Aminopeptidase

Overview
NameAminopeptidase
Smed IDSMED30006924
Length (bp)3057
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aminopeptidase (SMED30006924) t-SNE clustered cells

Violin plots show distribution of expression levels for Aminopeptidase (SMED30006924) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aminopeptidase (SMED30006924) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aminopeptidase (SMED30006924) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006924

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30006924SMESG000065015.1 dd_Smed_v4_6958_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30006924SMESG000065015.1 dd_Smed_v6_6958_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aminopeptidase vs. Ensembl Human
Match: LVRN (laeverin [Source:HGNC Symbol;Acc:HGNC:26904])

HSP 1 Score: 279.641 bits (714), Expect = 7.657e-79
Identity = 241/842 (28.62%), Postives = 403/842 (47.86%), Query Frame = 2
Query:  191 PIQNKCCKCNKSTAA----MTTEPP--RPPVIEIENSIFYLPNSVWPLEYRLSMKFDFNQLKLNSDSRA-QGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIY--KAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMAT----KVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSF----VESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWE----SLNKYS----PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIP-LYIMFGNETFASTPKFSKLEMYSDIL-QLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIF--TAVNLLDK-LNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGL--RRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENWRLL---YSNRNFQSWDYINVKYYAMGCSKVPWIIEKNIDIA 2611
            P++ K     K ++A    +TT P   RPP    +     LP  + PL Y L +       +L + S    G ++I       T  + LHS      R   VR   S D        F +    ++ + L+  +  G  Y ++++ F      +   G+    Y T QG+   LLA+Q +P  AR VFPCFDEP  KA F++T+  +  Y  LSNMP++       +N S W   +F  +P MP Y +AF I D+  + +T E+G++ RIWARK  I    A FALN T   F   E   NI + L K D +A+P+      ME++GL+ ++E  ++   K  L+  K L   ++ HE+ HQWFGNLVT   W ++WLNEGFA+++ +++      K+  +E+F++    +I + +   D   AL+  A+A  + +F    ++  FD   Y KG  +  ML   L ++ F  A+ +YL +  + +   +DLW     +++  S    P  I+N++D W  QS +P+I +    N S  + +      +  K+R     +    W +P L+I  G     +T     L+  S +  ++   +   DW++LNLN   ++  +Y+ + + +L+ QL K+ + IP I+R Q+I D + LSK     ++   L+L  Y+ AE D + ++    VNL+ + L     +   Y    +Y+ K LN  +  +    R +       Y  L     LF   C +    C  +++ +  +W ++      Y +  V LC  I + +  E W +L   Y+N   +  + I +  YAM CSK PWI+ + ++ A
Sbjct:   61 PLRQKPTPTPKPSSARELAVTTTPSNWRPPGPWDQ---LRLPPWLVPLHYDLELWPQLRPDELPAGSLPFTGRVNITVRCTVATSRLLLHSLFQDCERA-EVRGPLSPDDVW-----FALDTEYMV-LELSEPLKPGSSYELQLS-FSGLVKEDLREGLFLNVY-TDQGERRALLASQLEPTFARYVFPCFDEPALKATFNITMIHHPSYVALSNMPKLGQSEKEDVNGSKWTVTTFSTTPHMPTYLVAFVICDYDHVNRT-ERGKEIRIWARKDAIANGSADFALNITGPIFSFLEDLFNISYSLPKTDIIALPSFDNH-AMENWGLMIFDESGLLLEPKDQLTEKKTLISYVVSHEIGHQWFGNLVTMNWWNNIWLNEGFASYFEFEVINYFNPKLPRNEIFFS----NILHNILRED--HALVTRAVAMKVENFKTSEIQELFDIFTYSKGASMARMLSCFLNEHLFVSALKSYLKTFSYSNAEQDDLWRHFQMAIDDQSTVILPATIKNIMDSWTHQSGFPVITL----NVSTGVMKQEPFYLENIKNRTLLTSN--DTWIVPILWIKNG-----TTQPLVWLDQSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKKLNQQLEKDPKAIPVIHRLQLIDDAFSLSKN-NYIEIETALELTKYL-AEEDEIIVWHTVLVNLVTRDLVSEVNIYDIYSLLKRYLLKRLNLIWNIYSTIIRENVLALQDDYLALISLEKLFVTACWLGLEDCLQLSKELFAKWVDHPENEIPYPIKDVVLCYGIALGSDKE-WDILLNTYTNTTNKE-EKIQLA-YAMSCSKDPWILNRYMEYA 866          
BLAST of Aminopeptidase vs. Ensembl Human
Match: LVRN (laeverin [Source:HGNC Symbol;Acc:HGNC:26904])

HSP 1 Score: 279.256 bits (713), Expect = 1.308e-78
Identity = 205/677 (30.28%), Postives = 342/677 (50.52%), Query Frame = 2
Query:  665 TPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIY--KAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMAT----KVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSF----VESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWE----SLNKYS----PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIP-LYIMFGNETFASTPKFSKLEMYSDIL-QLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIF--TAVNLLDK-LNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGL--RRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENWRLL---YSNRNFQSWDYINVKYYAMGCSKVPWIIEKNIDIA 2611
            T QG+   LLA+Q +P  AR VFPCFDEP  KA F++T+  +  Y  LSNMP++       +N S W   +F  +P MP Y +AF I D+  + +T E+G++ RIWARK  I    A FALN T   F   E   NI + L K D +A+P+      ME++GL+ ++E  ++   K  L+  K L   ++ HE+ HQWFGNLVT   W ++WLNEGFA+++ +++      K+  +E+F++    +I + +   D   AL+  A+A  + +F    ++  FD   Y KG  +  ML   L ++ F  A+ +YL +  + +   +DLW     +++  S    P  I+N++D W  QS +P+I +    N S  + +      +  K+R     +    W +P L+I  G     +T     L+  S +  ++   +   DW++LNLN   ++  +Y+ + + +L+ QL K+ + IP I+R Q+I D + LSK     ++   L+L  Y+ AE D + ++    VNL+ + L     +   Y    +Y+ K LN  +  +    R +       Y  L     LF   C +    C  +++ +  +W ++      Y +  V LC  I + +  E W +L   Y+N   +  + I +  YAM CSK PWI+ + ++ A
Sbjct:  226 TDQGERRALLASQLEPTFARYVFPCFDEPALKATFNITMIHHPSYVALSNMPKLGQSEKEDVNGSKWTVTTFSTTPHMPTYLVAFVICDYDHVNRT-ERGKEIRIWARKDAIANGSADFALNITGPIFSFLEDLFNISYSLPKTDIIALPSFDNH-AMENWGLMIFDESGLLLEPKDQLTEKKTLISYVVSHEIGHQWFGNLVTMNWWNNIWLNEGFASYFEFEVINYFNPKLPRNEIFFS----NILHNILRED--HALVTRAVAMKVENFKTSEIQELFDIFTYSKGASMARMLSCFLNEHLFVSALKSYLKTFSYSNAEQDDLWRHFQMAIDDQSTVILPATIKNIMDSWTHQSGFPVITL----NVSTGVMKQEPFYLENIKNRTLLTSN--DTWIVPILWIKNG-----TTQPLVWLDQSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKKLNQQLEKDPKAIPVIHRLQLIDDAFSLSKN-NYIEIETALELTKYL-AEEDEIIVWHTVLVNLVTRDLVSEVNIYDIYSLLKRYLLKRLNLIWNIYSTIIRENVLALQDDYLALISLEKLFVTACWLGLEDCLQLSKELFAKWVDHPENEIPYPIKDVVLCYGIALGSDKE-WDILLNTYTNTTNKE-EKIQLA-YAMSCSKDPWILNRYMEYA 878          
BLAST of Aminopeptidase vs. Ensembl Human
Match: LVRN (laeverin [Source:HGNC Symbol;Acc:HGNC:26904])

HSP 1 Score: 260.766 bits (665), Expect = 3.924e-74
Identity = 197/665 (29.62%), Postives = 324/665 (48.72%), Query Frame = 2
Query:  191 PIQNKCCKCNKSTAA----MTTEPP--RPPVIEIENSIFYLPNSVWPLEYRLSMKFDFNQLKLNSDSRA-QGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITR------SNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIY--KAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMA----TKVLNDEVFYALEHLSIFNYVRNF--DDYFALIKSAIAAPILSF----VESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWE----SLNKYS----PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIP-LYIMFGNETFASTPKFSKLEMYSDIL-QLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSK 2080
            P++ K     K ++A    +TT P   RPP    +     LP  + PL Y L +       +L + S    G ++I       T  + LHS      R   VR   S         R  +        +  + + L+  +  G  Y ++++ F      +   G+    Y T QG+   LLA+Q +P  AR VFPCFDEP  KA F++T+  +  Y  LSNMP++       +N S W   +F  +P MP Y +AF I D+  + +T E+G++ RIWARK  I    A FALN T   F   E   NI + L K D +A+P+      ME++GL+ ++E  ++   K  L+  K L   ++ HE+ HQWFGNLVT   W ++WLNEGFA+++ +++      K+  +E+F++       N + N   +D+ AL+  A+A  + +F    ++  FD   Y KG  +  ML   L ++ F  A+ +YL +  + +   +DLW     +++  S    P  I+N++D W  QS +P+I +    N S  + +      +  K+R     +    W +P L+I  G     +T     L+  S +  ++   +   DW++LNLN   ++  +Y+ + + +L+ QL K+ + IP I+R Q+I D + LSK
Sbjct:   61 PLRQKPTPTPKPSSARELAVTTTPSNWRPPGPWDQ---LRLPPWLVPLHYDLELWPQLRPDELPAGSLPFTGRVNITVRCTVATSRLLLHSLFQDCERA-EVRGPLSPGTGNATVGRVPVDDVWFALDTEYMVLELSEPLKPGSSYELQLS-FSGLVKEDLREGLFLNVY-TDQGERRALLASQLEPTFARYVFPCFDEPALKATFNITMIHHPSYVALSNMPKLGQSEKEDVNGSKWTVTTFSTTPHMPTYLVAFVICDYDHVNRT-ERGKEIRIWARKDAIANGSADFALNITGPIFSFLEDLFNISYSLPKTDIIALPSFDNH-AMENWGLMIFDESGLLLEPKDQLTEKKTLISYVVSHEIGHQWFGNLVTMNWWNNIWLNEGFASYFEFEVINYFNPKLPRNEIFFS-------NILHNILREDH-ALVTRAVAMKVENFKTSEIQELFDIFTYSKGASMARMLSCFLNEHLFVSALKSYLKTFSYSNAEQDDLWRHFQMAIDDQSTVILPATIKNIMDSWTHQSGFPVITL----NVSTGVMKQEPFYLENIKNRTLLTSN--DTWIVPILWIKNG-----TTQPLVWLDQSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKKLNQQLEKDPKAIPVIHRLQLIDDAFSLSK 698          
BLAST of Aminopeptidase vs. Ensembl Human
Match: ENPEP (glutamyl aminopeptidase [Source:HGNC Symbol;Acc:HGNC:3355])

HSP 1 Score: 249.98 bits (637), Expect = 1.143e-68
Identity = 207/763 (27.13%), Postives = 345/763 (45.22%), Query Frame = 2
Query:  224 STAAMTTEPPRP-----PVIEIENSI---FYLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIR----------QIRVRNIFSVDQKMNLAKRFN--ITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQNKS-----LNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSD-WLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFE-MRSFYPDWNKYIEKILNSTFKRFLNDFR-NDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLL 2428
            S+ A  + PP       P  E E+     F LP+ V P+ Y L +K       L  +    G +SI   +   T  + LH  E  + R          Q++VR  F   ++  +       +T S+   +YL T               E   + N       R   T  G+++ ++AT  +P  AR  FPCFDEP  KA ++++IT  +EY  LSNMP ++   S+      W   +FE S  M  Y + FA+  F  +++    G+   I+ +  Q + A +A N T   F  FE    +++ L K+D +AIP+  G   ME++GLITY E  ++++ K   S ++    +++ HE+ HQWFGN+VT   W+DLWLNEGFA+F+ +        D        L     V+  D   +     +       + S FD ++Y KG  I+ MLE  ++  NF      YL   +F +   +D W +L + S +P++ V+D W  Q  YP++ V+  +N +     L+ R N S       S + Y       WNIP  + +  +   S+  F++ E   + + LN+ N S + +L +N +   F+  +Y    +D ++  L  NH+     +RA +I D + L++  Q  D    L L  Y++ E + +P    ++ +  +  +FE  +  YP     IE+      K   +    ND    + +   LR ++  F CKM          ++ E+W N ++ L
Sbjct:   62 SSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVK------PLLEEDTYTGTVSISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVEAEEELTPSSGDGLYLLT--------------MEFAGWLNGSLVGFYRTTYTENGQVKSIVATDHEPTDARKSFPCFDEPNKKATYTISITHPKEYGALSNMP-VAKEESV---DDKWTRTTFEKSVPMSTYLVCFAVHQFDSVKRISNSGKPLTIYVQPEQKHTAEYAANITKSVFDYFEEYFAMNYSLPKLDKIAIPDF-GTGAMENWGLITYRETNLLYDPKESASSNQQRVATVVAHELVHQWFGNIVTMDWWEDLWLNEGFASFFEFLGVNHAETDWQMRDQMLLEDVLPVQEDDSLMSSHPIIVTVTTPDEITSVFDGISYSKGSSILRMLEDWIKPENFQKGCQMYLEKYQFKNAKTSDFWAALEEASRLPVKEVMDTWTRQMGYPVLNVNGVKNITQKRFLLDPRANPS----QPPSDLGY------TWNIP--VKWTEDNITSSVLFNRSE--KEGITLNSSNPSGNAFLKINPDHIGFYRVNYEVATWDSIATALSLNHKTFSSADRASLIDDAFALARA-QLLDYKVALNLTKYLKREENFLPWQRVISAVTYIISMFEDDKELYP----MIEEYFQGQVKPIADSLGWND--AGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSL 778          
BLAST of Aminopeptidase vs. Ensembl Human
Match: LNPEP (leucyl and cystinyl aminopeptidase [Source:HGNC Symbol;Acc:HGNC:6656])

HSP 1 Score: 246.128 bits (627), Expect = 4.389e-67
Identity = 201/729 (27.57%), Postives = 338/729 (46.36%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYF-----ALIKSAI--AAPILSFVESK------FDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYS--PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAV-------NLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYT--GLRRTLFNFGCKMKFSFCFVITEAIVERW 2407
            LP +V PL Y LS+  +   +        +G+++I    +  T  I LHS+ + + R   V  + +V  +   A+         I I     +  G  Y ++I    S + ++   G     Y     + +   ATQF+P +AR+ FPCFDEP FKA F + I  + +Y+ LSNMP+ S   S+ ++    +   F  S  M  Y +AF + +   + + D  G    I+A   +I + H+AL TTV+    F+    I +PLKK+D +AIP+ +    ME++GL+T+ E  ++++        + L   II HE+AHQWFGNLVT   W DLWLNEGFATF  Y            ++LE   IF  + +++D+       + K ++  + PI S V+S       FD L+Y KG  ++ ML+  L ++ F  A+  YL++  + S+  +DLW+S N+ +   + ++ ++  W  Q  +P++ V   Q K   L       F   K  I+  D+   +W+IPL  +     ++     S L+  S ++ L    +   W+ +N+N N ++   Y    ++ L  QL  N  ++   +RA +I + ++L+    +  L +   L  Y+  E    PI  A+       NLL+KL G  ++ S          +++   FK   N  +          +   LR  L  F C      C      + + W
Sbjct:  154 LPTAVVPLRYELSLHPNLTSMTF------RGSVTISVQALQVTWNIILHSTGHNISR---VTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEY--SANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKS---SVVLDDGLVQD-EFSESVKMSTYLVAFIVGEMKNLSQ-DVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAG-AMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEY------------FSLE--KIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTV---QKKGKELFIQQERFFLNMKPEIQPSDTSY-LWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVL---WVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELA-GLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKL-GYMDLAS----------RLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDW 832          
BLAST of Aminopeptidase vs. Ensembl Celegans
Match: F49B2.6 (Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:G5EGH4])

HSP 1 Score: 228.794 bits (582), Expect = 1.512e-61
Identity = 196/715 (27.41%), Postives = 330/715 (46.15%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIY---LTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVD-FSFIQK---TDEKGRKFRIWARKSQIY-KAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLND----EVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYS----PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMY--SDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSF---YPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFC 2374
            LP +  P++Y L++  +       ++   + ++SI  LI N T ++ L++ EN+ ++       F + +K    K  +  +  V+  +   L   + KG+  ++ I  + S    +   G+    +    GK  +  ATQF+P  AR + PCFDEP FKA F + I  N  +   SNM   +   S    +   K   FE S  M  Y LA A++D + +I++     +K  + R++A +  +  ++ F L+TT+     FE   NI +PL K+D LA+ +      ME++GL+T+ +  +++NE+     +K     IICHE+AHQWFGNLVT   W +++LNEGFA +  YK    +  D      FYA E+L+       F     L   AI +     + + FD + Y K   I+ M+ ++  + NF  A+  YLN   + +    DLW+ + K++     V I ++   + TQ  YP++ V       L   Q   +  +  K+  K  D K   W IP+       ++  +    K + +  +D   +     S+DWL+LN     +F   Y+   + +L  QL +NH  I PI+R+ I+ D +DLSK    N +     L  Y+E ETD +        L  +  L E   +   Y D+ +       S   R       D + +N     L+  +F   C+++   C
Sbjct:  200 LPRTAEPIDYDLTLHPNL------TNGEVEASVSIRILIKNDTKLLILNA-ENLEMKS------FDITKKGAKVKA-DFVKCAVMTQWAWKLAKRLHKGDHIVLTI--YYSAQMKSDLQGLYFSTHLGTDGKKTKSAATQFEPTFARKMLPCFDEPNFKATFQVAIIRNPHHIARSNM---NILISKEYKNGLIKDV-FEKSVKMSTYLLAVAVLDGYGYIKRLTRNTQKAIEVRLYAPQDMLTGQSEFGLDTTIRALEFFEDYFNISYPLDKIDLLALDDFSEG-AMENWGLVTFRDSALLFNERKASVVAKEHIALIICHEIAHQWFGNLVTMDWWNEVFLNEGFANYMEYKCVEHLFPDWSIMSRFYA-ENLAFSQEPDGF-----LSSRAIESDDDDSLLNLFDAINYHKAAAIIHMIAEMAGQKNFQNALVEYLNKYAYSNAIGVDLWKIVEKHANLQGTVSIPDLAKAYTTQVGYPLLTVERTDEGVLVHNQTRFLFAEGDKAEEKRGDWK---WPIPI-------SYRDSEHRRKKQHWIQADDKNVTWETTSNDWLILNTGGVGYFKVLYDPETYRKLVKQLQRNHTTISPIDRSMILVDSFDLSKTSLLN-ISVYFDLLEYVEKETDKMTWSIVGKQLRTIEALIEESDYLDIYQDFQR-------SLIMRLYESLDWDEQGANPNQKRLQVDIFAVACRLQIKDC 869          
BLAST of Aminopeptidase vs. Ensembl Celegans
Match: anp-1 (Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:Q1HB04])

