F       +S+  + VS+A TVK+S PIF VI S +   E   L + +SL  +  G+AL + TE+SFN +G  +A+         N+ +K+ L+    ++FS        +  +  + +P W F          G  F YS+           + LL+ DG L   Q+V A+ L+ KI+P++++V + +K  + I +SI+ FGN +T L+ IGT     GVL+YN  +   + T         +   +   SR P  D+            EP + +  ++ H
Sbjct:  142 FIMTMLF-VGLMRFATVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRMILGEYTGLLVNLSLIPVMGGLALCTATEISFNILGFSAALSTNIMDCLQNVFSKKLLS-GDKYRFSAPELQFYTSAAAVALLIPAWTFFMDIPVIGRSGKSFSYSQD---------IVLLLLTDGALFHLQSVTAYALMGKISPVTFSVASTVKHALSIWLSIIVFGNKITSLSAIGTILVTLGVLLYNKARQYQQET---------MQSLVTATSRNPEDDT------------EPLVPQDSRQHH 405          
BLAST of slc35e1 vs. Ensembl Mouse
Match: Slc35e2 (solute carrier family 35, member E2 [Source:MGI Symbol;Acc:MGI:2444240])

HSP 1 Score: 102.834 bits (255), Expect = 2.109e-23
Identity = 82/296 (27.70%), Postives = 140/296 (47.30%), Query Frame = 1
Query:  394 YIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSX---XXXXARISTLMFLPIWIF--------NDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEPYLRKPEKRFH 1248
            +I+ M+  +G  +F       +S+  + VS+A TVK+S PIF VI S +   E   L + +SL  +  G+AL + TE+SFN +G  +A+         N+ +K+ L+    ++FS        +  +  + +P W F          G  F YS+           + LL+ DG L   Q+V A+ L+ KI+P++++V + +K  + I +SI+ FGN +T L+ IGT     GVL+YN  +   + T         +   +   SR P  D+            EP + +  ++ H
Sbjct:  142 FIMTMLF-VGLMRFATVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRMILGEYTGLLVNLSLIPVMGGLALCTATEISFNILGFSAALSTNIMDCLQNVFSKKLLS-GDKYRFSAPELQFYTSAAAVALLIPAWTFFMDIPVIGRSGKSFSYSQD---------IVLLLLTDGALFHLQSVTAYALMGKISPVTFSVASTVKHALSIWLSIIVFGNKITSLSAIGTILVTLGVLLYNKARQYQQET---------MQSLVTATSRNPEDDT------------EPLVPQDSRQHH 405          
BLAST of slc35e1 vs. UniProt/SwissProt
Match: sp|Q9VR50|S35E1_DROME (Solute carrier family 35 member E1 homolog OS=Drosophila melanogaster OX=7227 GN=CG14621 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.361e-64
Identity = 138/346 (39.88%), Postives = 222/346 (64.16%), Query Frame = 1
Query:  190 NIVTALVLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKM--KGKATTILPIHKTK-LNGSIVHNSRLPHIDSNVVLCIPNGLTEEP 1218
            +I   L++C  W +IS  NN+I K +LN FP+P+T TL QL +  + + P   +W+I +  ++DI   Y  ++I+PL  GK +A+  +HIS+ K+PVSYAHTVKA+MP+F V+ + +F+ EK    +Y+SL  I +G+ +A++TE+SF+ +GL+SA+I+T  F+  NI +K+ L  T++H   LL LL ++S  +FLP+W++ D    ++  T    LD  + I+LL ADG+LN+ QN+IAF++++ +TPL+YAV +  KR+ VI +S+L  GNPVT +N +G   ++ GVL YN  K   +G+    LP+ +T  +  S +     P+   +V   + NGL   P
Sbjct:   10 HIAVVLLMCLFWYVISSSNNVIGKMVLNEFPFPMTVTLVQLCSITLYSGPFFNLWRIRK--YQDIPRPYYYRLIVPLALGKLLASVTSHISLWKVPVSYAHTVKATMPLFTVVLTRVFFGEKQPTLVYLSLLPIITGVGIATVTEISFDMMGLISALISTMGFSMQNIFSKKVLKDTNIHHLRLLHLLGKLSLFIFLPLWLYMDSFA-VFRHTAIKNLDYRV-IALLFADGVLNWLQNIIAFSVLSLVTPLTYAVASASKRIFVIAVSLLILGNPVTWVNCVGMTLAIVGVLCYNRAKQLTRGREQPTLPLSQTSYVKYSPLEQQADPYYRGSVNGKLSNGLHRTP 351          
BLAST of slc35e1 vs. UniProt/SwissProt
Match: sp|P0C6B1|S35E1_RAT (Solute carrier family 35 member E1 OS=Rattus norvegicus OX=10116 GN=Slc35e1 PE=3 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 6.181e-56
Identity = 130/383 (33.94%), Postives = 206/383 (53.79%), Query Frame = 1
Query:  211 LCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKD-------------ISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATT---ILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEPYLRKPEKRFHNAIDII*HGNY-YQNYWFIEH 1308
            LC +W  +S   N+++K +L+ FP+P+T +L  +LA      PL++ W++P                   +  ++  + ++PL FGK+ A+   H+S+ K+PVSYAHTVKA+MPI+VV+ S +  KEK S K+Y+SL  I SG+ LA++TE+SF+  GL+SA+ AT  F+  NI +K+ L  + +H   LL +L   +    +P W+  D   FL S           T+ LL+  G  NFAQNVIAF+++  I+PLSY+V N  KR++VI +S++   NPVT  N++G   ++ GV +YN TK          +LP+  +                          L+   +LR P ++ HN       G++ Y+N    +H
Sbjct:   33 LCLLWYALSAGGNVVNKVILSAFPFPVTVSLCHILALCAGLPPLLRAWRVPPAPPVSGPGPSPHPASGPLLPPRFYPRYVLPLAFGKYFASVSAHVSIWKVPVSYAHTVKATMPIWVVLLSRIIMKEKQSTKVYLSLVPIISGVLLATVTELSFDVWGLVSALAATLCFSLQNIFSKKVLRDSRIHHLRLLNILGCHAVFFMIPTWVLVDLSTFLVSSDLAYVSQWPWTLLLLVVSGFCNFAQNVIAFSILNLISPLSYSVANATKRIMVIAVSLIMLRNPVTSTNVLGMMTAILGVFLYNKTKYDANQQARRHLLPVSTSD-------------------------LSNREHLRSPMEKPHNGALFPQQGDFQYRNILLTDH 390          
BLAST of slc35e1 vs. UniProt/SwissProt
Match: sp|Q96K37|S35E1_HUMAN (Solute carrier family 35 member E1 OS=Homo sapiens OX=9606 GN=SLC35E1 PE=1 SV=2)