HSP 1 Score: 216.468 bits (550), Expect = 9.131e-58
Identity = 175/646 (27.09%), Postives = 293/646 (45.36%), Query Frame = 2
Query:  248 PPRPPVIEIENSIFYLPNSVWPLEYRLSMKFDFNQLKLNSDSRA---QGNLSIIALIINRTDMISLHSSE-NVLIRQIRVRNI--------FSVDQKMNLAKR--FNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAP-ILSF-------VESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSP----------VPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISI-WNIPL-YIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDW-LLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSK 2080
            P   P   I  S   LP SV P+ Y+L++K         +D      +G + I   I      +SL+S + N     I+  +I        F++D K +  ++  FN+  +       T  V+ G     ++            SG+    Y   +G+ +    TQ +P  AR + PCFDEP +KA +++T+    +   +SN  E      +      +   +F+ +P M  Y LA  I +F + + T + G +FR+W+R  +     +A+   V+    +E+  NI FPL K D +A+P+      ME++GLITY E  ++++ +      K     +I HE+AHQWFGNLVT   W DLWLNEGFAT   Y + T  ++D      E  ++         + AL   ++A+   L+F       V   FD + Y KG  +++M+ K + + NFN  I +YL   +FD+    +L  +L +  P          + I   +D W  Q  YP++  S   N  + + Q+      T K   KY +      W++P+ Y + G+         S+LEM   + +     + SD  +++N   N F+   Y+  L+  +S  L +NH    P  R ++I D + L++
Sbjct:   71 PAAKPEDNISASELRLPTSVSPISYQLTVKTYLPGYGYTADKNNLTFEGQVLIELNITKSIKKVSLNSKDLNYTEEFIKKSSILVNGKSIAFTLDDKQSTHEKIFFNLDETVEPTTSATLKVAFGAPLRTDM------------SGLYQTTYTNSKGESKMAAVTQMEPVYARRMVPCFDEPAYKATWTVTVIHPNKTVAVSNGIE----DKVEDGQPGFIISTFKPTPRMSSYLLAIFISEFEYNEATTKSGVRFRVWSRPEEKNSTMYAVEAGVKCLEYYEKYYNISFPLPKQDMVALPDFSAG-AMENWGLITYRESALLYDPRIYSGSQKRRVAVVIAHELAHQWFGNLVTLKWWNDLWLNEGFATLVEY-LGTDEISDGNMRMREWFTMDAL------WSALAADSVASTHPLTFKIDKAMEVLDSFDSVTYDKGGAVLAMVRKTIGEENFNTGINHYLTRHQFDNADAGNLLTALGEKIPDSVMGPKGVKLNISEFMDPWTKQLGYPLLNASRINNTHIIVEQSRFKLLATGKEEEKYSNPVWGFKWDVPVWYQVVGS---------SELEMKW-MKRNEPLIIKSDKNVIINAESNGFYRAGYSSGLWKEISEMLKENHEQFSPQTRVRLIDDSFALAR 682          
BLAST of Aminopeptidase vs. Ensembl Celegans
Match: anp-1 (Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:Q1HB04])

HSP 1 Score: 216.083 bits (549), Expect = 1.071e-57
Identity = 174/645 (26.98%), Postives = 289/645 (44.81%), Query Frame = 2
Query:  248 PPRPPVIEIENSIFYLPNSVWPLEYRLSMKFDFNQLKLNSDSRA---QGNLSIIALIINRTDMISLHSSE-NVLIRQIRVRNI--------FSVDQKMNLAKR--FNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAP-ILSF-------VESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSP----------VPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISI-WNIPL-YIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSK 2080
            P   P   I  S   LP SV P+ Y+L++K         +D      +G + I   I      +SL+S + N     I+  +I        F++D K +  ++  FN+  +       T  V+ G     ++            SG+    Y   +G+ +    TQ +P  AR + PCFDEP +KA +++T+    +   +SN  E      +      +   +F+ +P M  Y LA  I +F + + T + G +FR+W+R  +     +A+   V+    +E+  NI FPL K D +A+P+      ME++GLITY E  ++++ +      K     +I HE+AHQWFGNLVT   W DLWLNEGFAT   Y + T  ++D      E  ++         + AL   ++A+   L+F       V   FD + Y KG  +++M+ K + + NFN  I +YL   +FD+    +L  +L +  P          + I   +D W  Q  YP++  S   N  + + Q+      T K   KY +      W++P+ Y + G+         S+LEM            S   +++N   N F+   Y+  L+  +S  L +NH    P  R ++I D + L++
Sbjct:   59 PAAKPEDNISASELRLPTSVSPISYQLTVKTYLPGYGYTADKNNLTFEGQVLIELNITKSIKKVSLNSKDLNYTEEFIKKSSILVNGKSIAFTLDDKQSTHEKIFFNLDETVEPTTSATLKVAFGAPLRTDM------------SGLYQTTYTNSKGESKMAAVTQMEPVYARRMVPCFDEPAYKATWTVTVIHPNKTVAVSNGIE----DKVEDGQPGFIISTFKPTPRMSSYLLAIFISEFEYNEATTKSGVRFRVWSRPEEKNSTMYAVEAGVKCLEYYEKYYNISFPLPKQDMVALPDFSAG-AMENWGLITYRESALLYDPRIYSGSQKRRVAVVIAHELAHQWFGNLVTLKWWNDLWLNEGFATLVEY-LGTDEISDGNMRMREWFTMDAL------WSALAADSVASTHPLTFKIDKAMEVLDSFDSVTYDKGGAVLAMVRKTIGEENFNTGINHYLTRHQFDNADAGNLLTALGEKIPDSVMGPKGVKLNISEFMDPWTKQLGYPLLNASRINNTHIIVEQSRFKLLATGKEEEKYSNPVWGFKWDVPVWYQVVGS---------SELEMKWMKRNEPLIIKSDKNVIINAESNGFYRAGYSSGLWKEISEMLKENHEQFSPQTRVRLIDDSFALAR 670          
BLAST of Aminopeptidase vs. Ensembl Celegans
Match: Y67D8C.9 (Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:A8W765])

HSP 1 Score: 208.764 bits (530), Expect = 4.763e-55
Identity = 156/521 (29.94%), Postives = 252/521 (48.37%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVI-RIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIW--------NEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYK-MATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYL-AYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIE-----NVIDGWLTQSCYP-IIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISI 1804
            +P  ++ L Y   ++ DF+Q   +   RA  ++ + +   +  D I  H   N+ + ++R+R     D K   AK F    S  + RI L   + KG KYI+E+    +    + +    S   QT          T+F+P  AR  FPC+DEP  KA F++++  N++Y++LSNMP +           F KT  F+ +P M  Y LAFAI +F  ++   E+G    +W     +    F L      F   E  L I +PL KVD +A  N     GME++GL+ +E   I +        NE     +++     +I HE AHQWFGNLVT   W +L+LNEGFATFY Y+ M+T+      F   + L+     ++ +D+   +   +A    S VES F     Y KG +++ ML  L+   +F  A+  YL  + + SV+ +DL+ SL  Y+    E     +V++GW      P I  +  Y N+ + + Q  +++ + ++S +K   +  S+
Sbjct:  123 VPLPLYILPYHYDLQLDFSQFDTHLFIRANISIHLESYGNSTEDEIQFHLGPNIKMERMRLRK----DGKKFYAKTFKREESKKLGRISLRDPLQKG-KYILEMTYNMTICDEDVDGVRCSLDNQTNSSLKATSFTTKFEPTLARAFFPCWDEPGVKATFNISVRHNKKYTVLSNMPPVESHDHKSWEDQF-KTTVFQTTPPMSTYLLAFAIGEFVKLESRTERGIPVTVWTYPEDVMSMKFTLEYAPVIFDRLEDALEIPYPLPKVDLIAARNFH-VGGMENWGLVVFEFASIAYTPPITDHVNETVDRMYNEFRIGKLIAHEAAHQWFGNLVTMRDWSELFLNEGFATFYVYEMMSTERPVTAQFEYYDSLASLILAQSEEDHRLSLVRELATE--SQVESSFHPTNLYTKGCVLIRMLRDLVSDFDFKAAVRRYLRKNAYRSVSRDDLFASLPAYADHGAEQEKLSHVLEGWFVNEGIPEITLIRNYDNEMMTISQRKTVHHE-YRSFLKDRKASASV 633          
BLAST of Aminopeptidase vs. Ensembl Celegans
Match: Y67D8C.9 (Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:A8W765])

HSP 1 Score: 208.379 bits (529), Expect = 7.250e-55
Identity = 156/521 (29.94%), Postives = 252/521 (48.37%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVI-RIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIW--------NEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYK-MATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYL-AYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIE-----NVIDGWLTQSCYP-IIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISI 1804
            +P  ++ L Y   ++ DF+Q   +   RA  ++ + +   +  D I  H   N+ + ++R+R     D K   AK F    S  + RI L   + KG KYI+E+    +    + +    S   QT          T+F+P  AR  FPC+DEP  KA F++++  N++Y++LSNMP +           F KT  F+ +P M  Y LAFAI +F  ++   E+G    +W     +    F L      F   E  L I +PL KVD +A  N     GME++GL+ +E   I +        NE     +++     +I HE AHQWFGNLVT   W +L+LNEGFATFY Y+ M+T+      F   + L+     ++ +D+   +   +A    S VES F     Y KG +++ ML  L+   +F  A+  YL  + + SV+ +DL+ SL  Y+    E     +V++GW      P I  +  Y N+ + + Q  +++ + ++S +K   +  S+
Sbjct:  180 VPLPLYILPYHYDLQLDFSQFDTHLFIRANISIHLESYGNSTEDEIQFHLGPNIKMERMRLRK----DGKKFYAKTFKREESKKLGRISLRDPLQKG-KYILEMTYNMTICDEDVDGVRCSLDNQTNSSLKATSFTTKFEPTLARAFFPCWDEPGVKATFNISVRHNKKYTVLSNMPPVESHDHKSWEDQF-KTTVFQTTPPMSTYLLAFAIGEFVKLESRTERGIPVTVWTYPEDVMSMKFTLEYAPVIFDRLEDALEIPYPLPKVDLIAARNFH-VGGMENWGLVVFEFASIAYTPPITDHVNETVDRMYNEFRIGKLIAHEAAHQWFGNLVTMRDWSELFLNEGFATFYVYEMMSTERPVTAQFEYYDSLASLILAQSEEDHRLSLVRELATE--SQVESSFHPTNLYTKGCVLIRMLRDLVSDFDFKAAVRRYLRKNAYRSVSRDDLFASLPAYADHGAEQEKLSHVLEGWFVNEGIPEITLIRNYDNEMMTISQRKTVHHE-YRSFLKDRKASASV 690          
BLAST of Aminopeptidase vs. Ensembl Fly
Match: CG31445 (gene:FBgn0051445 transcript:FBtr0085401)

HSP 1 Score: 266.544 bits (680), Expect = 8.180e-75
Identity = 220/823 (26.73%), Postives = 389/823 (47.27%), Query Frame = 2
Query:  266 IEIENSI-----FYLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRV--RNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFE-----SHHFTNQESGIISRKYQTP-QGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPI--LSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESL----NKYSPVP----IENVIDGWLTQSCYPIIYVSI-YQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPL-YIMFGNETFASTPKFSKLEMYS-DILQLNTFNVSS---DWLLLNLNCNSFFTTDYNG----ILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRL-SNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDY----DLLHVALCQYIQMDNYGENWRLLYSN-RNFQSWDYINVKYYAMGCSKVPWIIEKNIDIAYN 2617
            + + NSI     + LP ++ P  Y L +      L+   D R  GN+ I+   +  T  I+LHS +N+ I + R+  R I       N     ++  ++   I+ T       K ++  N ++     S   T Q  G     Y+ P   K   L ATQF+P SAR  FPCFDEP FKA+F +T+  +++++ LSNMP         + +  W  C F+ S  M  Y +A+++ DFSF   T   G  FR WAR + I +  +A     +  + +E    I +PL K+D +A+P+      ME++GL+ Y E  ++++        K    ++I HE+AHQWFGNLVT   W DLWLNEGFAT+ +     ++  +  +++ +  S+   +  F     +    I+ PI  ++ +E  FD ++Y+KG  ++ M+   + + +F   +  YL    + +   N+LWESL    ++   +P    I  ++D W  Q+ +P++ ++  Y   +  + Q   +      S+I   D ++  W +PL Y       F +T   + +E  S D     T + S+   +WL+LN+  ++ +  +Y+     +L D L+    K+ + I  INRAQ+I D    +   ++ D    L++  Y+  E D +P  +A++ L  LN +      +  + +Y++K+L   ++  L+   + F L +      L+ T+ N  C+   S C    +A   RW+  +    ++    +L     C  I      E+W  L+S  R              +GCSK  WI+++ ++ +++
Sbjct:   15 LSVANSISRYNHYRLPTALRPQRYYLRI---LTLLESPDDLRFAGNVQIVIKALQNTRNITLHS-KNLTIDESRITLRQISGAGNMDNCVSSTSVNPTHDYYIFHTC------KELLAGNVYKLFLPFSADLTPQLFGYYRSSYKDPVTNKTRWLSATQFEPSSARKAFPCFDEPGFKASFVVTLGYHKQFNALSNMPVREIRPHESLANYIW--CEFQESVPMSTYLVAYSVNDFSFKPSTLPNGALFRTWARPNAIDQCDYAAEFGPKVLQYYEEFFGIRYPLPKIDQMAVPDFSAG-AMENWGLVKYRESTLLYSPTHSSLADKQDLANVIAHELAHQWFGNLVTMKWWTDLWLNEGFATYVAGLGVQEIYPE--WHSRDKGSLTALMTAFRLDSLVSSHPISRPIQMVTEIEESFDAISYQKGSAVLRMMHLFMGEESFRTGLREYLKLYAYKNAEQNNLWESLTTAAHQNGALPGHYDINTIMDSWTLQTGFPVLNITRDYSTGTAEITQERYLR----NSQIPQAD-RVGCWWVPLSYTTQDENDFNNTSPKAWMECSSTDEGVPTTIDHSAGPEEWLILNIQLSTPYKANYDARNWKLLIDTLN---SKDFQSIHVINRAQLIDDVLYFAWTGEQ-DYETALQVTNYLRRERDLIPWKSALDNLKLLNRILRQTPNFGSFKRYMQKLLTPIYEH-LHGMNDTFSLMTQQDEVLLKTTVVNVACQYDVSDCVTQAQAYFRRWRAETNPDENHPVPLNLRSTVYCTAISQGT-EEDWNFLWSRYRKSNVASERQTILSTLGCSKEVWILQRYMEKSFH 811          
BLAST of Aminopeptidase vs. Ensembl Fly
Match: CG31445 (gene:FBgn0051445 transcript:FBtr0332431)

HSP 1 Score: 266.544 bits (680), Expect = 8.180e-75
Identity = 220/823 (26.73%), Postives = 389/823 (47.27%), Query Frame = 2
Query:  266 IEIENSI-----FYLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRV--RNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFE-----SHHFTNQESGIISRKYQTP-QGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPI--LSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESL----NKYSPVP----IENVIDGWLTQSCYPIIYVSI-YQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPL-YIMFGNETFASTPKFSKLEMYS-DILQLNTFNVSS---DWLLLNLNCNSFFTTDYNG----ILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRL-SNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDY----DLLHVALCQYIQMDNYGENWRLLYSN-RNFQSWDYINVKYYAMGCSKVPWIIEKNIDIAYN 2617
            + + NSI     + LP ++ P  Y L +      L+   D R  GN+ I+   +  T  I+LHS +N+ I + R+  R I       N     ++  ++   I+ T       K ++  N ++     S   T Q  G     Y+ P   K   L ATQF+P SAR  FPCFDEP FKA+F +T+  +++++ LSNMP         + +  W  C F+ S  M  Y +A+++ DFSF   T   G  FR WAR + I +  +A     +  + +E    I +PL K+D +A+P+      ME++GL+ Y E  ++++        K    ++I HE+AHQWFGNLVT   W DLWLNEGFAT+ +     ++  +  +++ +  S+   +  F     +    I+ PI  ++ +E  FD ++Y+KG  ++ M+   + + +F   +  YL    + +   N+LWESL    ++   +P    I  ++D W  Q+ +P++ ++  Y   +  + Q   +      S+I   D ++  W +PL Y       F +T   + +E  S D     T + S+   +WL+LN+  ++ +  +Y+     +L D L+    K+ + I  INRAQ+I D    +   ++ D    L++  Y+  E D +P  +A++ L  LN +      +  + +Y++K+L   ++  L+   + F L +      L+ T+ N  C+   S C    +A   RW+  +    ++    +L     C  I      E+W  L+S  R              +GCSK  WI+++ ++ +++
Sbjct:   15 LSVANSISRYNHYRLPTALRPQRYYLRI---LTLLESPDDLRFAGNVQIVIKALQNTRNITLHS-KNLTIDESRITLRQISGAGNMDNCVSSTSVNPTHDYYIFHTC------KELLAGNVYKLFLPFSADLTPQLFGYYRSSYKDPVTNKTRWLSATQFEPSSARKAFPCFDEPGFKASFVVTLGYHKQFNALSNMPVREIRPHESLANYIW--CEFQESVPMSTYLVAYSVNDFSFKPSTLPNGALFRTWARPNAIDQCDYAAEFGPKVLQYYEEFFGIRYPLPKIDQMAVPDFSAG-AMENWGLVKYRESTLLYSPTHSSLADKQDLANVIAHELAHQWFGNLVTMKWWTDLWLNEGFATYVAGLGVQEIYPE--WHSRDKGSLTALMTAFRLDSLVSSHPISRPIQMVTEIEESFDAISYQKGSAVLRMMHLFMGEESFRTGLREYLKLYAYKNAEQNNLWESLTTAAHQNGALPGHYDINTIMDSWTLQTGFPVLNITRDYSTGTAEITQERYLR----NSQIPQAD-RVGCWWVPLSYTTQDENDFNNTSPKAWMECSSTDEGVPTTIDHSAGPEEWLILNIQLSTPYKANYDARNWKLLIDTLN---SKDFQSIHVINRAQLIDDVLYFAWTGEQ-DYETALQVTNYLRRERDLIPWKSALDNLKLLNRILRQTPNFGSFKRYMQKLLTPIYEH-LHGMNDTFSLMTQQDEVLLKTTVVNVACQYDVSDCVTQAQAYFRRWRAETNPDENHPVPLNLRSTVYCTAISQGT-EEDWNFLWSRYRKSNVASERQTILSTLGCSKEVWILQRYMEKSFH 811          
BLAST of Aminopeptidase vs. Ensembl Fly
Match: SP1029 (gene:FBgn0263236 transcript:FBtr0085400)