HSP 1 Score: 194.126 bits (492), Expect = 9.942e-56
Identity = 125/337 (37.09%), Postives = 193/337 (57.27%), Query Frame = 1
Query:  211 LCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKD-------------ISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATT---ILPIHKTKLNGSIVHNSRL--PH 1167
            LC +W  +S   N+++K +L+ FP+P+T +L  +LA      PL++ W++P                   +  ++  + ++PL FGK+ A+   H+S+ K+PVSYAHTVKA+MPI+VV+ S +  KEK S K+Y+SL  I SG+ LA++TE+SF+  GL+SA+ AT  F+  NI +K+ L  + +H   LL +L   +    +P W+  D   FL S           T+ LL   G  NFAQNVIAF+++  ++PLSY+V N  KR++VI +S++   NPVT  N++G   ++ GV +YN TK          +LP+    L+    H S L  PH
Sbjct:   33 LCLLWYALSAGGNVVNKVILSAFPFPVTVSLCHILALCAGLPPLLRAWRVPPAPPVSGPGPSPHPSSGPLLPPRFYPRYVLPLAFGKYFASVSAHVSIWKVPVSYAHTVKATMPIWVVLLSRIIMKEKQSTKVYLSLIPIISGVLLATVTELSFDMWGLVSALAATLCFSLQNIFSKKVLRDSRIHHLRLLNILGCHAVFFMIPTWVLVDLSAFLVSSDLTYVYQWPWTLLLLAVSGFCNFAQNVIAFSILNLVSPLSYSVANATKRIMVITVSLIMLRNPVTSTNVLGMMTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPH 369          
BLAST of slc35e1 vs. UniProt/SwissProt
Match: sp|Q8CD26|S35E1_MOUSE (Solute carrier family 35 member E1 OS=Mus musculus OX=10090 GN=Slc35e1 PE=1 SV=2)

HSP 1 Score: 190.274 bits (482), Expect = 3.676e-54
Identity = 132/384 (34.38%), Postives = 206/384 (53.65%), Query Frame = 1
Query:  208 VLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKD-------------ISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATT---ILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEPYLRKPEKRFHNAIDII*HGNY-YQNYWFIEH 1308
            VLC +W  +S   N+++K +L+ FP+P+T +L  +LA      PL++ W++P                   +  ++  + ++PL FGK+ A+   H+S+ K+PVSYAHTVKA+MPI+VV+ S +  KEK S K+Y+SL  I SG+ LA++TE+SF+  GL+SA+ AT  F+  NI +K+ L  + +H   LL +L   +    +P W+  D   FL S           T+ LL   G  NFAQNVIAF+++  I+PLSY+V N  KR++VI +S++   NPVT  N++G   ++ GV +YN TK          +LPI  +                          L+   +LR P ++ HN       G++ Y+N    +H
Sbjct:   32 VLCLLWYALSAGGNVVNKVILSAFPFPVTVSLCHILALCAGLPPLLRAWRVPPAPPVSGPGPGPHPASGPLLPPRFYPRYVLPLAFGKYFASVSAHVSIWKVPVSYAHTVKATMPIWVVLLSRIIMKEKQSTKVYLSLVPIISGVLLATVTELSFDVWGLVSALAATLCFSLQNIFSKKVLRDSRIHHLRLLNILGCHAVFFMIPTWVLVDLSTFLVSSDLAYVSQWPWTLLLLAVSGFCNFAQNVIAFSILNLISPLSYSVANATKRIMVITVSLIMLRNPVTSTNVLGMMTAILGVFLYNKTKYDANQQARRHLLPISTSD-------------------------LSSREHLRSPVEKPHNGALFPQQGDFQYRNILLTDH 390          
BLAST of slc35e1 vs. UniProt/SwissProt
Match: sp|Q5VQL3|PPT3_ORYSJ (Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT3 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 4.222e-33
Identity = 83/247 (33.60%), Postives = 141/247 (57.09%), Query Frame = 1
Query:  349 IWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTH--MHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTK 1083
            +W +       IS   + K I PL  G  +    T++S+SK+ VS+ HT+KAS P F V+ S  F  E  SL +  SL  I  G+ALAS+TE+SFN +G  SA+ +   +   N+L+K+ L      +   +L  +L  +S L+ LP+ +F++G+ F     + + L+L          G        +++ ++A+++P++++V N +KR+VVIV S+LFF  P++ +N +GTG ++GGV +Y+  K
Sbjct:  141 MWALKLHPAPRISISQLAK-IAPLAAGHMLGTVFTNMSLSKVAVSFTHTIKASEPFFTVLLSAFFLGETPSLLVLGSLVPIVGGVALASLTELSFNWIGFWSAMASNLLYQSRNVLSKKLLGGEEEALDDINLFSILTILSFLLSLPLMLFSEGVKFSPGYLRSTGLNLQELCVRAALAGFCFHGYQKLSYLILARVSPVTHSVANCVKRVVVIVASVLFFRTPISPVNALGTGVALGGVFLYSRLK 386          
BLAST of slc35e1 vs. TrEMBL
Match: A0A0H3YFA1 (Slc35e1 OS=Schmidtea mediterranea OX=79327 GN=slc35e1 PE=2 SV=1)

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 400/400 (100.00%), Postives = 400/400 (100.00%), Query Frame = 1
Query:   67 MKNALLPIRRSRTISDSESTELPDFVSTVNSFNSNLGEDNINIVTALVLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEPYLRKPEKRFHNAIDII 1266
            MKNALLPIRRSRTISDSESTELPDFVSTVNSFNSNLGEDNINIVTALVLCTIWCIISVLNNIISKSLLNNFPYPLTSTLAQLLATAICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSLLLLLARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEPYLRKPEKRFHNAIDII
Sbjct:    1 MKNALLPIRRSRTISDSESTELPDFVSTVNSFNSNLGEDNINIVTALVLCTIWCIISVLNNIISKSLLNNFPYPLTSTLAQLLATAICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSLLLLLARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEPYLRKPEKRFHNAIDII 400          
BLAST of slc35e1 vs. TrEMBL
Match: A0A267F415 (TPT domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029801g1 PE=4 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 2.483e-76
Identity = 164/375 (43.73%), Postives = 230/375 (61.33%), Query Frame = 1
Query:   94 RSRTISDSESTELPDFVSTV---------------------NSFNSNLGEDNINIV---TALVLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTK----MKGKATTILPIHKTKLN 1134
            RSRTISD +  E+PD   +                           + G D  N +     L LC  W  +S  NNII KSLL  +PYP T+TL QLL+TA+ + PL   W++P + W  I ++Y   MI+PL FGKF+AA   HIS+ K+P+SYAHTVKASMPIFVV  S +  +E+ +  +Y+SL+ I +G+ +A++TE+SF+  GLLSA++AT +F+  N+ +K+CL  T MH   LLL+LARIS L+FLP+W+  D    L +    +  D +  + LL+ DG LNFAQNVIAFT+IA +TPLSYAV N  KR+ VI+MS++   NPVT  N +G G ++ GVL+YN  K     + +   +LP  K+  +
Sbjct:    9 RSRTISDGDDAEMPDLSESDIEDRRGGAKHSVPMVSQHPGGGDAEDDAGCDKDNAMLCCKVLFLCLCWYTVSSTNNIIGKSLLTYYPYPATATLFQLLSTALFSQPLAMYWRVPPVRWNLIGWRYYATMIVPLAFGKFIAAVSAHISIWKVPISYAHTVKASMPIFVVFLSRIILRERQTWLVYLSLTPIVTGVIIATLTELSFDITGLLSALLATLAFSLQNVFSKKCLKETRMHHIRLLLVLARISCLLFLPVWLIFDVRYVLSNWDSMAGTDWTWVVGLLLLDGFLNFAQNVIAFTMIALVTPLSYAVANASKRIAVILMSLVILQNPVTTANCVGMGMAILGVLLYNKAKYDQNREAQRIKLLPYVKSDAD 383          
BLAST of slc35e1 vs. TrEMBL
Match: A0A267EDW9 (TPT domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025499g1 PE=4 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 1.049e-75
Identity = 166/388 (42.78%), Postives = 235/388 (60.57%), Query Frame = 1
Query:   73 NALLPIRR------SRTISDSESTELPDFVSTV---------------------NSFNSNLGEDNINIV---TALVLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTK----MKGKATTILPIHKTKLN 1134
            N L+P+ +      SRTISD +  E+PD   +                           + G D  N +     L LC  W  +S  NNII KSLL  +PYP T+TL QLL+TA+ + PL   W++P + W  I ++Y   MI+PL FGKF+AA   HIS+ K+P+SYAHTVKASMPIFVV  S +  +E+ +  +Y+SL+ I +G+ +A++TE+SF+  GLLSA++AT +F+  N+ +K+CL  T MH   LLL+LARIS L+FLP+W+  D    L +    +  D +  + LL+ DG LNFAQNVIAFT+IA +TPLSYAV N  KR+ VI+MS++   NPVT  N +G G ++ GVL+YN  K     + +   +LP  K+  +
Sbjct:    1 NTLMPVFKKARFGGSRTISDGDDAEMPDLSESDIEDRRGGAKHSVPMVSQHPGGGDAEDDAGCDKDNAMLCCKVLFLCLCWYTVSSTNNIIGKSLLTYYPYPATATLFQLLSTALFSQPLAMYWRVPPVRWNLIGWRYYATMIVPLAFGKFIAAVSAHISIWKVPISYAHTVKASMPIFVVFLSRIILRERQTWLVYLSLTPIVTGVIIATLTELSFDITGLLSALLATLAFSLQNVFSKKCLKETRMHHIRLLLVLARISCLLFLPVWLIFDVRYVLSNWDSMAGTDWTWVVGLLLLDGFLNFAQNVIAFTMIALVTPLSYAVANASKRIAVILMSLVILQNPVTTANCVGMGMAILGVLLYNKAKYDQNREAQRIKLLPYVKSDAD 388          
BLAST of slc35e1 vs. TrEMBL
Match: A0A482VPS3 (Solute carrier family 35 member E1-like OS=Asbolus verrucosus OX=1661398 GN=BDFB_005479 PE=4 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 1.495e-72
Identity = 150/352 (42.61%), Postives = 229/352 (65.06%), Query Frame = 1
Query:  190 NIVTALVLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEPYLRKPEKRF 1245
             I+T L+LC +W I+S  NN+I K+LLN FPYP+T T+ QLL+  + + PL  +W I +  + DIS+KY   +I+PL FGKF+A+  +H+S+ K+PVSYAHTVKA+MP+F VI S +  KEK ++K+Y SL  I +G+A+A+ITE+SF+ +GL+SA++AT  F+ +NI +K+ L  T++H   LL +L R++ LMFLP+W+F D    L  ++     D  + I LLI DG+LN+ QN+IAF++++ +TPL+YAV N  KR+ VI +S+   GNPVT  N+ G   ++ GVL YN  K   K        + +   +++  S+    D      + NG+ +E + +KP   F
Sbjct:    9 EILTVLLLCVLWYIVSSSNNVIGKTLLNEFPYPMTMTMVQLLSITVFSGPLFNLWGIRK--YVDISWKYYFTLIVPLAFGKFIASVFSHVSIWKVPVSYAHTVKATMPLFTVILSRILMKEKQTIKVYFSLIPIITGVAIATITEISFDVIGLISALVATMGFSLMNIFSKKVLYDTNVHHLRLLHILGRLALLMFLPVWVFVDMFHLLKDDSVQYH-DYRV-IGLLIMDGVLNWLQNIIAFSVLSLVTPLTYAVANASKRIFVIAVSLFILGNPVTGPNIFGMLLAIFGVLFYNKAKYDAK--------QAEKKQTLLPYSQKSWQDRTGYTVLQNGINDEQF-KKPSNSF 347          
BLAST of slc35e1 vs. TrEMBL
Match: D6X3C6 (Solute carrier family 35 member E1 homolog-like Protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC011911 PE=4 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 6.773e-72
Identity = 142/312 (45.51%), Postives = 214/312 (68.59%), Query Frame = 1
Query:  190 NIVTALVLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKA----TTILP 1113
             I+T L+LC +W ++S  NN+I K+LLN FPYP+T T+ QLL+  + + PL  +W I +  + DIS++Y   +I+PL FGKF+A+  +H+S+ K+PVSYAHTVKA+MP+F V+ S +  KEK +L++Y SL  I +G+A+A+ITE+SF+ +GL+SA++AT  F+ +NI +K+ L+ T++H   LL +L R++ +MFLP+W+  D    L  +T   K      I LLI DG+LN+ QN+IAF++++ +TPL+YAV N  KR+ VI +S+   GNPVT  N+ G   ++ GVL+YN  K   K      TILP
Sbjct:    9 EILTVLILCVLWYVVSSSNNVIGKTLLNEFPYPMTMTMVQLLSITVFSGPLFNLWGIRK--YADISWRYYFTLIVPLAFGKFIASVFSHVSIWKVPVSYAHTVKATMPLFTVVLSRILMKEKQTLRVYFSLIPIITGVAIATITEISFDVIGLISALVATMGFSLMNIFSKKVLHDTNVHHLRLLHILGRLALVMFLPVWVLVDMFRLLKDDT--VKYHDYRVIGLLIMDGVLNWLQNIIAFSVLSLVTPLTYAVANASKRIFVIAVSLFILGNPVTGTNVFGMLLAIFGVLLYNKAKYDAKQAEKKQTILP 316          
BLAST of slc35e1 vs. Ensembl Cavefish
Match: slc35e1 (solute carrier family 35 member E1 [Source:NCBI gene;Acc:103040458])