HSP 1 Score: 251.521 bits (641), Expect = 1.168e-69
Identity = 212/840 (25.24%), Postives = 389/840 (46.31%), Query Frame = 2
Query:  266 IEIENSIFYLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLI--RQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFE-----SHHFTNQESGIISRKYQTPQGKIEQLLA-TQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPI--LSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESL----NKYSPVP----IENVIDGWLTQSCYPIIYVSI-YQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPL-YIMFGNETFASTPKFSKLEMYSDILQL----NTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRL--IPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFR-LSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNS----LLLTDYDLLHVALCQYIQMDNYGENWRLL---YSNRNFQSWDYINVKYYAMGCSKVPWIIEKNIDIAYNVLKNFSKRNDFPHVSEIIIDDI 2683
            IE   + + LP S+ P +Y L +      L+   D R  G++ I+   +  T  ++LHS +N+ I   QI +R I    +K N      +  S+   I  T       + ++  N +E     +     Q  G     Y+ P   + + ++ TQF+P SAR  FPCFDEP FKA F +T+  +++Y+ +SNMPE        +    W  C F+ S  M  Y +A+++ DFS    T      FR WAR + I +  +A     +  + +E+   I FPL K+D +A+P+      ME++GL+TY E  ++++        K    S++ HE+AHQWFGNLVT   W DLWLNEGFAT+ +  +  + +N E + ++E  S+ N +  F          I+ PI  +S +   FD ++Y+KG  ++ M+   L + +F   +  YL    + +   ++LWESL    +KY  +P    I++++D W  Q+ YP+I V+  Y  ++  L Q   +   T  +R      +   W +PL Y     + F +T   + +E   +   L            W++ N   ++ +  +Y+   + +L ++ L N     I  INRAQ+I D   L+   ++ D    ++L  Y++ E + +P  +A   L ++  +      +  + +Y++K++   ++  LN   + F  +       L+  + N+ C+ +   C     A    W+  +          ++     C  I+  +   +W  L   Y   N  +     +   A+GCS+  W++++ +++ ++  +   K++       +  +++
Sbjct:   25 IETTYNYYRLPTSLRPQKYHLRI---LTLLENPEDLRFSGSVKILIEALENTKNVTLHS-KNLTIDESQITLRQIGGEGKKENCVSSTAVNPSHDFYILNTC------QELLAGNTYELYMPFAADLNRQLEGYYRSSYKDPVANLTKWISVTQFEPASARLAFPCFDEPDFKAPFVVTLGYHKKYTAISNMPEKETKPHETLADYIW--CEFQESVPMSTYLVAYSVNDFSHKPSTLPNSALFRTWARPNAIDQCDYAAQFGPKVLQYYEQFFGIKFPLPKIDQIAVPDFSAG-AMENWGLVTYREIALLYSAAHSSLADKQRVASVVAHELAHQWFGNLVTMKWWTDLWLNEGFATYVA-SLGVENINPE-WRSMEQESLSNLLTIFRRDALESSHPISRPIQMVSEISESFDQISYQKGSTVLRMMHLFLGEESFRSGLQAYLQKFSYKNAEQDNLWESLTQAAHKYRSLPKSYDIKSIMDSWTLQTGYPVINVTRDYAARTAKLNQERYL-LNTQVARA----YRGGCWWVPLSYTTQAVQDFNNTAPKAWMECGKNGESLPKTIQDLPGPDQWVIFNTQLSTLYKVNYDAQNW-KLLIETLTNGDFERIHVINRAQLIDDALYLAWTGEQ-DYEIAMRLIEYLQREREYLPWKSAFENLKRVGRIVRQTPDFEFFKRYMKKLILPIYEH-LNGINDTFSAIPQQDQVLLKTMVVNWACQYQVGDCVPQALAYYRNWRAEANPDEKNPVPINVRSTVYCTSIKHGS-DSDWEFLWTRYKKSNVAAEKRTILT--ALGCSREVWLLQRYLELTFDPKEAIRKQDSMWAFQAVAFNEV 838          
BLAST of Aminopeptidase vs. Ensembl Fly
Match: SP1029 (gene:FBgn0263236 transcript:FBtr0334868)

HSP 1 Score: 251.521 bits (641), Expect = 1.168e-69
Identity = 212/840 (25.24%), Postives = 389/840 (46.31%), Query Frame = 2
Query:  266 IEIENSIFYLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLI--RQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFE-----SHHFTNQESGIISRKYQTPQGKIEQLLA-TQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPI--LSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESL----NKYSPVP----IENVIDGWLTQSCYPIIYVSI-YQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPL-YIMFGNETFASTPKFSKLEMYSDILQL----NTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRL--IPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFR-LSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNS----LLLTDYDLLHVALCQYIQMDNYGENWRLL---YSNRNFQSWDYINVKYYAMGCSKVPWIIEKNIDIAYNVLKNFSKRNDFPHVSEIIIDDI 2683
            IE   + + LP S+ P +Y L +      L+   D R  G++ I+   +  T  ++LHS +N+ I   QI +R I    +K N      +  S+   I  T       + ++  N +E     +     Q  G     Y+ P   + + ++ TQF+P SAR  FPCFDEP FKA F +T+  +++Y+ +SNMPE        +    W  C F+ S  M  Y +A+++ DFS    T      FR WAR + I +  +A     +  + +E+   I FPL K+D +A+P+      ME++GL+TY E  ++++        K    S++ HE+AHQWFGNLVT   W DLWLNEGFAT+ +  +  + +N E + ++E  S+ N +  F          I+ PI  +S +   FD ++Y+KG  ++ M+   L + +F   +  YL    + +   ++LWESL    +KY  +P    I++++D W  Q+ YP+I V+  Y  ++  L Q   +   T  +R      +   W +PL Y     + F +T   + +E   +   L            W++ N   ++ +  +Y+   + +L ++ L N     I  INRAQ+I D   L+   ++ D    ++L  Y++ E + +P  +A   L ++  +      +  + +Y++K++   ++  LN   + F  +       L+  + N+ C+ +   C     A    W+  +          ++     C  I+  +   +W  L   Y   N  +     +   A+GCS+  W++++ +++ ++  +   K++       +  +++
Sbjct:   25 IETTYNYYRLPTSLRPQKYHLRI---LTLLENPEDLRFSGSVKILIEALENTKNVTLHS-KNLTIDESQITLRQIGGEGKKENCVSSTAVNPSHDFYILNTC------QELLAGNTYELYMPFAADLNRQLEGYYRSSYKDPVANLTKWISVTQFEPASARLAFPCFDEPDFKAPFVVTLGYHKKYTAISNMPEKETKPHETLADYIW--CEFQESVPMSTYLVAYSVNDFSHKPSTLPNSALFRTWARPNAIDQCDYAAQFGPKVLQYYEQFFGIKFPLPKIDQIAVPDFSAG-AMENWGLVTYREIALLYSAAHSSLADKQRVASVVAHELAHQWFGNLVTMKWWTDLWLNEGFATYVA-SLGVENINPE-WRSMEQESLSNLLTIFRRDALESSHPISRPIQMVSEISESFDQISYQKGSTVLRMMHLFLGEESFRSGLQAYLQKFSYKNAEQDNLWESLTQAAHKYRSLPKSYDIKSIMDSWTLQTGYPVINVTRDYAARTAKLNQERYL-LNTQVARA----YRGGCWWVPLSYTTQAVQDFNNTAPKAWMECGKNGESLPKTIQDLPGPDQWVIFNTQLSTLYKVNYDAQNW-KLLIETLTNGDFERIHVINRAQLIDDALYLAWTGEQ-DYEIAMRLIEYLQREREYLPWKSAFENLKRVGRIVRQTPDFEFFKRYMKKLILPIYEH-LNGINDTFSAIPQQDQVLLKTMVVNWACQYQVGDCVPQALAYYRNWRAEANPDEKNPVPINVRSTVYCTSIKHGS-DSDWEFLWTRYKKSNVAAEKRTILT--ALGCSREVWLLQRYLELTFDPKEAIRKQDSMWAFQAVAFNEV 838          
BLAST of Aminopeptidase vs. Ensembl Fly
Match: SP1029 (gene:FBgn0263236 transcript:FBtr0085399)

HSP 1 Score: 251.521 bits (641), Expect = 1.168e-69
Identity = 212/840 (25.24%), Postives = 389/840 (46.31%), Query Frame = 2
Query:  266 IEIENSIFYLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLI--RQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFE-----SHHFTNQESGIISRKYQTPQGKIEQLLA-TQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPI--LSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESL----NKYSPVP----IENVIDGWLTQSCYPIIYVSI-YQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPL-YIMFGNETFASTPKFSKLEMYSDILQL----NTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRL--IPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFR-LSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNS----LLLTDYDLLHVALCQYIQMDNYGENWRLL---YSNRNFQSWDYINVKYYAMGCSKVPWIIEKNIDIAYNVLKNFSKRNDFPHVSEIIIDDI 2683
            IE   + + LP S+ P +Y L +      L+   D R  G++ I+   +  T  ++LHS +N+ I   QI +R I    +K N      +  S+   I  T       + ++  N +E     +     Q  G     Y+ P   + + ++ TQF+P SAR  FPCFDEP FKA F +T+  +++Y+ +SNMPE        +    W  C F+ S  M  Y +A+++ DFS    T      FR WAR + I +  +A     +  + +E+   I FPL K+D +A+P+      ME++GL+TY E  ++++        K    S++ HE+AHQWFGNLVT   W DLWLNEGFAT+ +  +  + +N E + ++E  S+ N +  F          I+ PI  +S +   FD ++Y+KG  ++ M+   L + +F   +  YL    + +   ++LWESL    +KY  +P    I++++D W  Q+ YP+I V+  Y  ++  L Q   +   T  +R      +   W +PL Y     + F +T   + +E   +   L            W++ N   ++ +  +Y+   + +L ++ L N     I  INRAQ+I D   L+   ++ D    ++L  Y++ E + +P  +A   L ++  +      +  + +Y++K++   ++  LN   + F  +       L+  + N+ C+ +   C     A    W+  +          ++     C  I+  +   +W  L   Y   N  +     +   A+GCS+  W++++ +++ ++  +   K++       +  +++
Sbjct:   25 IETTYNYYRLPTSLRPQKYHLRI---LTLLENPEDLRFSGSVKILIEALENTKNVTLHS-KNLTIDESQITLRQIGGEGKKENCVSSTAVNPSHDFYILNTC------QELLAGNTYELYMPFAADLNRQLEGYYRSSYKDPVANLTKWISVTQFEPASARLAFPCFDEPDFKAPFVVTLGYHKKYTAISNMPEKETKPHETLADYIW--CEFQESVPMSTYLVAYSVNDFSHKPSTLPNSALFRTWARPNAIDQCDYAAQFGPKVLQYYEQFFGIKFPLPKIDQIAVPDFSAG-AMENWGLVTYREIALLYSAAHSSLADKQRVASVVAHELAHQWFGNLVTMKWWTDLWLNEGFATYVA-SLGVENINPE-WRSMEQESLSNLLTIFRRDALESSHPISRPIQMVSEISESFDQISYQKGSTVLRMMHLFLGEESFRSGLQAYLQKFSYKNAEQDNLWESLTQAAHKYRSLPKSYDIKSIMDSWTLQTGYPVINVTRDYAARTAKLNQERYL-LNTQVARA----YRGGCWWVPLSYTTQAVQDFNNTAPKAWMECGKNGESLPKTIQDLPGPDQWVIFNTQLSTLYKVNYDAQNW-KLLIETLTNGDFERIHVINRAQLIDDALYLAWTGEQ-DYEIAMRLIEYLQREREYLPWKSAFENLKRVGRIVRQTPDFEFFKRYMKKLILPIYEH-LNGINDTFSAIPQQDQVLLKTMVVNWACQYQVGDCVPQALAYYRNWRAEANPDEKNPVPINVRSTVYCTSIKHGS-DSDWEFLWTRYKKSNVAAEKRTILT--ALGCSREVWLLQRYLELTFDPKEAIRKQDSMWAFQAVAFNEV 838          
BLAST of Aminopeptidase vs. Ensembl Zebrafish
Match: lnpep (leucyl/cystinyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-030131-1534])

HSP 1 Score: 261.922 bits (668), Expect = 1.064e-72
Identity = 234/824 (28.40%), Postives = 374/824 (45.39%), Query Frame = 2
Query:  215 CNKSTAAMTTEPPRPPVIEIENSIF-----YLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRS-NVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPN-LKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAI--AAPILSF------VESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYS--PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPL-YIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRS---FYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERW-KNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKYYAMGCS-----KVPWIIEKNID 2605
            C KS ++M++  P    I     +F      LP SV P+ Y +S+  D N +        QGN+SI+ L+++ T  I LHSS+  +I+        + D K     RF   +    I I    ++ KG+ Y+++ +     + +N   G  +  Y    G    L ATQF+P +AR  FPCFDEP FK+ F + +T   +Y  LSNMP+I    +  +N +  +   FE S  M  Y +AF + +FS   K   K     ++A   +  + H+AL T  +  + +     I++PL K+D +AIP+ L G   ME++GLIT+ E  ++   +    F K L  S+I HE+AHQWFGNLVT   W DLWLNEGFAT+  Y     V  D +   +E L++         + AL K A+  + P+ +F      VE  FD ++Y+KG  I+ ML   LR   F+  +  YL +    +    DLW SL++ S   + +  +++ W     +P++ V       + L Q   +      +    DDS  S+W+IPL Y+        S  +   L+     LQL        WL  N   + F+   Y+   +  L   L  +  ++P  ++A +I + + LS +  +    ++L L  YI  ET+  P+  A++ L ++  L + RS          YIE    S F   +     +   S S  T LR  L    C +    C      + ++W  +N  L    DL+        + D   E W  L  +     +D    K      S     K+ W+++K++D
Sbjct:  128 CQKSNSSMSSIYP----ISTSGELFPWTDLRLPVSVHPVHYNISLHPDLNSMTF------QGNVSIVVLVMHETKNIILHSSDMNIIK-------VTFDDK---EYRFLEYKPWQQIAIKFPEDLKKGQ-YVLKFSY--KANLSNSYDGFYNSSYVDTAGTKRVLAATQFEPLAARKAFPCFDEPAFKSTFVVKMTREAKYISLSNMPKIK---TTDLNENGLQEDEFESSVKMSTYLVAFIVAEFSSHSKNVSK-TTVSVYAVPDKKDQVHYALETACKLLKFYNTFFEIEYPLSKLDLVAIPDFLAG--AMENWGLITFRETTLLVGNQSS-RFDKQLVTSVIAHELAHQWFGNLVTMRWWNDLWLNEGFATYMQYMSIENVFPD-LDIDIEFLNV--------RFKALAKDALNSSHPVSTFVSTPEQVEEMFDSVSYEKGASILLMLNATLRDGEFHKGVIEYLQNYNLSNTESKDLWNSLSQVSKQSLNVSEMMNTWTVHKGFPLVTVK-RNGPQVTLSQEHFL----LNAENGTDDS--SLWHIPLTYVNDSCSVLRSCKQVFHLKDKEATLQLPG---QVKWLKFNFRSDGFYIVHYDEQGWSDLISALKVDVNVLPSEDKAALINNIFALS-RLGKVSFRQVLNLMDYIRNETETAPLTEALSQLGQIYRLLDKRSDLNLASSMTTYIE----SHFGSLMESQSWEVETSVSKMT-LRSALLETACALNRPNCTTQARRLFDQWLASNKTLQIPSDLMRTVFKVAAKTD---EGWSKLLGSYKHSIYDTEKRKMLEALASTQDVRKIIWVLQKSLD 893          
BLAST of Aminopeptidase vs. Ensembl Zebrafish
Match: lnpep (leucyl/cystinyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-030131-1534])