HSP 1 Score: 197.978 bits (502), Expect = 1.827e-58
Identity = 122/311 (39.23%), Postives = 191/311 (61.41%), Query Frame = 1
Query:  208 VLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATT---ILPIHKTKL 1131
            +LC  W  +S   N+I+K +LN+FPYP+T +L  +++  +   PL++ W +P+    ++  +Y    I+PL FGK+ A+   H S+ K+PVSYAHTVKA+MPI+VV+ S +  KEK + K+Y+SL  I  G+ LA++TE+SF+ +GL+SA+ AT  F+  NI +K+ L  T +H   LL +L   + L  LP WI  D   FL         + + T+ LL+  G  NFAQN+IAF+++  ++PLSYAV N  KR++VI +S+L   NPV + N++G   ++ GV +YN  K          +LP+ +  +
Sbjct:   17 LLCLCWYTVSSGGNVINKIILNSFPYPVTVSLFHIMSIVLFLPPLLRAWGVPK---SEVPGRYYRWYILPLAFGKYFASVSAHFSIWKVPVSYAHTVKATMPIWVVLLSRIIMKEKQTTKVYVSLIPIIGGVLLATVTELSFDVLGLVSALAATLCFSLQNIFSKKVLRDTKVHHLRLLNILGFNAVLFMLPTWILVDLSSFLVDGDLSEVSNWTGTLVLLVISGFCNFAQNMIAFSVLNLVSPLSYAVANATKRIMVITISLLMLRNPVNLSNIMGMLTAILGVFLYNKAKYDANQEAKKKLLPVSEQDM 324          
BLAST of slc35e1 vs. Ensembl Cavefish
Match: SLC35E2A (solute carrier family 35 member E2B [Source:NCBI gene;Acc:103022106])

HSP 1 Score: 93.9745 bits (232), Expect = 1.568e-20
Identity = 70/231 (30.30%), Postives = 127/231 (54.98%), Query Frame = 1
Query:  418 LGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFS---XXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKAT 1101
            +G  +F       +S+  + VS+A TVK+S PIF VI S L   E     + +SL  + +G+AL + +E+SFN +G  +A+         N+ +K+ L+    ++FS   L    +  + +M +P W+F   +  +    +   L   I + LL+ DG+L   Q+V A+ L+ +I+P++++V + +K  + I +SI+ F NP+T L+ +GT   + GV++YN  K   ++T
Sbjct:  136 VGLMRFTTVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRLILGEYTGFWVNLSLFPVMAGLALCTASEISFNMLGFSAALSTNIMDCLQNVFSKKLLS-GDKYRFSPPELQFYTSAAAVIMLIPAWVFLMDIPVIGKSGRSFNLSQDI-VLLLLLDGVLFHLQSVTAYALMGRISPVTFSVASTVKHALSIWLSIIVFSNPITALSAVGTVLVVVGVMLYNKAKQIQRST 364          
BLAST of slc35e1 vs. Ensembl Cavefish
Match: ENSAMXT00000013197.2 (pep primary_assembly:Astyanax_mexicanus-2.0:15:25809036:25860556:1 gene:ENSAMXG00000012384.2 transcript:ENSAMXT00000013197.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 1.645e-9
Identity = 49/241 (20.33%), Postives = 115/241 (47.72%), Query Frame = 1
Query:  367 INWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFL---PIWIFNDGLVFLYSET--KHSKLD-LSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMY 1071
            + WK+  YK     + P      +    ++ S   + +S     K+S  +F+++FS +F  E+ +  + + + +I SG+ + ++    FN  G +  ++A+        LT+  +    +   + +  +  +  LMFL   P+++ N+GL    SE   + S+L  L  ++  L   G L F      F L+++ + L+ ++  + K +  +++++ F G+ ++ +N +G    + G+ ++
Sbjct:   75 LGWKEYLYK-----VAPTALATALDIGLSNWSFLFITISLYTMTKSSAVLFILLFSLVFKLEEPNPFLILVVILISSGLFMFTLKSTQFNLEGFIMVLLASFIGGIRWTLTQVLMQKAELGLQNPIDTMYHLQPLMFLGLFPLFVVNEGLGLSTSEKLFRVSELQPLLYSLLTLSVGGTLAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCTLLLAVGFMGDKMSTVNWLGFVVCLAGISLH 310          
BLAST of slc35e1 vs. Ensembl Cavefish
Match: ENSAMXT00000044703.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:25808986:25818566:1 gene:ENSAMXG00000012384.2 transcript:ENSAMXT00000044703.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 4.290e-7
Identity = 53/259 (20.46%), Postives = 123/259 (47.49%), Query Frame = 1
Query:  367 INWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFL---PIWIFNDGLVFLYSET--KHSKLD-LSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKM---KGKATTILPI 1116
            + WK+  YK     + P      +    ++ S   + +S     K+S  +F+++FS +F  E+ +  + + + +I SG+ + ++    FN  G +  ++A+        LT+  +    +   + +  +  +  LMFL   P+++ N+GL    SE   + S+L  L  ++  L   G L F      F L+++ + L+ ++  + K +  +++++ F G+ ++ +N +G    + G+ ++   K    KG  +++ P+
Sbjct:   75 LGWKEYLYK-----VAPTALATALDIGLSNWSFLFITISLYTMTKSSAVLFILLFSLVFKLEEPNPFLILVVILISSGLFMFTLKSTQFNLEGFIMVLLASFIGGIRWTLTQVLMQKAELGLQNPIDTMYHLQPLMFLGLFPLFVVNEGLGLSTSEKLFRVSELQPLLYSLLTLSVGGTLAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCTLLLAVGFMGDKMSTVNWLGFVVCLAGISLHVGLKTYYSKGNGSSLRPL 328          
BLAST of slc35e1 vs. Ensembl Sea Lamprey
Match: SLC35E2B (solute carrier family 35 member E2B [Source:HGNC Symbol;Acc:HGNC:33941])