HSP 1 Score: 261.151 bits (666), Expect = 1.737e-72
Identity = 234/824 (28.40%), Postives = 374/824 (45.39%), Query Frame = 2
Query:  215 CNKSTAAMTTEPPRPPVIEIENSIF-----YLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRS-NVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPN-LKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAI--AAPILSF------VESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYS--PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPL-YIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRS---FYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERW-KNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKYYAMGCS-----KVPWIIEKNID 2605
            C KS ++M++  P    I     +F      LP SV P+ Y +S+  D N +        QGN+SI+ L+++ T  I LHSS+  +I+        + D K     RF   +    I I    ++ KG+ Y+++ +     + +N   G  +  Y    G    L ATQF+P +AR  FPCFDEP FK+ F + +T   +Y  LSNMP+I    +  +N +  +   FE S  M  Y +AF + +FS   K   K     ++A   +  + H+AL T  +  + +     I++PL K+D +AIP+ L G   ME++GLIT+ E  ++   +    F K L  S+I HE+AHQWFGNLVT   W DLWLNEGFAT+  Y     V  D +   +E L++         + AL K A+  + P+ +F      VE  FD ++Y+KG  I+ ML   LR   F+  +  YL +    +    DLW SL++ S   + +  +++ W     +P++ V       + L Q   +      +    DDS  S+W+IPL Y+        S  +   L+     LQL        WL  N   + F+   Y+   +  L   L  +  ++P  ++A +I + + LS +  +    ++L L  YI  ET+  P+  A++ L ++  L + RS          YIE    S F   +     +   S S  T LR  L    C +    C      + ++W  +N  L    DL+        + D   E W  L  +     +D    K      S     K+ W+++K++D
Sbjct:  142 CQKSNSSMSSIYP----ISTSGELFPWTDLRLPVSVHPVHYNISLHPDLNSMTF------QGNVSIVVLVMHETKNIILHSSDMNIIK-------VTFDDK---EYRFLEYKPWQQIAIKFPEDLKKGQ-YVLKFSY--KANLSNSYDGFYNSSYVDTAGTKRVLAATQFEPLAARKAFPCFDEPAFKSTFVVKMTREAKYISLSNMPKIK---TTDLNENGLQEDEFESSVKMSTYLVAFIVAEFSSHSKNVSK-TTVSVYAVPDKKDQVHYALETACKLLKFYNTFFEIEYPLSKLDLVAIPDFLAG--AMENWGLITFRETTLLVGNQSS-RFDKQLVTSVIAHELAHQWFGNLVTMRWWNDLWLNEGFATYMQYMSIENVFPD-LDIDIEFLNV--------RFKALAKDALNSSHPVSTFVSTPEQVEEMFDSVSYEKGASILLMLNATLRDGEFHKGVIEYLQNYNLSNTESKDLWNSLSQVSKQSLNVSEMMNTWTVHKGFPLVTVK-RNGPQVTLSQEHFL----LNAENGTDDS--SLWHIPLTYVNDSCSVLRSCKQVFHLKDKEATLQLPG---QVKWLKFNFRSDGFYIVHYDEQGWSDLISALKVDVNVLPSEDKAALINNIFALS-RLGKVSFRQVLNLMDYIRNETETAPLTEALSQLGQIYRLLDKRSDLNLASSMTTYIE----SHFGSLMESQSWEVETSVSKMT-LRSALLETACALNRPNCTTQARRLFDQWLASNKTLQIPSDLMRTVFKVAAKTD---EGWSKLLGSYKHSIYDTEKRKMLEALASTQDVRKIIWVLQKSLD 907          
BLAST of Aminopeptidase vs. Ensembl Zebrafish
Match: lnpep (leucyl/cystinyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-030131-1534])

HSP 1 Score: 261.151 bits (666), Expect = 2.034e-72
Identity = 234/824 (28.40%), Postives = 374/824 (45.39%), Query Frame = 2
Query:  215 CNKSTAAMTTEPPRPPVIEIENSIF-----YLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRS-NVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPN-LKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAI--AAPILSF------VESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYS--PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPL-YIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRS---FYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERW-KNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKYYAMGCS-----KVPWIIEKNID 2605
            C KS ++M++  P    I     +F      LP SV P+ Y +S+  D N +        QGN+SI+ L+++ T  I LHSS+  +I+        + D K     RF   +    I I    ++ KG+ Y+++ +     + +N   G  +  Y    G    L ATQF+P +AR  FPCFDEP FK+ F + +T   +Y  LSNMP+I    +  +N +  +   FE S  M  Y +AF + +FS   K   K     ++A   +  + H+AL T  +  + +     I++PL K+D +AIP+ L G   ME++GLIT+ E  ++   +    F K L  S+I HE+AHQWFGNLVT   W DLWLNEGFAT+  Y     V  D +   +E L++         + AL K A+  + P+ +F      VE  FD ++Y+KG  I+ ML   LR   F+  +  YL +    +    DLW SL++ S   + +  +++ W     +P++ V       + L Q   +      +    DDS  S+W+IPL Y+        S  +   L+     LQL        WL  N   + F+   Y+   +  L   L  +  ++P  ++A +I + + LS +  +    ++L L  YI  ET+  P+  A++ L ++  L + RS          YIE    S F   +     +   S S  T LR  L    C +    C      + ++W  +N  L    DL+        + D   E W  L  +     +D    K      S     K+ W+++K++D
Sbjct:  151 CQKSNSSMSSIYP----ISTSGELFPWTDLRLPVSVHPVHYNISLHPDLNSMTF------QGNVSIVVLVMHETKNIILHSSDMNIIK-------VTFDDK---EYRFLEYKPWQQIAIKFPEDLKKGQ-YVLKFSY--KANLSNSYDGFYNSSYVDTAGTKRVLAATQFEPLAARKAFPCFDEPAFKSTFVVKMTREAKYISLSNMPKIK---TTDLNENGLQEDEFESSVKMSTYLVAFIVAEFSSHSKNVSK-TTVSVYAVPDKKDQVHYALETACKLLKFYNTFFEIEYPLSKLDLVAIPDFLAG--AMENWGLITFRETTLLVGNQSS-RFDKQLVTSVIAHELAHQWFGNLVTMRWWNDLWLNEGFATYMQYMSIENVFPD-LDIDIEFLNV--------RFKALAKDALNSSHPVSTFVSTPEQVEEMFDSVSYEKGASILLMLNATLRDGEFHKGVIEYLQNYNLSNTESKDLWNSLSQVSKQSLNVSEMMNTWTVHKGFPLVTVK-RNGPQVTLSQEHFL----LNAENGTDDS--SLWHIPLTYVNDSCSVLRSCKQVFHLKDKEATLQLPG---QVKWLKFNFRSDGFYIVHYDEQGWSDLISALKVDVNVLPSEDKAALINNIFALS-RLGKVSFRQVLNLMDYIRNETETAPLTEALSQLGQIYRLLDKRSDLNLASSMTTYIE----SHFGSLMESQSWEVETSVSKMT-LRSALLETACALNRPNCTTQARRLFDQWLASNKTLQIPSDLMRTVFKVAAKTD---EGWSKLLGSYKHSIYDTEKRKMLEALASTQDVRKIIWVLQKSLD 916          
BLAST of Aminopeptidase vs. Ensembl Zebrafish
Match: anpepa (alanyl (membrane) aminopeptidase a [Source:ZFIN;Acc:ZDB-GENE-030131-4781])

HSP 1 Score: 254.603 bits (649), Expect = 1.592e-70
Identity = 204/760 (26.84%), Postives = 350/760 (46.05%), Query Frame = 2
Query:  383 GNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNI--TRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQ---TPQGKIEQLLATQF-QPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVD---FSFIQKTDEKGRKFRIWARKSQIYKAH--FALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLND-EVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSD-WLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSI----YTGL--RRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVK---YYAMGCSKVPWIIEK 2596
            GN ++       +  + LH   N+ +  + VR     ++K+ L K + I    +N + I+L   + +   Y I    FE     +  +G  + +Y    T     E+ LAT   QP  ARTVFPCFDEP  KA F++TI    E    SN  E     +I IN + W   +F+ +  M  Y L F I D   FS++ K      K  +  R   I   H  +AL TT      +E    + +P+ K+D +A+P+  G   ME++G I+Y+E  ++++++   +F +    ++I HE+AHQWFGNLVT + W DLWL EGFAT+ SYK    V  D +    L  +     + + +    L  +A      S +   FD + Y KG  ++ ML   + +N F   +  YL+  +F++  P DLWE LN  + + ++  +  W  +  YP++ +         +      + + F   +K +    S+W+IP+  M         P F   +    I     F +  D WLL N+NC  F+  +Y+   ++RL+ QL KNHR+IP INR Q+I D ++L++   R ++   L L  Y+  + + +P  +A+  LD    +F+    Y    KY+  ++   ++ +      ++ ++ +I    YT    +       C      C  + + +   +KN S  +   +L     C  +   +  ++W  ++    +Q       K    YA+ C+K  W++ +
Sbjct:   98 GNSTVRVNCTKTSSRVFLHV-HNINVTAVEVRK-SDTNEKLPL-KGYQIFKNETNFLDIHLEVAIKENGTYDI-FTEFEGELLEDL-TGFYASRYTGKGTDDEDEERFLATSLLQPTDARTVFPCFDEPAMKAVFTITIIHRPEIRARSN--EDGDPRTIQINGTDWIRTTFKPTKKMSSYLLGFIIYDTHTFSYVSKGTRT--KIHVHGRSEAIDAGHADYALETTETILSHYENIFGLRYPMSKIDQIALPDF-GVRAMENWGFISYQESGLLYDKETASTFDEEQVTTLIAHELAHQWFGNLVTMSWWNDLWLKEGFATYMSYKGVEAVGWDLKDLIVLREIQTAFQMDSLNTSHPLSMNAYDVQTSSQISELFDDITYSKGAAVLRMLATRMGENEFMKGVKMYLSKFQFENTVPKDLWECLNMDTHIKVDEFMKTWTEEVGYPVLTI---------ITDTGDTSQEQF--LLKKEGGHDSLWHIPIKYMTLKAGVKEFPNFFTDKGPDPIPD---FKIGKDNWLLANINCTGFYRVNYDEENWNRLTAQLQKNHRIIPLINRGQLIDDAFNLARA-HRLNVTIALNLTKYLINDLEYIPWESALKNLDFFTLMFDRSEVYGPIMKYLRNLVTPLYEEY-----EEYTINGTIPIEKYTDQCNQVNAITVACSNGLPECITMAKDLFSDYKNGSNPIHP-NLRRAVYCSAVASGDE-DDWEYVW--EEYQKATVAAEKDKLRYALSCTKEIWLLNR 823          
BLAST of Aminopeptidase vs. Ensembl Zebrafish
Match: BX005410.1 (si:ch211-106j24.1 [Source:NCBI gene;Acc:555478])

HSP 1 Score: 249.21 bits (635), Expect = 1.248e-68
Identity = 212/843 (25.15%), Postives = 387/843 (45.91%), Query Frame = 2
Query:  197 QNKCCKCNKSTAAMTTEPPRPPVIEIENSIFYLPNSVWPLEYRLSMKFDFNQLKLNSDSRA--QGNLSIIALIINRTDMISLHSSENVLI----RQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTP---QGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQI--YKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESK----------FDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSP---VP--IENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTF----KSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVS-SDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTL-FNFGCKMKFSFCFVITEAIVERWKNNSLLLTDY-DLLHVALCQYIQMDNYGE---NWRLLYSNRNFQSWDYINVKYYAMGCSKVPWIIEKNIDIAYN 2617
            +N     N +T+A+   PP P         + LP+++ P  Y +++   + Q+ ++++      G   ++   + +TD+I +HS++  L     R  ++  +  V     +   +  T++  + I L   ++ G+ Y +         FT + +  +   Y++     G+ + +  TQ Q   AR  FPCFDEP  KA F++ +  +R  + LSN  EI     I I+       +FE +  M  Y +AF + DFS+I   D+ G   RIWARK  I   +  +AL+ T      FE   N  +PL K D +A+P+      ME++GL+TY E  ++++ +   + +K    +++ HE+AH WFGNLVT   W DLWLNEGFA++  Y  A     +  +   + + +++  R F      + S  ++  LS  E +          F  ++Y KG  ++ ML + L +  F   ++NYL    F S   +DLW+ L K +P   +P  I  ++  W+ Q  +P+I +     ++ N+ Q   +  K      KS   Y+      W +P+  M   +         K  ++  +       VS  +W+L N   + +F  +Y+   ++RL  QL  NH+ IP +NRAQI+ D ++L++    N +   L+   Y+  E + +P   A+  L+    LF+    Y     Y++K +   F+ F     N  ++ N       + +  +  C      C  IT++  ++W  N  +   + +L     C  I      E    W++    +   + + + ++  A+ C+KVPW++ + ++ + N
Sbjct:   39 KNTAKLTNATTSAV---PPTPKPSNEPWDKYRLPDTLSPQYYNITL---WPQMVMDANGMYIFTGISDVMFTCVKKTDLILIHSNKLNLTLFNGRHAKLTGMSGVTAPA-IKSTWLQTQTQYLVIQLKGKLNPGKSYWLHT------EFTGELADDLEGFYRSEYMEDGEKKIIAITQMQATYARKAFPCFDEPGMKAVFNIILIHDRGMTALSNSQEIRTEDVI-IDEMPVTRTTFEPTARMSTYLVAFVVSDFSYINNEDKAGVLVRIWARKKAIDDGQGDYALSITQPILEFFESYYNTSYPLSKSDQVALPDFNSG-AMENWGLVTYRETALLYDPQTSANGNKQRIATVVSHELAHMWFGNLVTLKWWNDLWLNEGFASYVEYLGADHA--EPTWNIKDQIILYDMQRAF-----AVDSLTSSHPLSRKEEEVNTPAEISEMFSTISYSKGAAVLKMLSEFLTEPVFAKGLSNYLKQFAFGSSVHSDLWDHLQKVTPGMKLPRSIHEIMSRWILQMGFPVITID---TRTGNVSQKHFLVEKDAVVERKSEFNYE------WFVPIKWMKKGQVQDQMWLLQKSAIHKPM------KVSKGEWVLANHKVSGYFRVNYDHGNWERLLSQLETNHQTIPVVNRAQILDDAFNLARASIIN-ITLALRTTKYLVREREYIPWEAALRSLNYFFQLFDRNEVYGALQAYLKKQVKPLFEHFGTISSNWTKVPNGHTDQFTQIIALSLACGTGVEGCREITKSWFKKWMQNPRVNPIHPNLRSTVYCNAIAAGGADEWNFGWQMF--QKATVAAEAVKLR-AALACTKVPWLLNRYLEYSIN 840          
BLAST of Aminopeptidase vs. Ensembl Xenopus
Match: LNPEP (leucyl/cystinyl aminopeptidase [Source:NCBI gene;Acc:100216271])

HSP 1 Score: 257.684 bits (657), Expect = 4.520e-71
Identity = 245/931 (26.32%), Postives = 420/931 (45.11%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEI---NNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDF-SFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAA--PILSFVESK------FDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPV--PIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSD--WLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYT-GLRRTLFNFGCKMKFSFCFVITEAIVERWK-NNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKYYAMGCS-----KVPWIIEKNIDIAYNVLKNFSKRNDFPHVSEIIIDDIPPDYLHGTTXXXXXXXXXXXYNTPNSINFLYRFKKDGLGVIYNSLLYPPHFPLPN--SIVEYAIPTLSHYNFII-YLSHDKLKPRNV-ILKDA----KSNIDWILKNNIEN 2992
            LPNS+ P+ Y L++  D   +         G + I   I   ++ I LHSS    +R I+     +    M+ A+         I I L  ++ KG++ ++ I   +NF S ++     G     Y   +G    L ATQF+P +AR VFPCFDEP FK+ F + I  N+    LSNMP++ C ++            +  S  M  Y +AF + D  +  Q+T++      ++A   ++ +  +AL++ ++    +    NI +PLKK+D +AIP+ +    ME++GLIT+ E  +++ E       K     +I HE+AHQWFGNLVT   W DLWLNEGFAT+  Y     V    +F  L   + F  +R    + AL K ++ A  PI + ++S       FD L+Y KG  I+ ML+  L ++ F+  I  YL + ++ S T + LW+S+N  +     ++N++  W  ++ YP++  ++ + + + ++Q   +   +      +  +  ++W+IPL  +  NET      F           L   NVSS+  W+  N+N   ++  DY    +D L  QLL++H ++   +RA +I D + L+    +  L K  +L  Y+  ET+  PI  A+N    ++G+   R      ++  +K++    K   N     +    ++    LR +L +F C      C      +   W+ NN+ + TD     V    +       E W  L+       ++    K      S     K+ W++++++D          +  + P V   I     P YL                         + F K    +I    + P  FP+ +  S   Y   T +H N +I + +  K K R +  +K+A    K NI+W +KNN+++
Sbjct:  164 LPNSIKPVHYVLTLHPDMTTMYF------AGTVQIKLNITASSNNIVLHSSG---LRIIKAHVSVTEGTTMD-AEVLEYPTFEEIAIILPESLPKGKECLLTIQYTSNFSSTYY-----GFYKIDYME-KGNKRSLAATQFEPLAARKVFPCFDEPAFKSTFQINIIRNQSMISLSNMPKVRCVAAEEDYDGLLLD-EYSTSVNMSTYLVAFIVGDIKNTTQETNDT--LVSVYAVPEKMDQVKYALDSAMKLLYFYSNYYNIAYPLKKLDLVAIPDFQAG-AMENWGLITFRETALLYKEDSSSVADKQSITKVIAHELAHQWFGNLVTMEWWNDLWLNEGFATYMEY-----VSMSSLFPELNSENSFLKMR----FTALQKDSLNASHPISTDIQSPEQIEEMFDDLSYIKGASILLMLQAFLSEDVFHHCIMEYLQAHQYGSTTSDSLWDSMNVVTNKNPNVKNMMKTWTQKAGYPLV-TALRKGEEITVQQERFLRTPS----PDHATNASTVWHIPLTYVTRNETNCIFLLF----------LLGRINVSSEFPWVKFNVNMTGYYIVDYGADGWDALIKQLLRDHTVLHSSDRANLIHDIFMLA-GVGKVPLAKAFELLGYLANETNSAPITQALNQFYHIHGILLKRGL----DELSDKVMERGLKLLSNLINQTWEDEGTLAERELRSSLLDFACSSGLQSCVDKAMELFNIWRLNNTRIPTD-----VMKVVFKVGAKTAEGWAFLWDKYTTSLYETEKRKILEALASTDNGRKLQWLMQESLD------GGLIRSQELPAVLGFISKG-SPGYL-----------------------LAWEFAKQNWDLITQKFM-PGSFPIQSIVSTTTYHFSTDTHLNEVIAFFNSTKGKSREMWCVKEAVETIKFNIEW-MKNNLDS 1008          
BLAST of Aminopeptidase vs. Ensembl Xenopus
Match: LNPEP (leucyl/cystinyl aminopeptidase [Source:NCBI gene;Acc:100216271])