HSP 1 Score: 95.1301 bits (235), Expect = 7.436e-22
Identity = 68/232 (29.31%), Postives = 120/232 (51.72%), Query Frame = 1
Query:  457 ISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSV--IFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLN-----VTHMHQF---SXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYA-VCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILPIH 1119
            + +  + VS+A TVK+S PIF V+ S     E    +  +S S+  +  G+++ + TE+ F+S+G  +A+         N+ +K+ L      + H H F    L    +  + LM +P W+    +V+L         DL+    LL+ DG L  AQ+V AF L+  I+P++++ V + +K  + I +S+L FGNPV+V++  G+   +GGV +Y+  +  G       +H
Sbjct:  109 VCLKNVAVSFAETVKSSAPIFTVLMSRFILGEHTGTQWRVSASLMPVMLGLSMCTATEVGFSSLGFSAALSTNIVDCLQNVFSKKLLRAYTYVLLHKHTFMPAELQFYTSGAAVLMMIPAWLLMTDMVWLAVPITP---DLA---GLLVTDGALFHAQSVCAFALMGYISPVTFSSVASTMKHALSIWLSVLVFGNPVSVVSAAGSALVVGGVALYSHARAHGGHGVTAAMH 334          
BLAST of slc35e1 vs. Ensembl Sea Lamprey
Match: slc35c2 (solute carrier family 35 member C2 [Source:ZFIN;Acc:ZDB-GENE-030131-2202])

HSP 1 Score: 46.2098 bits (108), Expect = 9.265e-6
Identity = 46/197 (23.35%), Postives = 95/197 (48.22%), Query Frame = 1
Query:  499 KASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASF------AFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETK---HSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGV 1062
            K++  IF+++FS +F  EK    + + + +I  G+ + +     FN  G L  ++ TASF          ILT++     H    +L  L   +   +F P++++N+G+    +E     H    L  ++  L   G+L F  +   F L+++ + L+ ++  + K +  +V++    G+ ++ LN +G G  + G+
Sbjct:  115 KSTSIIFILLFSIVFRLEKARPSLIVVVILIAGGLFMFTYESTQFNLEGFL--LVLTASFIGGIRWTLTQILTQKAELGLHNPVDALYHLQPLMLAALF-PLFLYNEGVSLACTEKLFGFHDSEVLLWSVGTLALGGVLAFGLSFSEFLLVSQTSGLTLSISGIFKEVCTLVLATHINGDIMSPLNWVGFGVCLAGI 308          
BLAST of slc35e1 vs. Ensembl Yeast
Match: SLY41 (Protein involved in ER-to-Golgi transport [Source:SGD;Acc:S000005834])

HSP 1 Score: 69.3218 bits (168), Expect = 3.960e-13
Identity = 73/277 (26.35%), Postives = 127/277 (45.85%), Query Frame = 1
Query:  391 KYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKY--SLKIYISLSVIFS---------GIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTH---------MHQFSXXXXXARISTLMFLPIWI-------------FNDGLV-FLYSETKHSKL---DLSI-TISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYN---MTKMKGKA 1098
            K ++    P+G  +F+    +H +VS +PVS  H+VKA  PI  V + Y F++ +Y  S+  Y  L +IF          G   AS  +   + +GLL A I+   F   NI  K  L +               +       +    F P+ +             F+  L+ FL  E  H      DL++ T++L+   GI +F Q ++AF LI  ++ ++Y+V N++KR+VVI ++ LF+   +    + G   ++ G+  Y+   ++K  G+ 
Sbjct:  178 KLVLMTTFPMGIFQFIGHITSHKAVSMIPVSLVHSVKALSPIITVGY-YKFFEHRYYNSMTYYTLLLLIFGVMTTCWSTHGSKRASDNKSGSSLIGLLFAFISMIIFVAQNIFAKNILTIRRKVGILPSSSTDDVTSKEGQPSLDKTRFSPLQVDKITILFYCSCIGFSLTLLPFLTGELMHGGSVINDLTLETVALVAIHGIAHFFQAMLAFQLIGLLSSINYSVANIMKRIVVISVA-LFWETKLNFFQVFGVILTIAGLYGYDKWGLSKKDGRQ 452          
BLAST of slc35e1 vs. Ensembl Yeast
Match: YJL193W_mRNA (Putative protein of unknown function; predicted to encode a triose phosphate transporter subfamily member based on phylogenetic analysis; similar to YOR307C/SLY41; deletion mutant has a respiratory growth defect [Source:SGD;Acc:S000003729])

HSP 1 Score: 56.225 bits (134), Expect = 4.165e-9
Identity = 67/292 (22.95%), Postives = 124/292 (42.47%), Query Frame = 1
Query:  391 KYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKE--KYSLKIYISLSVIFSGIAL---------ASITEM-SFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMF-LPIWI-FNDGLVFLYSETKHSKLDLSITISLL---------------------------------------IADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYN----MTKMKGK 1095
            K I++ ++PLG  +F+     H + S +PVS   ++K   P+F+++   +      K +L +  SL  +  G+ +         AS  E+  F+  G++ A+I+   F   NI  K     T+  Q       +  S     LP++   ++ LV       + KL L I ISL+                                       + +G  +F Q +I F L+ +++ L+Y++ N++KR  +I +S +F G  +T L + G   +  G+ +Y      +K+K K
Sbjct:  109 KPILQTVLPLGLFQFVGKYFGHTATSLVPVSTVASIKTLSPMFILLLQKILKISTLKITLTLIFSLCTLVLGVWIIVQEDNRSPASSNELREFSKYGVICAMISMFIFVLQNIYGKTVF--TYRSQTDESQSNSGFSRQESPLPLYEKLDEKLVAKKKPKSYDKLTLMIYISLVGFCLSFGWFITLEFPVLFRYFFQINSSSTVIKAFPVSLFLLNGTFHFIQAMITFHLLGEVSTLTYSIANLMKRFAIIAVSWVFIGRRITWLQVFGLVLNTLGLFLYERCTSQSKIKAK 398          
BLAST of slc35e1 vs. Ensembl Nematostella
Match: EDO45158 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTW7])