HSP 1 Score: 253.062 bits (645), Expect = 1.785e-69
Identity = 247/936 (26.39%), Postives = 422/936 (45.09%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEI---NNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDF-SFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAA--PILSFVESK------FDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYS-PVP-IENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQL-----NTFNVSSD--WLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYT-GLRRTLFNFGCKMKFSFCFVITEAIVERWK-NNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKYYAMGCS-----KVPWIIEKNIDIAYNVLKNFSKRNDFPHVSEIIIDDIPPDYLHGTTXXXXXXXXXXXYNTPNSINFLYRFKKDGLGVIYNSLLYPPHFPLPN--SIVEYAIPTLSHYNFII-YLSHDKLKPRNV-ILKDA----KSNIDWILKNNIEN 2992
            LPNS+ P+ Y L++  D   +         G + I   I   ++ I LHSS    +R I+     +    M+ A+         I I L  ++ KG++ ++ I   +NF S ++     G     Y   +G    L ATQF+P +AR VFPCFDEP FK+ F + I  N+    LSNMP+    +     S       +  S  M  Y +AF + D  +  Q+T++      ++A   ++ +  +AL++ ++    +    NI +PLKK+D +AIP+ +    ME++GLIT+ E  +++ E       K     +I HE+AHQWFGNLVT   W DLWLNEGFAT+  Y     V    +F  L   + F  +R    + AL K ++ A  PI + ++S       FD L+Y KG  I+ ML+  L ++ F+  I  YL + ++ S T + LW+S+N  +   P ++N++  W  ++ YP++  ++ + + + ++Q   +   +      +  +  ++W+IPL  +        T K S +E   D + L        NVSS+  W+  N+N   ++  DY    +D L  QLL++H ++   +RA +I D + L+    +  L K  +L  Y+  ET+  PI  A+N    ++G+   R      ++  +K++    K   N     +    ++    LR +L +F C      C      +   W+ NN+ + TD     V    +       E W  L+       ++    K      S     K+ W++++++D          +  + P V   I     P YL                         + F K    +I    + P  FP+ +  S   Y   T +H N +I + +  K K R +  +K+A    K NI+W +KNN+++
Sbjct:  165 LPNSIKPVHYVLTLHPDMTTMYF------AGTVQIKLNITASSNNIVLHSSG---LRIIKAHVSVTEGTTMD-AEVLEYPTFEEIAIILPESLPKGKECLLTIQYTSNFSSTYY-----GFYKIDYME-KGNKRSLAATQFEPLAARKVFPCFDEPAFKSTFQINIIRNQSMISLSNMPK----AKTSTMSDGLLLDEYSTSVNMSTYLVAFIVGDIKNTTQETNDT--LVSVYAVPEKMDQVKYALDSAMKLLYFYSNYYNIAYPLKKLDLVAIPDFQAG-AMENWGLITFRETALLYKEDSSSVADKQSITKVIAHELAHQWFGNLVTMEWWNDLWLNEGFATYMEY-----VSMSSLFPELNSENSFLKMR----FTALQKDSLNASHPISTDIQSPEQIEEMFDDLSYIKGASILLMLQAFLSEDVFHHCIMEYLQAHQYGSTTSDSLWDSMNVVTNKNPNVKNMMKTWTQKAGYPLV-TALRKGEEITVQQERFLRTPS----PDHATNASTVWHIPLTYV--------TRKCSGIEPQCDNIYLLKEVTGRINVSSEFPWVKFNVNMTGYYIVDYGADGWDALIKQLLRDHTVLHSSDRANLIHDIFMLA-GVGKVPLAKAFELLGYLANETNSAPITQALNQFYHIHGILLKRGL----DELSDKVMERGLKLLSNLINQTWEDEGTLAERELRSSLLDFACSSGLQSCVDKAMELFNIWRLNNTRIPTD-----VMKVVFKVGAKTAEGWAFLWDKYTTSLYETEKRKILEALASTDNGRKLQWLMQESLD------GGLIRSQELPAVLGFISKG-SPGYL-----------------------LAWEFAKQNWDLITQKFM-PGSFPIQSIVSTTTYHFSTDTHLNEVIAFFNSTKGKSREMWCVKEAVETIKFNIEW-MKNNLDS 1013          
BLAST of Aminopeptidase vs. Ensembl Xenopus
Match: LNPEP (leucyl/cystinyl aminopeptidase [Source:NCBI gene;Acc:100216271])

HSP 1 Score: 252.677 bits (644), Expect = 2.438e-69
Identity = 247/936 (26.39%), Postives = 422/936 (45.09%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEI---NNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDF-SFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAA--PILSFVESK------FDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYS-PVP-IENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQL-----NTFNVSSD--WLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYT-GLRRTLFNFGCKMKFSFCFVITEAIVERWK-NNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKYYAMGCS-----KVPWIIEKNIDIAYNVLKNFSKRNDFPHVSEIIIDDIPPDYLHGTTXXXXXXXXXXXYNTPNSINFLYRFKKDGLGVIYNSLLYPPHFPLPN--SIVEYAIPTLSHYNFII-YLSHDKLKPRNV-ILKDA----KSNIDWILKNNIEN 2992
            LPNS+ P+ Y L++  D   +         G + I   I   ++ I LHSS    +R I+     +    M+ A+         I I L  ++ KG++ ++ I   +NF S ++     G     Y   +G    L ATQF+P +AR VFPCFDEP FK+ F + I  N+    LSNMP+    +     S       +  S  M  Y +AF + D  +  Q+T++      ++A   ++ +  +AL++ ++    +    NI +PLKK+D +AIP+ +    ME++GLIT+ E  +++ E       K     +I HE+AHQWFGNLVT   W DLWLNEGFAT+  Y     V    +F  L   + F  +R    + AL K ++ A  PI + ++S       FD L+Y KG  I+ ML+  L ++ F+  I  YL + ++ S T + LW+S+N  +   P ++N++  W  ++ YP++  ++ + + + ++Q   +   +      +  +  ++W+IPL  +        T K S +E   D + L        NVSS+  W+  N+N   ++  DY    +D L  QLL++H ++   +RA +I D + L+    +  L K  +L  Y+  ET+  PI  A+N    ++G+   R      ++  +K++    K   N     +    ++    LR +L +F C      C      +   W+ NN+ + TD     V    +       E W  L+       ++    K      S     K+ W++++++D          +  + P V   I     P YL                         + F K    +I    + P  FP+ +  S   Y   T +H N +I + +  K K R +  +K+A    K NI+W +KNN+++
Sbjct:  154 LPNSIKPVHYVLTLHPDMTTMYF------AGTVQIKLNITASSNNIVLHSSG---LRIIKAHVSVTEGTTMD-AEVLEYPTFEEIAIILPESLPKGKECLLTIQYTSNFSSTYY-----GFYKIDYME-KGNKRSLAATQFEPLAARKVFPCFDEPAFKSTFQINIIRNQSMISLSNMPK----AKTSTMSDGLLLDEYSTSVNMSTYLVAFIVGDIKNTTQETNDT--LVSVYAVPEKMDQVKYALDSAMKLLYFYSNYYNIAYPLKKLDLVAIPDFQAG-AMENWGLITFRETALLYKEDSSSVADKQSITKVIAHELAHQWFGNLVTMEWWNDLWLNEGFATYMEY-----VSMSSLFPELNSENSFLKMR----FTALQKDSLNASHPISTDIQSPEQIEEMFDDLSYIKGASILLMLQAFLSEDVFHHCIMEYLQAHQYGSTTSDSLWDSMNVVTNKNPNVKNMMKTWTQKAGYPLV-TALRKGEEITVQQERFLRTPS----PDHATNASTVWHIPLTYV--------TRKCSGIEPQCDNIYLLKEVTGRINVSSEFPWVKFNVNMTGYYIVDYGADGWDALIKQLLRDHTVLHSSDRANLIHDIFMLA-GVGKVPLAKAFELLGYLANETNSAPITQALNQFYHIHGILLKRGL----DELSDKVMERGLKLLSNLINQTWEDEGTLAERELRSSLLDFACSSGLQSCVDKAMELFNIWRLNNTRIPTD-----VMKVVFKVGAKTAEGWAFLWDKYTTSLYETEKRKILEALASTDNGRKLQWLMQESLD------GGLIRSQELPAVLGFISKG-SPGYL-----------------------LAWEFAKQNWDLITQKFM-PGSFPIQSIVSTTTYHFSTDTHLNEVIAFFNSTKGKSREMWCVKEAVETIKFNIEW-MKNNLDS 1002          
BLAST of Aminopeptidase vs. Ensembl Xenopus
Match: ERAP1 (endoplasmic reticulum aminopeptidase 1 [Source:NCBI gene;Acc:100496768])

HSP 1 Score: 251.136 bits (640), Expect = 3.055e-69
Identity = 221/825 (26.79%), Postives = 359/825 (43.52%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYII--EINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPIL--SFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSP-----------------------VPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKIS--IWNIPL-YIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWK-NNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSN-RNFQSWDYINVKYYAMGCS----KVPWIIEKNIDIAYNVLKNFSKRNDFPHV 2659
            LP    PL Y L +  +   L  +      G   +   +  +T  + LHS    + +    R +       +L  R +      I +     +  GE Y I  E N   S +F     G     Y+T  G++  L +TQF+P +ART FPCFDEP FKA+FS+ I    ++  +SNMP +    ++ I     +   F  S  M  Y +AF + DF  I +    G +  ++A   +I +A +AL   V+    +E   NI +PL K D  AIP+ +    ME++GL TY E  ++ + K   +  K+    II HE+AHQWFGNLVT   W DLWLNEGFA F  Y ++ +V   E+   +E   +    R  D        A++ P+     ++  FD ++Y KG  I++ML   +   +F   I +YL    + +    DLW S+    P                       + ++++++ W  Q  +P++ V++ + K + L Q   +   T        D++ S  +W+IPL YI   + T       SK    +D+L L       +W+  N+  N ++   Y G  +D L   L +NH  I   +RA +I   + L     R  + K L L LY++ E   +P+F  ++ L  +  L E R      ++  + ILN    R L D ++     +     LR +L  F C  ++  C    E   +RW+ +N  +    D   VA   Y       E W  L+   +   S    N    A+  +    K+ W++E+ +        +  +  D PH+
Sbjct:   53 LPTFAAPLHYDLLIHPNLTTLTFS------GLTKVTVTVTQKTSFLVLHSKHLEITKTTIKRKLGKDPVLQDLLLREHPVNEQ-IALLAADPLIPGENYTIYIEYNANLSKNF----RGFYKSTYKTKDGEVRVLASTQFEPTAARTAFPCFDEPAFKASFSIQIRREPKHHAVSNMPVVK---TVNIGGGLLED-HFAASVKMSTYLVAFIVSDFKSISQVTNHGVRISVYATPEKIDQAEYALKAAVKLLDFYEDYFNISYPLPKQDLAAIPDFQSG-AMENWGLTTYRESALLHDPKTSTASHKLWVTMIIAHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEY-VSVRVTYPEL--QVEDYFLDKCFRAMDVDSLNSSHAVSTPVENPEEIQEMFDEVSYDKGACILNMLMDYMGAESFEAGIVDYLRRYSYRNARNEDLWNSMTDVCPSDETNSGYCTKTRQTSHWSEGEIIDVKSMMNTWTLQKGFPLVTVTV-KGKYVYLHQEHYLKGST--------DTEASGLLWHIPLTYITSKSNTVQRFLLMSK----TDVLVLAE---EVEWIKFNVGMNGYYIVHYEGEGWDALIKLLQENHTAISSNDRANLINSAFQLV-SIGRLPIDKALSLSLYLKNEDKIMPVFQGMDELIPIYKLMEKRDMQEVESQMKKYILN--LLRKLIDAQSWTDEGSVSERMLRSSLLLFACVRQYQPCVQRAEQYFKRWQESNGTISLPRD---VASAVYAVGAQTPEGWDFLFEKYKTTLSGSEKNQIELALAITSLKHKLQWLMEEGMK------GDHVRTQDLPHI 830          
BLAST of Aminopeptidase vs. Ensembl Xenopus
Match: ERAP1 (endoplasmic reticulum aminopeptidase 1 [Source:NCBI gene;Acc:100496768])

HSP 1 Score: 250.751 bits (639), Expect = 3.604e-69
Identity = 221/825 (26.79%), Postives = 359/825 (43.52%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYII--EINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPIL--SFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSP-----------------------VPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKIS--IWNIPL-YIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWK-NNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSN-RNFQSWDYINVKYYAMGCS----KVPWIIEKNIDIAYNVLKNFSKRNDFPHV 2659
            LP    PL Y L +  +   L  +      G   +   +  +T  + LHS    + +    R +       +L  R +      I +     +  GE Y I  E N   S +F     G     Y+T  G++  L +TQF+P +ART FPCFDEP FKA+FS+ I    ++  +SNMP +    ++ I     +   F  S  M  Y +AF + DF  I +    G +  ++A   +I +A +AL   V+    +E   NI +PL K D  AIP+ +    ME++GL TY E  ++ + K   +  K+    II HE+AHQWFGNLVT   W DLWLNEGFA F  Y ++ +V   E+   +E   +    R  D        A++ P+     ++  FD ++Y KG  I++ML   +   +F   I +YL    + +    DLW S+    P                       + ++++++ W  Q  +P++ V++ + K + L Q   +   T        D++ S  +W+IPL YI   + T       SK    +D+L L       +W+  N+  N ++   Y G  +D L   L +NH  I   +RA +I   + L     R  + K L L LY++ E   +P+F  ++ L  +  L E R      ++  + ILN    R L D ++     +     LR +L  F C  ++  C    E   +RW+ +N  +    D   VA   Y       E W  L+   +   S    N    A+  +    K+ W++E+ +        +  +  D PH+
Sbjct:   46 LPTFAAPLHYDLLIHPNLTTLTFS------GLTKVTVTVTQKTSFLVLHSKHLEITKTTIKRKLGKDPVLQDLLLREHPVNEQ-IALLAADPLIPGENYTIYIEYNANLSKNF----RGFYKSTYKTKDGEVRVLASTQFEPTAARTAFPCFDEPAFKASFSIQIRREPKHHAVSNMPVVK---TVNIGGGLLED-HFAASVKMSTYLVAFIVSDFKSISQVTNHGVRISVYATPEKIDQAEYALKAAVKLLDFYEDYFNISYPLPKQDLAAIPDFQSG-AMENWGLTTYRESALLHDPKTSTASHKLWVTMIIAHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEY-VSVRVTYPEL--QVEDYFLDKCFRAMDVDSLNSSHAVSTPVENPEEIQEMFDEVSYDKGACILNMLMDYMGAESFEAGIVDYLRRYSYRNARNEDLWNSMTDVCPSDETNSGYCTKTRQTSHWSEGEIIDVKSMMNTWTLQKGFPLVTVTV-KGKYVYLHQEHYLKGST--------DTEASGLLWHIPLTYITSKSNTVQRFLLMSK----TDVLVLAE---EVEWIKFNVGMNGYYIVHYEGEGWDALIKLLQENHTAISSNDRANLINSAFQLV-SIGRLPIDKALSLSLYLKNEDKIMPVFQGMDELIPIYKLMEKRDMQEVESQMKKYILN--LLRKLIDAQSWTDEGSVSERMLRSSLLLFACVRQYQPCVQRAEQYFKRWQESNGTISLPRD---VASAVYAVGAQTPEGWDFLFEKYKTTLSGSEKNQIELALAITSLKHKLQWLMEEGMK------GDHVRTQDLPHI 823          
BLAST of Aminopeptidase vs. Ensembl Mouse
Match: Lvrn (laeverin [Source:MGI Symbol;Acc:MGI:1921824])

HSP 1 Score: 268.085 bits (684), Expect = 7.273e-75
Identity = 210/781 (26.89%), Postives = 358/781 (45.84%), Query Frame = 2
Query:  461 RQIRVRNIFSVDQKMNLAKRFNITR------SNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQE-----SGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAH--FALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMAT----KVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESK-----FDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLN--------KYSPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKI---------LNSTFKRFLNDFRNDFRLSNSIYTGL--RRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKY-----------YAMGCSKVPWIIEKNIDIAYN-VLKNFSKRN 2644
            +Q+ V    + D +     R  + +         + + L  ++  G +Y +      S HF+ Q       G+    Y   + ++  L+ATQ +P  AR VFPCFDEP  KA F++T+  +  Y+ LSNMP++     I +N S W   +F  +P MP Y +A  + D   I +T E+G++ R+WARK  I   +  FA N T   F   E   NI + L K D +A+P       ME++GL+ ++E  ++   +  L+  + + +SII HEV HQWFGNLVT + W ++WLNEGFA+++  ++      KV  + +F+     ++ + +   D   AL   A++  + +F E+      FD   YKKG  +  ML   L  + F  A+ +YL +  + +   +DLW  +          + P  ++ ++D W  +  +PII V    N S  + +         +++     S  S W +P++ M  N          K  M    ++L+  +  SDW++LN N   ++  +Y+ + + +LS QL K+ + IP INR Q++ D + L+K     ++   L L  YI AE D + ++  V LL+ +N     R    D N Y              NS +  +    R +       Y  L     +F   C +    C  ++  + ++W  +        + +  LC  + + +  ++W  L++        YIN              +AM CSK PWI+ + ++ A   V  NFS+ N
Sbjct:  151 KQVEVWGPLAQDTRNATVGRVQVEKVWFAPDMQFVVLDLGQSLEPGSRYEL------SFHFSGQVLQVGLEGLFLNLYHD-EDELRALVATQMEPTFARHVFPCFDEPALKATFNITVIHHPGYAALSNMPQLGQSERIDVNGSRWTVTTFHTTPRMPTYLVALVVCDLDHISRT-ERGKEIRVWARKDDIASGYLDFAANITGPIFSFLEDLFNISYRLPKTDIVALPIFASG-AMENWGLLIFDESSLLLEPEDELTEKRAMILSIIAHEVGHQWFGNLVTMSWWNNIWLNEGFASYFELELTNYFYPKVPMNMIFF----FTVLHGILGEDH--ALESRAVSTAVENFTETSEINRLFDLYTYKKGACMAWMLASFLSPHLFINALKSYLETFSYSNAEQDDLWRHIQMAIGEQNVTHLPATVKGIMDSWTHRGGFPIITV----NVSTGVVKQEPFYLDKVENQTLL--SHNSTWIVPIFWM-KNGIPQPLVWLDKSNMMFPGMKLS--DSDSDWVILNFNVTGYYRVNYDELGWKKLSEQLEKDPKAIPVINRLQLVSDAFALTKN-NYIEIETALDLTKYI-AEEDEILVWFEV-LLNLIN-----REVIYDVNNYALYPLLKKYLLKRFNSIWNTYSAIIRENVASLQDNYLSLFSLERIFETACWLGLEDCLQLSRELFKKWTAHPETAIPPQIENAVLCSAVALGS-DKDWDFLFNL-------YINTTEEEDESRRRRLVHAMSCSKDPWILNRFMEYAITAVSSNFSETN 891          
BLAST of Aminopeptidase vs. Ensembl Mouse
Match: Enpep (glutamyl aminopeptidase [Source:MGI Symbol;Acc:MGI:106645])