HSP 1 Score: 204.912 bits (520), Expect = 6.514e-62
Identity = 141/344 (40.99%), Postives = 216/344 (62.79%), Query Frame = 1
Query:  166 SNLGEDNINIVTALVLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFND-GLVFLYSE-TKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKG-KATTILPIH--KTKLNGSIVHNSRLPHIDSNV 1182
            S L  + I I    +LCT+W  +S  NN+I+K LLN FP+P+T    Q+ +TA+   P + +W++P+ +   I      K I+PL FGK +AA   ++S+ K+PVSYAHTVKA+MPIF V+ S L   +K +  +Y SL+ I  G+ +++ TE+SF+ VGL+SA++AT +FA  NI TK+ +   H+    LL +LARI+T++ LPIW   D   +  YS+ ++ + L L + I++   +G LNF QN++AFT+++ ITPLSY+V    KR++VI +S+    NPVT+ N +G   ++ GV +YN  K    +A   LP+H   TKL    + N  L HI+S+V
Sbjct:    3 SGLSGEAIRI---FLLCTVWFTVSSTNNVITKRLLNKFPHPVTVAFVQVFSTALFMGPTLVLWRVPKNS--AIPKTTFYKFIVPLSFGKALAAVSAYVSIWKVPVSYAHTVKATMPIFTVVLSRLILGQKQTPLVYFSLAPIVLGVMVSTATELSFDIVGLMSALLATLTFAVQNIFTKKMMRELHISHLRLLSILARIATVILLPIWALYDLRKILTYSDLSEENILWLLVVITI---NGFLNFVQNMVAFTVLSLITPLSYSVATASKRILVISVSLFMLRNPVTIYNFLGMLMAIFGVFIYNKAKYDANRAAHHLPMHNKDTKLPTPSLTNGHLNHINSHV 338          
BLAST of slc35e1 vs. Ensembl Nematostella
Match: EDO37817 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEN2])

HSP 1 Score: 111.694 bits (278), Expect = 3.149e-27
Identity = 70/227 (30.84%), Postives = 126/227 (55.51%), Query Frame = 1
Query:  418 LGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSX---XXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMK 1089
            LG+ +F     + IS+  + VS+  TVK+S PIF  +FS++   E+ SL +Y+SL  +  G+AL +  E+SFN +G  SA++        N+ +K+ L+      +S        +  S ++  P W F     F+  + K   +D  + + +L+ +G L + Q++ A+ L++ I+P++++V N +KR V+I +S+L FGN V+ L+ +GT     GV +Y   K +
Sbjct:  112 LGWMRFATVVCSLISLKYVAVSFTETVKSSAPIFTALFSWIMIGERSSLPVYLSLIPVMGGLALCTANELSFNVIGFTSALMNNLMDCVQNVFSKKLLS-NEQSSYSAPELQFYTSAASLVVQFPFWFF-----FMDIQVKLQSMDY-LMMFMLVFNGFLFYMQSLTAYALMSLISPVTFSVSNTVKRAVLIWISVLMFGNEVSALSALGTMIVTCGVFLYQRAKRQ 331          
BLAST of slc35e1 vs. Ensembl Nematostella
Match: EDO46338 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQC5])

HSP 1 Score: 63.5438 bits (153), Expect = 5.526e-11
Identity = 33/77 (42.86%), Postives = 52/77 (67.53%), Query Frame = 1
Query:  508 MPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTK---RCLNVTHMH 729
            MPIF V+ S L   +K +  +Y SL+ I  G+ +++ TE+SF+ VGL+SA++AT +FA  NI TK   R L+++H+ 
Sbjct:    1 MPIFTVVLSRLILGQKQTPLVYFSLAPIVLGVMVSTATELSFDIVGLMSALLATLTFAVQNIFTKKMMRELHISHLR 77          
BLAST of slc35e1 vs. Ensembl Nematostella
Match: EDO43918 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX83])

HSP 1 Score: 48.9062 bits (115), Expect = 2.093e-6
Identity = 55/233 (23.61%), Postives = 108/233 (46.35%), Query Frame = 1
Query:  445 CG----THISVSKLPVSYAHTVKA-SMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSA---VIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIW--IFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILP 1113
            CG    T++S+    V      KA + P+ + I + LFY++ YS KI +++  I  G+ L S  ++ FN  G + A   V+ T+ +       ++   V  M        L+ I     +P++  I   G VF       S   L   +++L A G + F+ N+  + +I   +P++Y +   +K  + ++     F +P+ +  M+G   ++ G++ Y   K++ +   +LP
Sbjct:   77 CGFVVFTNLSLQSNTVGTYQLCKALTTPVIIGIHT-LFYRKAYSTKIKLTVIPITLGVFLNSYYDVRFNIQGTVYASLGVLVTSLYQVWVGAKQKEFQVNSMQLLYYQAPLSAILLGCVVPMFEPITGHGGVF-------SSWPLEAVLAVL-ASGAVAFSVNLSIYWIIGNTSPVTYNMVGHLKFCITLLGGYFIFHDPLKMNQMMGVAITLAGIMTYTHFKLEEQTKQVLP 300          
BLAST of slc35e1 vs. Ensembl Medaka
Match: slc35e1 (solute carrier family 35 member E1 [Source:NCBI gene;Acc:101159574])

HSP 1 Score: 212.616 bits (540), Expect = 4.253e-64
Identity = 134/338 (39.64%), Postives = 203/338 (60.06%), Query Frame = 1
Query:  205 LVLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKG-KATTILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEE 1215
             VLC  W  +S   N+++K +LN FPYP+T +L  +L+  +   P ++ W +P+I   +  Y++    I+PL FGK+ A+   H S+ K+PVSYAHTVKA+MPI+VV+ S +  +EK + K+YISL  I  G+ LA++TE+SF+  GL+SA+ AT  F+  NI +K+ L  T +H   LL +L   + +  LP W+  D  VFL +         + T+ LL+  G  NFAQNVIAF+++  I+PLSYAV N  KR++VI +S+L   NPV+  N++G   ++GGV +YN  K    K   +LP  K   +     NS L  + +N  +   +GL E+
Sbjct:   16 FVLCVFWYTVSSGGNVVNKIILNGFPYPVTVSLFHILSIVVFLPPFLRAWGVPKIELPNRYYRW---YILPLAFGKYFASVSAHFSIWKVPVSYAHTVKATMPIWVVLLSRIIMREKQTTKVYISLIPIIGGVLLATVTELSFDVSGLISALAATLCFSLQNIFSKKVLRDTKIHHLRLLNILGFNAVIFMLPTWVLVDLSVFLVNGDLSDISGWTGTLVLLLISGFCNFAQNVIAFSVLNLISPLSYAVANATKRIMVISISLLMLRNPVSFSNVLGMMTAIGGVFLYNKAKYDANKQKKLLPTTKQDFD-----NSVLEKLQANGSVPFSHGLEEQ 345          
BLAST of slc35e1 vs. Planmine SMEST
Match: SMESG000034003.1 (SMESG000034003.1)

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 400/400 (100.00%), Postives = 400/400 (100.00%), Query Frame = 1
Query:   67 MKNALLPIRRSRTISDSESTELPDFVSTVNSFNSNLGEDNINIVTALVLCTIWCXXXXXXXXXXXXXXXXFPYPXXXXXXXXXXXXICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSXXXXXARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEPYLRKPEKRFHNAIDII 1266
            MKNALLPIRRSRTISDSESTELPDFVSTVNSFNSNLGEDNINIVTALVLCTIWCIISVLNNIISKSLLNNFPYPLTSTLAQLLATAICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSLLLLLARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEPYLRKPEKRFHNAIDII
Sbjct:    1 MKNALLPIRRSRTISDSESTELPDFVSTVNSFNSNLGEDNINIVTALVLCTIWCIISVLNNIISKSLLNNFPYPLTSTLAQLLATAICAYPLVKIWKIPEINWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPIFVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIATASFAFLNILTKRCLNVTHMHQFSLLLLLARISTLMFLPIWIFNDGLVFLYSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVIKRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILPIHKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEPYLRKPEKRFHNAIDII 400          
The following BLAST results are available for this feature:
BLAST of slc35e1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC35E12.070e-5637.09solute carrier family 35 member E1 [Source:HGNC Sy... [more]
SLC35E15.304e-3430.56solute carrier family 35 member E1 [Source:HGNC Sy... [more]
SLC35E2B8.360e-2327.78solute carrier family 35 member E2B [Source:HGNC S... [more]
SLC35E2B8.360e-2327.78solute carrier family 35 member E2B [Source:HGNC S... [more]
SLC35E18.328e-1740.00solute carrier family 35 member E1 [Source:HGNC Sy... [more]
back to top
BLAST of slc35e1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y47G6A.76.317e-719.12pep chromosome:WBcel235:I:3502738:3508421:1 gene:W... [more]
Y47G6A.76.317e-719.12pep chromosome:WBcel235:I:3502738:3508421:1 gene:W... [more]
back to top
BLAST of slc35e1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG146211.358e-6539.88gene:FBgn0031183 transcript:FBtr0339557[more]
CG146211.358e-6539.88gene:FBgn0031183 transcript:FBtr0342876[more]
CG146211.358e-6539.88gene:FBgn0031183 transcript:FBtr0077344[more]
CG146213.661e-4338.33gene:FBgn0031183 transcript:FBtr0339558[more]
back to top
BLAST of slc35e1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc35e14.183e-5939.23solute carrier family 35 member E1 [Source:ZFIN;Ac... [more]
SLC35E2A8.521e-1730.09solute carrier family 35 member E2B [Source:NCBI g... [more]
back to top
BLAST of slc35e1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc35e13.217e-4534.14solute carrier family 35 member E1 [Source:NCBI ge... [more]
SLC35E2B1.288e-2632.31solute carrier family 35 member E2B [Source:HGNC S... [more]
SLC35E2B1.710e-2632.17solute carrier family 35 member E2B [Source:HGNC S... [more]
SLC35E2B1.780e-2632.31solute carrier family 35 member E2B [Source:HGNC S... [more]
back to top
BLAST of slc35e1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Slc35e15.255e-5534.38solute carrier family 35, member E1 [Source:MGI Sy... [more]
Slc35e22.109e-2327.70solute carrier family 35, member E2 [Source:MGI Sy... [more]
Slc35e22.109e-2327.70solute carrier family 35, member E2 [Source:MGI Sy... [more]
Slc35e22.109e-2327.70solute carrier family 35, member E2 [Source:MGI Sy... [more]
back to top
BLAST of slc35e1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VR50|S35E1_DROME1.361e-6439.88Solute carrier family 35 member E1 homolog OS=Dros... [more]
sp|P0C6B1|S35E1_RAT6.181e-5633.94Solute carrier family 35 member E1 OS=Rattus norve... [more]
sp|Q96K37|S35E1_HUMAN9.942e-5637.09Solute carrier family 35 member E1 OS=Homo sapiens... [more]
sp|Q8CD26|S35E1_MOUSE3.676e-5434.38Solute carrier family 35 member E1 OS=Mus musculus... [more]
sp|Q5VQL3|PPT3_ORYSJ4.222e-3333.60Phosphoenolpyruvate/phosphate translocator 3, chlo... [more]
back to top
BLAST of slc35e1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFA10.000e+0100.00Slc35e1 OS=Schmidtea mediterranea OX=79327 GN=slc3... [more]
A0A267F4152.483e-7643.73TPT domain-containing protein (Fragment) OS=Macros... [more]
A0A267EDW91.049e-7542.78TPT domain-containing protein (Fragment) OS=Macros... [more]
A0A482VPS31.495e-7242.61Solute carrier family 35 member E1-like OS=Asbolus... [more]
D6X3C66.773e-7245.51Solute carrier family 35 member E1 homolog-like Pr... [more]
back to top
BLAST of slc35e1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc35e11.827e-5839.23solute carrier family 35 member E1 [Source:NCBI ge... [more]
SLC35E2A1.568e-2030.30solute carrier family 35 member E2B [Source:NCBI g... [more]
ENSAMXT00000013197.21.645e-920.33pep primary_assembly:Astyanax_mexicanus-2.0:15:258... [more]
ENSAMXT00000044703.14.290e-720.46pep primary_assembly:Astyanax_mexicanus-2.0:15:258... [more]
back to top
BLAST of slc35e1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SLC35E2B7.436e-2229.31solute carrier family 35 member E2B [Source:HGNC S... [more]
slc35c29.265e-623.35solute carrier family 35 member C2 [Source:ZFIN;Ac... [more]
back to top
BLAST of slc35e1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SLY413.960e-1326.35Protein involved in ER-to-Golgi transport [Source:... [more]
YJL193W_mRNA4.165e-922.95Putative protein of unknown function; predicted to... [more]
back to top
BLAST of slc35e1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO451586.514e-6240.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378173.149e-2730.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463385.526e-1142.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439182.093e-623.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc35e1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc35e14.253e-6439.64solute carrier family 35 member E1 [Source:NCBI ge... [more]
back to top
BLAST of slc35e1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000034003.10.000e+0100.00SMESG000034003.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30006944
GenBankAKN21650.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006944 ID=SMED30006944|Name=slc35e1|organism=Schmidtea mediterranea sexual|type=transcript|length=1436bp
ATTTAGCACGATTTTAAAATTTTAAACGTGTAATATATTCACAACGATTT
TTATGAATAAAATAATATGAAAAATGCTTTATTGCCCATACGTAGAAGTC
GGACAATTAGTGATTCAGAAAGTACTGAACTTCCAGATTTTGTCAGTACT
GTTAATTCATTTAATAGCAATCTGGGCGAAGACAATATAAATATTGTTAC
TGCTCTAGTTCTGTGTACAATATGGTGCATTATAAGTGTACTAAACAACA
TTATCAGCAAGAGTCTTTTAAACAATTTTCCATATCCATTAACATCTACA
TTGGCCCAGCTTTTGGCTACTGCAATATGTGCATATCCACTCGTAAAAAT
TTGGAAAATACCAGAAATAAATTGGAAAGATATATCGTACAAATATATCG
TAAAAATGATCATTCCATTGGGCTTTGGTAAATTCATGGCTGCATGTGGT
ACTCACATTAGTGTTTCTAAGCTGCCAGTATCATATGCTCATACGGTTAA
AGCCTCAATGCCTATATTTGTTGTGATTTTTTCATATTTGTTCTACAAAG
AAAAGTATTCGTTAAAGATATACATCTCTTTATCAGTTATCTTTTCTGGA
ATCGCTCTCGCTTCAATCACAGAAATGTCTTTCAATTCTGTTGGGCTTCT
TTCAGCAGTTATTGCAACAGCTTCATTTGCTTTTTTAAACATTCTTACCA
AGCGATGTCTGAATGTGACTCACATGCATCAGTTTAGTCTTCTGTTATTA
CTGGCAAGGATTTCCACGCTGATGTTTCTACCGATCTGGATCTTCAACGA
CGGATTGGTATTTTTATACTCTGAAACTAAACACAGTAAACTCGATCTTT
CAATTACCATTTCTCTGCTAATTGCCGATGGTATTTTGAATTTCGCACAA
AACGTCATCGCTTTTACGCTTATTGCTAAAATTACCCCCCTCAGTTATGC
TGTATGCAACGTGATTAAACGCCTGGTTGTGATTGTTATGTCGATATTGT
TTTTTGGTAATCCTGTGACCGTTCTGAATATGATTGGCACGGGTGCTTCA
ATGGGAGGAGTTCTCATGTATAACATGACAAAAATGAAAGGTAAGGCGAC
AACTATTTTGCCTATTCACAAGACCAAATTAAATGGTTCAATTGTGCACA
ATTCGAGGCTACCACACATTGACAGTAATGTTGTTCTTTGCATTCCAAAT
GGTCTGACAGAAGAGCCATATCTCCGTAAACCCGAAAAACGATTCCACAA
TGCAATCGATATTATATAACACGGAAATTACTATCAAAATTATTGGTTTA
TTGAACACAACTTCCTTCTGGTGCATTTATGGGTAAAAGAAATCAAAAAA
TTTATTTCCATCAAGATTATGTAAAAAATCGTTAATTATTTCAATAATAT
ATCTAGTTTTCTTTTAATAAATCTTTGGAATTAAAA
back to top