HSP 1 Score: 244.202 bits (622), Expect = 5.997e-67
Identity = 195/711 (27.43%), Postives = 331/711 (46.55%), Query Frame = 2
Query:  287 FYLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQT---PQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYS----------YKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKIS-----IWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSD-WLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFE-MRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKM 2359
            F LP+ + P+ Y L +K       L  + R  G ++I   +   T  + LH  E  + +   +R      +++ + + F   +   + I    +++      +     E   + N   G +   Y+T     G+I  + AT  +P  AR  FPCFDEP  K+ +S++I   +EYS LSNMPE        +    WK  +F  S  M  Y + FA+  F+ I++    G+  +++ + +Q   A +A N T   F  FE    +++ L K+D +AIP+  G   ME++GL+TY E  ++++     S ++    S++ HE+ HQWFGN VT   W DLWLNEGFA+F+           ++M ++VL ++VF   E  S+ +       +  ++  +  A I S     FD ++Y KG  I+ ML+  +    F      YL   +F +   +D W+SL + S +P++ V+D W +Q  YP++ VS  QN          I  K F    K D S+        WNIP  + + +   +    +++L+     + LN  N+S D +L +N +   F+  +Y G  +D ++  L  NH      +R+  I D + L++  Q  +    L L +Y+++E D +P    ++ +  +  +FE  R  YP     IE       K  + D        + I   LR ++  F CKM
Sbjct:   83 FRLPDFINPVHYDLEVK------ALMEEDRYTGIVTISVNLSKPTRDLWLHIRETKITKLPELRR--PSGEQVPIRRCFEYKKQEYVVIQAAEDLAATSGDSVYRLTMEFKGWLN---GSLVGFYKTTYMEDGQIRSIAATDHEPTDARKSFPCFDEPNKKSTYSISIIHPKEYSALSNMPE----EKSEMVDDNWKKTTFVKSVPMSTYLVCFAVHRFTAIERKSRSGKPLKVYVQPNQKETAEYAANITQAVFDYFEDYFAMEYALPKLDKIAIPDF-GTGAMENWGLVTYRETNLLYDPLLSASSNQQRVASVVAHELVHQWFGNTVTMDWWDDLWLNEGFASFFEFLGVNHAEKDWQMLSQVLLEDVFPVQEDDSLMS------SHPVVVTVSTPAEITSV----FDGISYSKGASILRMLQDWITPEKFQKGCQIYLKKFQFANAKTSDFWDSLQEASNLPVKEVMDTWTSQMGYPVVTVSGRQN----------ITQKRFLLDSKADPSQPPSELGYTWNIP--VRWADNDNSRITVYNRLDKGG--ITLNA-NLSGDAFLKINPDHIGFYRVNYEGGTWDWIAEALSSNHTRFSAADRSSFIDDAFALARA-QLLNYKIALNLTMYLKSEEDFLPWERVISSVSYIISMFEDDRELYP----MIETYFQGQVKP-VADLLGWQDTGSHITKLLRASILGFACKM 746          
BLAST of Aminopeptidase vs. Ensembl Mouse
Match: Trhde (TRH-degrading enzyme [Source:MGI Symbol;Acc:MGI:2384311])

HSP 1 Score: 236.884 bits (603), Expect = 3.886e-64
Identity = 172/603 (28.52%), Postives = 290/603 (48.09%), Query Frame = 2
Query:  671 QGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMP-EISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAH--FALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVS-IICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKS-AIAAPI------LSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESL-------NKYSPVPIENVIDGWLTQSCYPIIYV---SIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRF---LNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERW 2407
             G+   L  TQF P  AR  FPCFDEP +KA F ++I     Y  LSNMP E S F   G     W T  F  +P+M  Y LA+AI +F++ + T + G   R++AR   I +    +AL+ T      +E    + + L K+D LA+P    +  ME++GL  + E  I+ +     S S +L V+ +I HE+ HQWFG+LVT   W+D+WL EGFA ++ +      +  +  Y   ++    ++ +      L+   A + P+       + ++  FD++AYKKG  ++ ML   +  + F   + +YL   K+ +   NDLW +L        KY  V I+ V+D W  Q  YP+I +   +  +N+ L  +Q+   +       ++  +S   +W IPL I+ GN +  S+     +   S+  ++   +  S W+L N+N   +F  +Y+   +  L  QL++NH ++   NRA +I D + L++       +  L++  Y+  E D +P   A   L  L+ L +    Y  +N+YI K + +T+ +     N+F      ++  +  LRR +    C      C      ++  W
Sbjct:  257 HGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLSLSNMPVETSVFEEDG-----WVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPDAIRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPK-HPYAAMENWGLSIFVEQRILLDPSVS-SISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEF------VGTDYLYPAWNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLRATDIDRVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALRRNGKY--VNIQEVMDQWTLQMGYPVITILGNTTAENRILITQQHFIYDIGAKTKALQLQNSSY-LWQIPLTIVVGNRSHVSSEAIIWVSNKSEHHRIAYLDRGS-WILGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAALIDDAFSLARAGYLPQ-NIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNEYILKQVATTYIKLGWPRNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDW 841          
BLAST of Aminopeptidase vs. Ensembl Mouse
Match: Lnpep (leucyl/cystinyl aminopeptidase [Source:MGI Symbol;Acc:MGI:2387123])

HSP 1 Score: 235.728 bits (600), Expect = 1.045e-63
Identity = 191/729 (26.20%), Postives = 335/729 (45.95%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYF-----ALIKSAI--AAPILSFVESK------FDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYS--PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAV-------NLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYT--GLRRTLFNFGCKMKFSFCFVITEAIVERW 2407
            LP ++ PL Y LS+  +   +        +G+++I    +  T  I LHS+ + + R   +  + S ++++ +           I +     +  G  Y ++I    S + +N   G     Y     + +   ATQF+P +AR+ FPCFDEP FKA F + IT N  ++ LSNMP+ S   S+       +   F  S  M  Y +AF + +   + + D  G    ++A   +I + H AL+TT++    ++    I +PLKK+D +AIP+ +    ME++GL+T+ E  ++++        + L   II HE+AHQWFGNLVT   W DLWLNEGFATF  Y            +++E   IF  + +++D+       + K ++  + PI S V+S       FD L+Y KG  ++ ML+  L ++ F  A+  YL++  + ++  +DLW+S N+ +   + ++ ++  W  Q  +P++ V   Q K   L       F   +   +  D+   +W+IP+  +     ++     S L+  SD++ L        W+ +N N   ++   Y    +  L  QL +N  ++   +RA +I + ++L+    +  L     L  Y++ ET   PI  A+       NLL+KL G  ++ S          +++    K   N  +          +   LR  L  F C      C  +   + + W
Sbjct:  168 LPTAIIPLCYELSLHPNLTSMTF------RGSVTISLQALQDTRDIILHSTGHNISRVTFMSAVSSQEKQVEI---LEYPYHEQIAVVAPEPLLTGHNYTLKIEY--SANISNSYYGFYGITYTDKSNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKITRNEHHTALSNMPKKS---SVPAEEGLIQD-EFSESVKMSTYLVAFIVGEMRNLSQ-DVNGTLVSVYAVPEKIGQVHHALDTTIKLLEFYQTYFEIQYPLKKLDLVAIPDFEAG-AMENWGLLTFREETLLYDNATSSVADRKLVTKIIAHELAHQWFGNLVTMQWWNDLWLNEGFATFMEY------------FSVE--KIFKELNSYEDFLDARFKTMRKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGASLLLMLKSYLSEDVFRHAVILYLHNHSYAAIQSDDLWDSFNEVTDKTLDVKKMMKTWTLQKGFPLVTV---QRKGTELLLQQERFFLRMQPESQPSDTS-HLWHIPISYVTDGRNYSEYRSVSLLDKKSDVINLTE---QVQWVKVNSNMTGYYIVHYAHDDWTALINQLKRNPYVLSDKDRANLINNIFELA-GLGKVPLRMAFDLIDYLKNETHTAPITEALFQTNLIYNLLEKL-GHMDLSS----------RLVARVHKLLQNQIQQQTWTDEGTPSMRELRSALLEFACAHSLENCTTMATNLFDSW 846          
BLAST of Aminopeptidase vs. Ensembl Mouse
Match: Erap1 (endoplasmic reticulum aminopeptidase 1 [Source:MGI Symbol;Acc:MGI:1933403])

HSP 1 Score: 233.032 bits (593), Expect = 3.165e-63
Identity = 190/710 (26.76%), Postives = 323/710 (45.49%), Query Frame = 2
Query:  641 GIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKS-AIAAPIL--SFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDG---------------------------WLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYP-DWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYS--NRNFQSWDYINVKYYAMGCSKVPWIIEKNIDIAYNVLKNFSKRNDFPHVSEII 2671
            G     Y+T +G++  L ATQF+P +AR  FPCFDEP  KA+FS+ I  +  +  +SNMP +    S+ +     +   F+I+  M  Y +AF I DF  + K  + G K  ++A   +I +A +AL+  V     +E   NI +PL K D  AIP+ +    ME++GL TY E  ++++++   + SK+    I+ HE+AHQWFGNLVT   W DLWLNEGFA F  + ++  V + E+   +E    F    N  +  AL  S  ++ P+   + +   FD ++Y+KG  I++ML   L  + F   I  YL    + +    DLW S+    P      +DG                           W  Q  +P+I +++   ++++++Q   +          Y      +W++PL   F      S  +F  L+  +D+L L     +  W+  N+  N ++   Y    +  LS  L + H  I   +RA +I + + L    ++  + K L L LY++ ET+ +PIF A+N L  +  L E R     +       +           + ++  +S  +   LR  L    C   +  C    E     WK+++  ++    + V L  +       E W  LYS    +  S +   ++ +++  SK P  ++  +D ++       K  +FPH+  +I
Sbjct:  150 GFYKSTYRTQEGEMRILAATQFEPTAARMAFPCFDEPALKASFSIKIKRDPRHLAISNMPLVK---SVNVAEGLIED-HFDITVKMSTYLVAFIISDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFNIPYPLPKQDLAAIPDFQSG-AMENWGLTTYRESSLLYDKEKSSASSKLGITMIVSHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEF-VSVTVTHPEL--KVEDY-FFGKCFNAMEVDALNSSHPVSTPVENPAQIREMFDDVSYEKGACILNMLRDYLSADTFKRGIVQYLQKYSYKNTKNEDLWNSMMHICPTDGTQTMDGFCSRSQHSSSTSHWRQEVVDVKTMMNTWTLQKGFPLITITV-SGRNVHMKQEHYMKGSERFPETGY------LWHVPL--TFITSKSDSVQRF-LLKTKTDVLILPE---AVQWIKFNVGMNGYYIVHYADDGWASLSGLLKEAHTTISSNDRASLINNAFQLV-SIEKLSIEKALDLTLYLKNETEIMPIFQALNELIPMYKLMEKRDMIEVETQFKDFLLKLLKDLIDKQTWTDEGSVSERM---LRSQLLLLACVRNYQPCVQRAERYFREWKSSNGNMS--IPIDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEKSQIE-FSLCTSKDPEKLQWLLDQSFK--GEIIKTQEFPHILTLI 828          
BLAST of Aminopeptidase vs. UniProt/SwissProt
Match: sp|Q6Q4G3|AMPQ_HUMAN (Aminopeptidase Q OS=Homo sapiens OX=9606 GN=LVRN PE=1 SV=4)

HSP 1 Score: 279.256 bits (713), Expect = 6.282e-78
Identity = 205/677 (30.28%), Postives = 342/677 (50.52%), Query Frame = 2
Query:  665 TPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIY--KAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMAT----KVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSF----VESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWE----SLNKYS----PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIP-LYIMFGNETFASTPKFSKLEMYSDIL-QLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIF--TAVNLLDK-LNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGL--RRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENWRLL---YSNRNFQSWDYINVKYYAMGCSKVPWIIEKNIDIA 2611
            T QG+   LLA+Q +P  AR VFPCFDEP  KA F++T+  +  Y  LSNMP++       +N S W   +F  +P MP Y +AF I D+  + +T E+G++ RIWARK  I    A FALN T   F   E   NI + L K D +A+P+      ME++GL+ ++E  ++   K  L+  K L   ++ HE+ HQWFGNLVT   W ++WLNEGFA+++ +++      K+  +E+F++    +I + +   D   AL+  A+A  + +F    ++  FD   Y KG  +  ML   L ++ F  A+ +YL +  + +   +DLW     +++  S    P  I+N++D W  QS +P+I +    N S  + +      +  K+R     +    W +P L+I  G     +T     L+  S +  ++   +   DW++LNLN   ++  +Y+ + + +L+ QL K+ + IP I+R Q+I D + LSK     ++   L+L  Y+ AE D + ++    VNL+ + L     +   Y    +Y+ K LN  +  +    R +       Y  L     LF   C +    C  +++ +  +W ++      Y +  V LC  I + +  E W +L   Y+N   +  + I +  YAM CSK PWI+ + ++ A
Sbjct:  226 TDQGERRALLASQLEPTFARYVFPCFDEPALKATFNITMIHHPSYVALSNMPKLGQSEKEDVNGSKWTVTTFSTTPHMPTYLVAFVICDYDHVNRT-ERGKEIRIWARKDAIANGSADFALNITGPIFSFLEDLFNISYSLPKTDIIALPSFDNH-AMENWGLMIFDESGLLLEPKDQLTEKKTLISYVVSHEIGHQWFGNLVTMNWWNNIWLNEGFASYFEFEVINYFNPKLPRNEIFFS----NILHNILRED--HALVTRAVAMKVENFKTSEIQELFDIFTYSKGASMARMLSCFLNEHLFVSALKSYLKTFSYSNAEQDDLWRHFQMAIDDQSTVILPATIKNIMDSWTHQSGFPVITL----NVSTGVMKQEPFYLENIKNRTLLTSN--DTWIVPILWIKNG-----TTQPLVWLDQSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKKLNQQLEKDPKAIPVIHRLQLIDDAFSLSKN-NYIEIETALELTKYL-AEEDEIIVWHTVLVNLVTRDLVSEVNIYDIYSLLKRYLLKRLNLIWNIYSTIIRENVLALQDDYLALISLEKLFVTACWLGLEDCLQLSKELFAKWVDHPENEIPYPIKDVVLCYGIALGSDKE-WDILLNTYTNTTNKE-EKIQLA-YAMSCSKDPWILNRYMEYA 878          
BLAST of Aminopeptidase vs. UniProt/SwissProt
Match: sp|O57579|AMPN_CHICK (Aminopeptidase Ey OS=Gallus gallus OX=9031 GN=ANPEP PE=1 SV=2)

HSP 1 Score: 261.922 bits (668), Expect = 5.683e-72
Identity = 204/717 (28.45%), Postives = 347/717 (48.40%), Query Frame = 2
Query:  380 QGNLSIIALIINRTDMISLHSSE-NVLIRQIRVRNIFSVDQKM--NLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLAT-QFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAH--FALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKS--------AIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLW----ESLNKYS-PVP--IENVIDGWLTQSCYPIIYV-----SIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMY-SDILQLNT-FNV-SSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFN---------FGCKMKFSFCFVITEAIVERWKNN 2416
            +GN S++ L    TD+I +HS++ N  ++     ++ +V+      ++  +  T +  + + L   + +G+ Y   + +  +    +  +G    +Y   +G + +++AT Q Q   AR  FPCFDEP  KA F++T+    +++ +SNMP  S +  + ++   W    F+ +P M  Y LAF +  F +++    K  + RIW R + I +    +AL  T      FER  N  +PL K D + +P+      ME++GL+TY E  ++++  +    +K   V++I HE+AHQWFGNLVT   W DLWLNEGFA++  Y  A      E  + ++ L + N +       AL  S         I  P  + +   FD +AY KG  ++ ML   L ++ F   + +YL+   +++    DLW    E++NK S P+P  I  ++D W  Q  +P++ V     S+ Q+  L L  NS++      S   Y       W +P+  M        TP  +    +  D+   N+ F+V SS WLLLNLN + +F  +YN   +D+L  QL  NH+ IP INRAQII D ++L++  Q+  +   L    ++  ET  +P   A+N L     +F+    +    KYI+K +   F+         +R + + +T +   L +           C    + C  +  A+ ++W+ N
Sbjct:  108 KGNSSVVFLCEEATDLILIHSNKLNYTLQGGFHASLHAVNGSTPPTISNTWLETNTQYLVLQLAGPLQQGQHY--RLFSIFTGELADDLAGFYRSEYT--EGNVTKVVATTQMQAPDARKAFPCFDEPAMKAVFTVTMIHPSDHTAISNMPVHSTYQ-LQMDGQSWNVTQFDPTPRMSTYLLAFIVSQFDYVENNTGK-VQIRIWGRPAAIAEGQGEYALEKTGPILSFFERHYNTAYPLPKSDQVGLPDFNAG-AMENWGLVTYRENSLLYDNAYSSIGNKERVVTVIAHELAHQWFGNLVTLRWWNDLWLNEGFASYVEYLGADSA---EPTWDIKDLMVLNELYTVMATDALTTSHPLTFREDEINTP--AQISEVFDSIAYSKGASVLRMLSDFLTEDVFKEGLQSYLHDFSYNNTVYTDLWDHLQEAVNKNSVPLPDSIGAIMDRWTLQMGFPVVTVNTLTGSVQQSHFL-LDSNSTVE---RPSVFNY------TWIVPITWM--------TPSRTGDRYWLVDVSATNSDFSVGSSTWLLLNLNVSGYFRVNYNQENWDQLLQQLSNNHQAIPVINRAQIIDDAFNLARA-QQVSVTLALNTTRFLSGETAYMPWQAALNNLQYFQLMFDRSEVFGAMTKYIQKQVTPLFEY--------YRTATNNWTAIPSALMDQYNEINAISTACSYGIAECQQLATALYQQWRQN 785          
BLAST of Aminopeptidase vs. UniProt/SwissProt
Match: sp|Q07075|AMPE_HUMAN (Glutamyl aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=1 SV=3)