protein sequence of SMED30006944-orf-1

>SMED30006944-orf-1 ID=SMED30006944-orf-1|Name=SMED30006944-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=401bp
MKNALLPIRRSRTISDSESTELPDFVSTVNSFNSNLGEDNINIVTALVLC
TIWCIISVLNNIISKSLLNNFPYPLTSTLAQLLATAICAYPLVKIWKIPE
INWKDISYKYIVKMIIPLGFGKFMAACGTHISVSKLPVSYAHTVKASMPI
FVVIFSYLFYKEKYSLKIYISLSVIFSGIALASITEMSFNSVGLLSAVIA
TASFAFLNILTKRCLNVTHMHQFSLLLLLARISTLMFLPIWIFNDGLVFL
YSETKHSKLDLSITISLLIADGILNFAQNVIAFTLIAKITPLSYAVCNVI
KRLVVIVMSILFFGNPVTVLNMIGTGASMGGVLMYNMTKMKGKATTILPI
HKTKLNGSIVHNSRLPHIDSNVVLCIPNGLTEEPYLRKPEKRFHNAIDII
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004853Sugar_P_trans_dom
Vocabulary: molecular function
TermDefinition
GO:0005215transporter activity
Vocabulary: biological process
TermDefinition
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0009507chloroplast
GO:0009536plastid
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031969chloroplast membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004853Sugar phosphate transporter domainPFAMPF03151TPTcoord: 46..336
e-value: 6.3E-75
score: 252.2
NoneNo IPR availablePANTHERPTHR11132SOLUTE CARRIER FAMILY 35coord: 42..346
NoneNo IPR availablePANTHERPTHR11132:SF267SOLUTE CARRIER FAMILY 35 MEMBER E1coord: 42..346
NoneNo IPR availableSUPERFAMILYSSF103481Multidrug resistance efflux transporter EmrEcoord: 82..185
NoneNo IPR availableSUPERFAMILYSSF103481Multidrug resistance efflux transporter EmrEcoord: 261..340
NoneNo IPR availableTMHMMTMhelixcoord: 41..63
NoneNo IPR availableTMHMMTMhelixcoord: 138..160
NoneNo IPR availableTMHMMTMhelixcoord: 165..184
NoneNo IPR availableTMHMMTMhelixcoord: 223..241
NoneNo IPR availableTMHMMTMhelixcoord: 303..325
NoneNo IPR availableTMHMMTMhelixcoord: 111..133
NoneNo IPR availableTMHMMTMhelixcoord: 188..210
NoneNo IPR availableTMHMMTMhelixcoord: 261..283
NoneNo IPR availableTMHMMTMhelixcoord: 78..98