HSP 1 Score: 249.98 bits (637), Expect = 5.491e-68
Identity = 207/763 (27.13%), Postives = 345/763 (45.22%), Query Frame = 2
Query:  224 STAAMTTEPPRP-----PVIEIENSI---FYLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIR----------QIRVRNIFSVDQKMNLAKRFN--ITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQNKS-----LNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSD-WLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFE-MRSFYPDWNKYIEKILNSTFKRFLNDFR-NDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLL 2428
            S+ A  + PP       P  E E+     F LP+ V P+ Y L +K       L  +    G +SI   +   T  + LH  E  + R          Q++VR  F   ++  +       +T S+   +YL T               E   + N       R   T  G+++ ++AT  +P  AR  FPCFDEP  KA ++++IT  +EY  LSNMP ++   S+      W   +FE S  M  Y + FA+  F  +++    G+   I+ +  Q + A +A N T   F  FE    +++ L K+D +AIP+  G   ME++GLITY E  ++++ K   S ++    +++ HE+ HQWFGN+VT   W+DLWLNEGFA+F+ +        D        L     V+  D   +     +       + S FD ++Y KG  I+ MLE  ++  NF      YL   +F +   +D W +L + S +P++ V+D W  Q  YP++ V+  +N +     L+ R N S       S + Y       WNIP  + +  +   S+  F++ E   + + LN+ N S + +L +N +   F+  +Y    +D ++  L  NH+     +RA +I D + L++  Q  D    L L  Y++ E + +P    ++ +  +  +FE  +  YP     IE+      K   +    ND    + +   LR ++  F CKM          ++ E+W N ++ L
Sbjct:   62 SSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVK------PLLEEDTYTGTVSISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVEAEEELTPSSGDGLYLLT--------------MEFAGWLNGSLVGFYRTTYTENGQVKSIVATDHEPTDARKSFPCFDEPNKKATYTISITHPKEYGALSNMP-VAKEESV---DDKWTRTTFEKSVPMSTYLVCFAVHQFDSVKRISNSGKPLTIYVQPEQKHTAEYAANITKSVFDYFEEYFAMNYSLPKLDKIAIPDF-GTGAMENWGLITYRETNLLYDPKESASSNQQRVATVVAHELVHQWFGNIVTMDWWEDLWLNEGFASFFEFLGVNHAETDWQMRDQMLLEDVLPVQEDDSLMSSHPIIVTVTTPDEITSVFDGISYSKGSSILRMLEDWIKPENFQKGCQMYLEKYQFKNAKTSDFWAALEEASRLPVKEVMDTWTRQMGYPVLNVNGVKNITQKRFLLDPRANPS----QPPSDLGY------TWNIP--VKWTEDNITSSVLFNRSE--KEGITLNSSNPSGNAFLKINPDHIGFYRVNYEVATWDSIATALSLNHKTFSSADRASLIDDAFALARA-QLLDYKVALNLTKYLKREENFLPWQRVISAVTYIISMFEDDKELYP----MIEEYFQGQVKPIADSLGWND--AGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSL 778          
BLAST of Aminopeptidase vs. UniProt/SwissProt
Match: sp|P50123|AMPE_RAT (Glutamyl aminopeptidase OS=Rattus norvegicus OX=10116 GN=Enpep PE=1 SV=2)

HSP 1 Score: 249.21 bits (635), Expect = 8.425e-68
Identity = 203/740 (27.43%), Postives = 335/740 (45.27%), Query Frame = 2
Query:  287 FYLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYS----------YKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKIS-----IWNIPL-YIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLL-LNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFE-MRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTG-LRRTLFNFGCKMKFSFCFVITEAIVERW-KNNSLLLTDYDLL 2446
            F LP+ + P+ Y L +K       L  + R  G +SI   +   T  + LH  E  + +   +R      +++ + + F   +   + I    +++      +     E   + N       R   T  G+ + + AT  +P  AR  FPCFDEP  KA +++++   +EYS LSNMP            + WK  +F  S  M  Y + FA+  F+ IQ+T   G+   ++ + +Q   A +A N T   F  FE    +++ L K+D +AIP+  G   ME++GL+TY E  ++++     S ++    S++ HE+ HQWFGN+VT   W DLWLNEGFA+F+           ++M ++VL ++V    E  S+ +       +  ++  +  A I S     FD ++Y KG  I+ ML+  +    F      YL + KF +   +D W+SL K S  P++ V+D W +Q  YP++ VS  QN          +  K F    K D S+        WNIP+ +   GN       + ++     + + LN  N+S D  L +N +   F+  +Y    +D ++  L  NH      +R+  I D + L++  Q  D  K L L  Y+ +E D +P    ++ +  +  +FE  R  YP     IE    S  K   +     ++ + S  T  LR ++  F CKM           + E W K N  +  +  LL
Sbjct:   83 FRLPDFIQPVHYDLEVKV------LMEEDRYTGIVSISVNLSKDTRDLWLHIRETRITKLPELRR--PSGEQVPIRRCFEYKKQEYVVIQAEEDLAATSGDSVYRLTIEFEGWLNGSLVGFYRTTYTEDGQTKSIAATDHEPTDARKSFPCFDEPNKKATYNISLIHPKEYSALSNMP----VEKKETLDNDWKKTTFMKSVPMSTYLVCFAVHQFTSIQRTSRSGKPLTVYVQPNQKQTAEYAANITKAVFDFFEDYFAMEYSLPKLDKIAIPDF-GTGAMENWGLVTYRETNLLYDPLLSASSNQQRVASVVAHELVHQWFGNIVTMDWWDDLWLNEGFASFFEFLGVNHAEADWQMLSQVLLEDVLPVQEDDSLMS------SHPVVVTVSTPAEITSV----FDGISYSKGASILRMLQDWITPEKFQKGCQIYLENFKFKNAKTSDFWDSLEKASNQPVKEVMDTWTSQMGYPVVTVSGKQN----------VTQKRFLLDYKADPSQPPSALGYTWNIPIKWTENGNSNITVYYRSNR-----EGITLNA-NLSGDGFLKINPDHIGFYRVNYEAETWDWIAETLSSNHMNFSSADRSSFIDDAFALARA-QLLDYEKALNLTRYLTSEKDFLPWERVISAVSYIISMFEDDRELYP----LIETYFRSQVKPIADSL--GWQDTGSHITKLLRASVLGFACKMGAGEALGNASQLFEAWLKGNESIPVNLRLL 776          
BLAST of Aminopeptidase vs. UniProt/SwissProt
Match: sp|Q9UIQ6|LCAP_HUMAN (Leucyl-cystinyl aminopeptidase OS=Homo sapiens OX=9606 GN=LNPEP PE=1 SV=3)

HSP 1 Score: 245.358 bits (625), Expect = 3.865e-66
Identity = 201/729 (27.57%), Postives = 338/729 (46.36%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYF-----ALIKSAI--AAPILSFVESK------FDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYS--PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAV-------NLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYT--GLRRTLFNFGCKMKFSFCFVITEAIVERW 2407
            LP +V PL Y LS+  +   +        +G+++I    +  T  I LHS+ + + R   V  + +V  +   A+         I I     +  G  Y ++I    S + ++   G     Y     + +   ATQF+P +AR+ FPCFDEP FKA F + I  + +Y+ LSNMP+ S   S+ ++    +   F  S  M  Y +AF + +   + + D  G    I+A   +I + H+AL TTV+    F+    I +PLKK+D +AIP+ +    ME++GL+T+ E  ++++        + L   II HE+AHQWFGNLVT   W DLWLNEGFATF  Y            ++LE   IF  + +++D+       + K ++  + PI S V+S       FD L+Y KG  ++ ML+  L ++ F  A+  YL++  + S+  +DLW+S N+ +   + ++ ++  W  Q  +P++ V   Q K   L       F   K  I+  D+   +W+IPL  +     ++     S L+  S ++ L    +   W+ +N+N N ++   Y    ++ L  QL  N  ++   +RA +I + ++L+    +  L +   L  Y+  E    PI  A+       NLL+KL G  ++ S          +++   FK   N  +          +   LR  L  F C      C      + + W
Sbjct:  168 LPTAVVPLRYELSLHPNLTSMTF------RGSVTISVQALQVTWNIILHSTGHNISR---VTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEY--SANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKS---SVVLDDGLVQD-EFSESVKMSTYLVAFIVGEMKNLSQ-DVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAG-AMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEY------------FSLE--KIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTV---QKKGKELFIQQERFFLNMKPEIQPSDTSY-LWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVL---WVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELA-GLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKL-GYMDLAS----------RLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDW 846          
BLAST of Aminopeptidase vs. TrEMBL
Match: A0A5G2QQR1 (Aminopeptidase OS=Sus scrofa OX=9823 GN=LVRN PE=1 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 3.452e-83
Identity = 233/819 (28.45%), Postives = 388/819 (47.37%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDS-RAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITR------SNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYK--AHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMAT----KVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESK-----FDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWE----SLNKYS----PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFK--SRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDIL-QLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAV--NLLDKLNGLFEMRSF--------------YPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKY-YAMGCSKVPWIIEKNIDIA 2611
            LP  + PL Y L +       +L+    R  G ++I    +  T  + LHS   +      VR   S D K     R  +           + + L   +  G +Y ++++ F    + +   G+    Y T QGK   LLA+Q +P  AR VFPCFDEP  KA F++TI  +  Y  LSNMP++       +N S W   +F  +P MP Y  AFA+ D+ ++ +  E+G++ RIWARK  I    A FALN T   F   E   NI +PL K D +A+P       ME++GL+ ++E +++      L+  K +   I+CHE+ HQWFGNLVT   W ++WLNEGFA+++   +      K+  DE+F++    +I + V   D   AL+  A++  + +F E+      FD   Y KG  +  ML   L +  F  A+ +YL +  + +   +DLW     ++++ S    P  +++++D W  QS +PII +    N S  + +         K  S + ++D+    W +P+  M       +T     L+  S +  ++   +   DW++LNLN   ++  +Y+ + + RL+ QL K+ + IP I+R Q++ D + LSK     ++   L L  Y+ AE D + ++ AV  NL+ + + +FE ++                P WN Y   I+        +D+     L           +F   C +    C  +++ +   W N+      Y + +V LC  I + N  E W  L +  N  + +   ++  YA+GCSK PWI+ + ++ A
Sbjct:   99 LPPWLVPLHYELELWPLLRPDELSVPGLRFTGRVNITVRCMAATARLLLHSL-FLDCESAEVRGPLSPDTKDATVGRVPVDEVWFALDMQYMVLELGQALQPGSRYELQLS-FSGPVYQDTREGLFLNLY-TDQGKRRALLASQLEPTFARNVFPCFDEPALKATFNITIIHHPSYVALSNMPKLGQSEKEDVNGSKWTVTTFYTTPHMPTYLAAFAVCDYEYVSRI-ERGKEIRIWARKDAIAGGNADFALNITGPIFSFLEDLFNISYPLPKTDIIALPTFDN-RAMENWGLLMFDESLLLLQPNDKLTEKKTVISYIVCHEIGHQWFGNLVTMNWWNNIWLNEGFASYFEVGVINYFNPKLPRDEIFFS----NILHGVLRED--HALVSRAVSRKVENFTETNEINELFDQFTYNKGASMARMLSSFLNEKIFISALKSYLETFSYSNAEQDDLWRHFQMAVDEQSKILLPATVKSIMDSWTHQSGFPIITL----NASTGIMKQEPFYLGKVKNQSLLTHNDT----WIVPILWMKN----GTTQSLVWLDNSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKRLNQQLEKDPKAIPVIHRLQLVDDAFSLSKN-NYIEIETALDLTKYL-AEEDEIIVWHAVLLNLVTR-DLIFEGKNHDIYPLLKKYLLKRLIPIWNTY-STIIRENVAALQDDYLALISLEK---------VFGTACWLGLEDCLQLSKELFRNWMNHPENEIPYPIKNVILCYGIALGNDKE-WDFLLNIYNNTTKEEERIQLAYALGCSKEPWILNRYMEHA 880          
BLAST of Aminopeptidase vs. TrEMBL
Match: A0A480UYE2 (Aminopeptidase OS=Sus scrofa OX=9823 PE=3 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 8.654e-83
Identity = 233/819 (28.45%), Postives = 388/819 (47.37%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDS-RAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITR------SNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYK--AHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMAT----KVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESK-----FDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWE----SLNKYS----PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFK--SRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDIL-QLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAV--NLLDKLNGLFEMRSF--------------YPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKY-YAMGCSKVPWIIEKNIDIA 2611
            LP  + PL Y L +       +L+    R  G ++I    +  T  + LHS   +      VR   S D K     R  +           + + L   +  G +Y ++++ F    + +   G+    Y T QGK   LLA+Q +P  AR VFPCFDEP  KA F++TI  +  Y  LSNMP++       +N S W   +F  +P MP Y  AFA+ D+ ++ +  E+G++ RIWARK  I    A FALN T   F   E   NI +PL K D +A+P       ME++GL+ ++E +++      L+  K +   I+CHE+ HQWFGNLVT   W ++WLNEGFA+++   +      K+  DE+F++    +I + V   D   AL+  A++  + +F E+      FD   Y KG  +  ML   L +  F  A+ +YL +  + +   +DLW     ++++ S    P  +++++D W  QS +PII +    N S  + +         K  S + ++D+    W +P+  M       +T     L+  S +  ++   +   DW++LNLN   ++  +Y+ + + RL+ QL K+ + IP I+R Q++ D + LSK     ++   L L  Y+ AE D + ++ AV  NL+ + + +FE ++                P WN Y   I+        +D+     L           +F   C +    C  +++ +   W N+      Y + +V LC  I + N  E W  L +  N  + +   ++  YA+GCSK PWI+ + ++ A
Sbjct:   99 LPPWLVPLHYELELWPLLRPDELSVPGLRFTGRVNITVRCMAATARLLLHSL-FLDCESAEVRGPLSPDTKDATVGRVPVDEVWFALDMQYMVLELGQALQPGSRYELQLS-FSGPVYQDTREGLFLNLY-TDQGKRRALLASQLEPTFARNVFPCFDEPALKATFNITIIHHPSYVALSNMPKLGQSEKEDVNGSKWTVTTFYTTPHMPTYLAAFAVCDYEYVSRI-ERGKEIRIWARKDAIAGGNADFALNITGPIFSFLEDLFNISYPLPKTDIIALPTFDN-RAMENWGLLMFDESLLLLQPNDKLTEKKTVISYIVCHEIGHQWFGNLVTMNWWNNIWLNEGFASYFEVGVINYFNPKLPRDEIFFS----NILHGVLRED--HALVSRAVSRKVENFTETNEINELFDQFTYNKGASMARMLSSFLNEKIFISALKSYLETFSYSNAEQDDLWRHFQMAVDEQSKILLPATVKSIMDSWTHQSGFPIITL----NASTGIMKQEPFYLGKVKNQSLLTHNDT----WIVPILWMKN----GTTQSLVWLDNSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKRLNQQLEKDPKAIPVIHRLQLVDDAFSLSKN-NYIEIETALDLTKYL-AEEDEIIVWHAVLLNLVTR-DLIFEGKNHDIYPLLKKYLLKRLIPIWNTY-STIIRENVAALQDDYLALISLEK---------VFGTACWLGLEDCLQLSKELFRNWMNHPENEIPYPIKNVILCYGIALGNDKE-WDFLLNIYNNTTKEEERIQLAYALGCSKEPWILNRYMEHA 880          
BLAST of Aminopeptidase vs. TrEMBL
Match: F1RLE3 (Aminopeptidase OS=Sus scrofa OX=9823 GN=LVRN PE=1 SV=2)

HSP 1 Score: 299.671 bits (766), Expect = 1.044e-82
Identity = 233/819 (28.45%), Postives = 388/819 (47.37%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDS-RAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITR------SNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYK--AHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMAT----KVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESK-----FDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWE----SLNKYS----PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFK--SRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDIL-QLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAV--NLLDKLNGLFEMRSF--------------YPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKY-YAMGCSKVPWIIEKNIDIA 2611
            LP  + PL Y L +       +L+    R  G ++I    +  T  + LHS   +      VR   S D K     R  +           + + L   +  G +Y ++++ F    + +   G+    Y T QGK   LLA+Q +P  AR VFPCFDEP  KA F++TI  +  Y  LSNMP++       +N S W   +F  +P MP Y  AFA+ D+ ++ +  E+G++ RIWARK  I    A FALN T   F   E   NI +PL K D +A+P       ME++GL+ ++E +++      L+  K +   I+CHE+ HQWFGNLVT   W ++WLNEGFA+++   +      K+  DE+F++    +I + V   D   AL+  A++  + +F E+      FD   Y KG  +  ML   L +  F  A+ +YL +  + +   +DLW     ++++ S    P  +++++D W  QS +PII +    N S  + +         K  S + ++D+    W +P+  M       +T     L+  S +  ++   +   DW++LNLN   ++  +Y+ + + RL+ QL K+ + IP I+R Q++ D + LSK     ++   L L  Y+ AE D + ++ AV  NL+ + + +FE ++                P WN Y   I+        +D+     L           +F   C +    C  +++ +   W N+      Y + +V LC  I + N  E W  L +  N  + +   ++  YA+GCSK PWI+ + ++ A
Sbjct:   99 LPPWLVPLHYELELWPLLRPDELSVPGLRFTGRVNITVRCMAATARLLLHSL-FLDCESAEVRGPLSPDTKDATVGRVPVDEVWFALDMQYMVLELGQALQPGSRYELQLS-FSGPVYQDTREGLFLNLY-TDQGKRRALLASQLEPTFARNVFPCFDEPALKATFNITIIHHPSYVALSNMPKLGQSEKEDVNGSKWTVTTFYTTPHMPTYLAAFAVCDYEYVSRI-ERGKEIRIWARKDAIAGGNADFALNITGPIFSFLEDLFNISYPLPKTDIIALPTFDN-RAMENWGLLMFDESLLLLQPNDKLTEKKTVISYIVCHEIGHQWFGNLVTMNWWNNIWLNEGFASYFEVGVINYFNPKLPRDEIFFS----NILHGVLRED--HALVSRAVSRKVENFTETNEINELFDQFTYNKGASMARMLSSFLNEKIFISALKSYLETFSYSNAEQDDLWRHFQMAVDEQSKILLPATVKSIMDSWTHQSGFPIITL----NASTGIMKQEPFYLGKVKNQSLLTHNDT----WIVPILWMKN----GTTQSLVWLDNSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKRLNQQLEKDPKAIPVIHRLQLVDDAFSLSKN-NYIEIETALDLTKYL-AEEDEIIVWHAVLLNLVTR-DLIFEGKNHDIYPLLKKYLLKRLIPIWNTY-STIIRENVAALQDDYLALISLEK---------VFGTACWLGLEDCLQLSKELFRNWMNHPENEIPYPIKNVILCYGIALGNDKE-WDFLLNIYNNTTKEEERIQLAYALGCSKEPWILNRYMEHA 880          
BLAST of Aminopeptidase vs. TrEMBL
Match: A0A4X1U4I5 (Aminopeptidase OS=Sus scrofa OX=9823 GN=LVRN PE=3 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.113e-82
Identity = 232/818 (28.36%), Postives = 387/818 (47.31%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDS-RAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITR------SNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYK--AHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMAT----KVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESK-----FDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWE----SLNKYS----PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFK--SRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDIL-QLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAV--NLLDKLNGLFEMRSF--------------YPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKYYAMGCSKVPWIIEKNIDIA 2611
            LP  + PL Y L +       +L+    R  G ++I    +  T  + LHS   +      VR   S D K     R  +           + + L   +  G +Y ++++ F    + +   G+    Y T QGK   LLA+Q +P  AR VFPCFDEP  KA F++TI  +  Y  LSNMP++       +N S W   +F  +P MP Y  AFA+ D+ ++ +  E+G++ RIWARK  I    A FALN T   F   E   NI +PL K D +A+P       ME++GL+ ++E +++      L+  K +   I+CHE+ HQWFGNLVT   W ++WLNEGFA+++   +      K+  DE+F++    +I + V   D   AL+  A++  + +F E+      FD   Y KG  +  ML   L +  F  A+ +YL +  + +   +DLW     ++++ S    P  +++++D W  QS +PII +    N S  + +         K  S + ++D+    W +P+  M       +T     L+  S +  ++   +   DW++LNLN   ++  +Y+ + + RL+ QL K+ + IP I+R Q++ D + LSK     ++   L L  Y+ AE D + ++ AV  NL+ + + +FE ++                P WN Y   I+        +D+     L           +F   C +    C  +++ +   W N+      Y + +V LC  I + N   ++ L   N   +  + I +  YA+GCSK PWI+ + ++ A
Sbjct:   99 LPPWLVPLHYELELWPLLRPDELSVPGLRFTGRVNITVRCMAATARLLLHSL-FLDCESAEVRGPLSPDTKDATVGRVPVDEVWFALDMQYMVLELGQALQPGSRYELQLS-FSGPVYQDTREGLFLNLY-TDQGKRRALLASQLEPTFARNVFPCFDEPALKATFNITIIHHPSYVALSNMPKLGQSEKEDVNGSKWTVTTFYTTPHMPTYLAAFAVCDYEYVSRI-ERGKEIRIWARKDAIAGGNADFALNITGPIFSFLEDLFNISYPLPKTDIIALPTFDN-RAMENWGLLMFDESLLLLQPNDKLTEKKTVISYIVCHEIGHQWFGNLVTMNWWNNIWLNEGFASYFEVGVINYFNPKLPRDEIFFS----NILHGVLRED--HALVSRAVSRKVENFTETNEINELFDQFTYNKGASMARMLSSFLNEKIFISALKSYLETFSYSNAEQDDLWRHFQMAVDEQSKILLPATVKSIMDSWTHQSGFPIITL----NASTGIMKQEPFYLGKVKNQSLLTHNDT----WIVPILWMKN----GTTQSLVWLDNSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKRLNQQLEKDPKAIPVIHRLQLVDDAFSLSKN-NYIEIETALDLTKYL-AEEDEIIVWHAVLLNLVTR-DLIFEGKNHDIYPLLKKYLLKRLIPIWNTY-STIIRENVAALQDDYLALISLEK---------VFGTACWLGLEDCLQLSKELFRNWMNHPENEIPYPIKNVILCYGIALGNDKWDFLLNIYNNTTKEEERIQLA-YALGCSKEPWILNRYMEHA 879          
BLAST of Aminopeptidase vs. TrEMBL
Match: A0A340WWQ9 (Aminopeptidase OS=Lipotes vexillifer OX=118797 GN=LOC103088265 PE=3 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 5.275e-82
Identity = 232/809 (28.68%), Postives = 386/809 (47.71%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDS-RAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITR------SNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYK--AHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMAT----KVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESK-----FDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWE----SLNKYS----PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSR--IKYDDSKISIWNIP-LYIMFGNETFASTPKFSKLEMYSDIL-QLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTA--VNLLDK-LNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGL--RRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKY-YAMGCSKVPWIIEKNIDIA 2611
            LP  + PL Y L +       +L+  + R  G ++I    I  T  + LHS   +      VR   S D       R  +           + + L   +  G +Y ++++ F    + +   G+    Y T QG+   LLA+Q +P  AR VFPCFDEP  KA F++T+  +  Y  LSNMP++       +N S W   +F  +P MP Y  AFAI D+  + +T E+G++ RIWARK  I    A FALN T   F   E   NI +PL K D +A+P       ME++GL+ ++E +++      L+  K +   I+ HE+ HQWFGNLVT   W ++WLNEGFA+++ + +      K+  +E+F++    +I + V   D   AL+  A++  + +F E+      FD   Y KG  +  ML   L +  F  A+ +YL +  + +   +DLW     +++  S    P  +++++D W  QS +P+I +    N S  + +         K++  + ++D+    W +P L+I  G     +T     L+  S +  ++   +   DW++LNLN   ++  +Y+   + +L+ QL K+ + IP I+R Q++ D + LSK     ++   L L  Y+ AE D + ++ A  VNL+ + L         YP    Y+ K L S +  +    R +       Y  L     LF   C +    C  ++  +   W N+      Y + +V LC  I + N  E W  L +  N ++ +   ++  YAM CSK PWI+ + ++ A
Sbjct:   98 LPPWLVPLHYELELWPRLKPEELSRPALRFTGRVNITVRCIAATARLLLHSL-FLDCESAEVRGPLSPDAGDATVGRVPVDEVWFALDMQYMVLELGEALQPGSRYELQLS-FSGPVYQDTREGLFLNLY-TDQGERRALLASQMEPTFARNVFPCFDEPALKATFNITVIHHPSYVALSNMPKLGQSEKEDVNGSKWTVTTFHTTPHMPTYLAAFAICDYEHVSRT-ERGKEIRIWARKEAIAAGNADFALNITGPIFSFLEDLFNISYPLPKTDIIALPTFDN-RAMENWGLLMFDESLLLLQPNDKLTEKKTVISYIVSHEIGHQWFGNLVTMNWWNNIWLNEGFASYFEFGVINYFNPKLPRNEIFFS----NILHGVLRED--HALVSRAVSMKVENFTETNEINELFDLFTYNKGASLARMLSSFLNEKIFISALKSYLETFSYSNAEQDDLWRHFQMAIDDQSKILLPATVKSIMDSWTHQSGFPVITL----NVSTGVMKQEPFYLGKVKNQTLLTHNDT----WIVPILWIKNG-----TTQSLVWLDKSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKFGWKKLNQQLEKDPKAIPVIHRLQLVDDAFSLSKN-SYIEIETALDLTKYL-AEEDEIIVWHAVLVNLVTRDLVSDVNNHDIYPLLKNYLLKRLISIWNTYSTIIRENVATLQDDYLALISLEKLFGTACWLGLEDCLQLSRDLFRNWMNHPENEIPYPIKNVILCYGIALGNDKE-WDFLLNIYNNKTKEEERIQLAYAMSCSKDPWILNRYMEYA 879          
BLAST of Aminopeptidase vs. Ensembl Cavefish
Match: erap1b (endoplasmic reticulum aminopeptidase 1 [Source:NCBI gene;Acc:103033452])

HSP 1 Score: 252.292 bits (643), Expect = 1.011e-69
Identity = 201/731 (27.50%), Postives = 334/731 (45.69%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYF------ALIKSAIAA--PILSFVESK------FDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESL----NKYSPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKIS--IWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNK---YIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNN 2416
            LP SV PL Y L +  +   L         G++ I   +   T+ I LHS +  + + + + +     Q + + +        +  +   T + KG +Y+ +++ FE+   +    G     Y+T +G+   L +TQF+  SAR  FPCFDEP FKANF+++I     +  +SNMP++     +G          F+ +  M  Y +AF + DF  I K  + G K  ++A   +I +A FAL+  V     ++   +I +PL K D  AIP+ +    ME++GL TY E  + ++     +  K+    II HE+AHQWFGNLVT   W DLWLNEGFA F  + ++  + N E+                +DYF      A+    +++  P+ + VE+       FD ++Y KG  I+ ML + L    F   I  YL    + +     LWESL    +    + +  +++ W  Q  +P+I V + + + + L Q   +  +        D S+ S  +W++PL  +  N   A+  +F  L+  +D+L L       DW+  N++ + ++   Y G  +D L   L  NH  +   +RA +I + + L     + +L K L L LY+  ET  VP+   ++ L  L  L E R      N+   YI  +      R    + +D  +S  +   LR  L  F C      C      + ++WK +
Sbjct:   85 LPESVSPLHYDLLIHPNLTSLDFT------GSVKIQVKVHEETNTIVLHSKDLSISKAVLLSSGEGQGQTLRVLEY--PAYHQIALVSDGTVLKKGGEYVFQLD-FEAK-LSENFHGFYKSTYRTSEGEERVLASTQFEATSARAAFPCFDEPAFKANFTISIRRESRHISISNMPKLRTLPVVG----GLLEDQFDTTVKMSTYLVAFIVCDFLSISKNTQHGVKISVYAVPEKIDQAQFALDAAVRLLDFYDDYFDIPYPLPKQDLAAIPDFQSG-AMENWGLTTYRETALFFDPHKSSASDKLGITMIIAHELAHQWFGNLVTMQWWNDLWLNEGFAKFMEF-VSVNITNPEL--------------EVEDYFMGKCFEAMEVDCLSSSHPVSTPVENPAQIQEMFDDVSYDKGACILHMLREFLTPEEFKSGIVRYLKKYSYQNTVNTHLWESLTTEQHAEEELDVRAMMETWTLQEGFPLITVEV-KGREVRLSQERYLKGE--------DPSQTSGFLWHVPLTYVDSNS--ATVHRF-LLKTKTDVLYLPE---EVDWIKFNVDMSGYYIVHYEGSGWDDLITLLKHNHTALSSNDRASLINNVFQLV-SVGKLELDKALDLSLYLSRETKSVPVTQGLSELVPLYKLMEKRDMETLENQMKSYIVHLFRELIDR--QTWTDDGSVSERM---LRSYLLLFACVRGHPPCISTATQLFKKWKES 764          
BLAST of Aminopeptidase vs. Ensembl Cavefish
Match: erap1a (endoplasmic reticulum aminopeptidase 1a [Source:ZFIN;Acc:ZDB-GENE-091113-7])

HSP 1 Score: 243.817 bits (621), Expect = 3.771e-67
Identity = 215/812 (26.48%), Postives = 366/812 (45.07%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQI----RVRNIFSVDQKMNLAKRFNITRSN--------VIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYF------ALIKSAIAA--PILSFVE------SKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESL-NKY---SPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPL-YIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLN--DFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWK--NNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSW--DYINVKYYAMGCSKVP----WIIEKNID 2605
            LP+SV PL Y L +  +   L  +      G + I   ++  T  I LHS    + R +    R +++  V Q+    ++  ++  N        VIR+  + N+S            ES H      G     Y+T  G++  L +TQF+   AR+ FPCFDEP FKANFS+ +     +  +SNMP +      G          ++++  M  Y +AF + DF  I +  + G +  ++    +I +A +ALNT V     ++   NI +PL K D  AIP+ +    ME++GL TY E  ++++ +   +  K+    +I HE+AHQWFGNLVT   W DLWLNEGFA F  + ++  +   E+                DDYF      A+   ++++  PI + VE        FD ++Y+KG  +++ML   L    F + I  YL    + +   +DLW SL NK+     + +  ++D W  Q  +P+I V + + + + L+Q   +      +   +      +W +PL YI  G+   +S  +F  L+   D+L L       +W+  N++   ++   Y    +D L  QL  NH +    +RA +I + + L     +  L   L L  Y+ +E++ +P+    + L  L  L E R      N+ ++  L + F+R ++   + +D  +S  +   LR  L  F C  +   C    + +  +WK  + +L L       V L  Y +     E W  L        +  +   +K  A+  S +P    W++EK ++
Sbjct:   26 LPDSVKPLHYDLLIHPNLTSLSFS------GAVQIQLDVLQETRHIFLHSKSLEISRALLLGSRYQHLLQV-QESEAFEQIALSYENFTFSTGLYVIRLEFSANLS------------ESFH------GFYKGTYRTSSGEVRTLASTQFEATHARSAFPCFDEPAFKANFSIRVRREPRHISISNMPNLKTVELAG----GLLEDQYDVTVKMSTYLVAFIVCDFLSISRRSQHGVEISVYTVPEKISQAEYALNTAVTLLDFYDDYFNIPYPLPKQDLAAIPDFQSG-AMENWGLTTYRESGLLFDPERSSTSDKLGITKVIAHELAHQWFGNLVTMQWWNDLWLNEGFAKFMEF-VSVNLTYPEL--------------QVDDYFLEKCFTAMGVDSLSSSHPISTPVENPAQIREMFDDVSYQKGACVLNMLRDFLTPEVFKIGIIRYLKKHSYQNTVNSDLWYSLTNKWFMEDDLDVREIMDTWTLQEGFPLITVEV-KGREVRLKQERFLKGAESANHPNF------LWKVPLTYITSGS---SSVQRF-LLKTRHDVLYL---PAEVEWVKFNVDMRGYYIVHYAAGGWDALIRQLQLNHTVFSGNDRASLIHNIFQLV-SIGKVPLDLALSLSQYLSSESEIMPVTQGFSELVPLYKLMEKRDMAALENQ-LKGYLVNVFRRLIDAQSWSDDGSVSERM---LRNYLLLFACVRRLPACVGPAQRLFRQWKESDGALRLA----ADVRLVVYTEGARTEEGWDFLLEKHGSTMYPSERSQIK-AALSYSPLPHKLEWLMEKGLE 768          
BLAST of Aminopeptidase vs. Ensembl Cavefish
Match: lnpep (leucyl and cystinyl aminopeptidase [Source:NCBI gene;Acc:103042675])

HSP 1 Score: 244.973 bits (624), Expect = 5.269e-67
Identity = 213/793 (26.86%), Postives = 358/793 (45.15%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIR---QIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPN-LKGFLGMEHYGLITYEEP-VIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFAL--IKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYS--PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTG-------LRRTLFNFGCKMKFSFCFVITEAIVERW-KNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKYYAMGCS-----KVPWIIEKNID 2605
            LP SV P++Y LS+  +   +        QGN++I  +++  +  I LHSS+  +++   Q +   I        +A +F            +  + KG++Y++ I    + + +N   G  +  Y    G    L ATQF+P +AR  FPCFDEP FKA+F + I    EY  LSNMP+     +  +    ++   FE S  M  Y +AF + +F      +       ++A   +  + H+AL    +    +     I++PL+K+D + IP+ L G   ME++GLIT+ E  +++ N   P+   K L  S+I HE+AHQWFGNLVT   W DLWLNEGFAT+  Y    KV   E+    E LS+       D   +   + S +  P    VE  FD ++Y+KG  I+ ML   L +  F   +  YL + +  +    DLW SL++ S   + +  +++ W  Q  +P++ V+    K + L Q   +      +    D S   +W+IPL   + N+T +++    ++ ++ +         S  WL  N   + F+  DY    +  L+  L  N  ++P  +RA +I + + LS +  +    ++L LF Y++ ET+  P+  A+  L+ +  L + RS         E +L S   +++ D   D   S S           LR  L    C++    C    +++ + W  +        DLL V L    Q +     W+ L+       +D    K      S     K+ WI+   ++
Sbjct:  169 LPTSVRPVQYELSLFPNLTTMTF------QGNVTITLVVLQESKKIVLHSSDMKILKANFQGKEVPILEYKPWQQIAIKF------------SEEIKKGQEYVLNI--VYTANLSNSYDGFYNSSYSDTAGVRRVLAATQFEPLAARKAFPCFDEPAFKASFLIKIKREAEYISLSNMPKAK---TTPLPGGLFED-EFEKSVNMSTYLVAFIVANF-VSANANVSNTLVSVYAVPDKKDQVHYALEAATKLLHFYNTFFEIEYPLRKLDLVGIPDFLAG--AMENWGLITFRETTLLVGNHSSPID--KQLVTSVIAHELAHQWFGNLVTMRWWNDLWLNEGFATYMQYMSIEKVF-PELDIDNEFLSVRFRAMAKDSLNSSHPVSSKVTTP--EEVEEMFDSVSYEKGASILLMLNATLSEEAFRKGVIEYLTNYRGGNTENEDLWSSLSQVSKQSINVSQMMNTWTVQKGFPLVTVN-RAGKQVKLTQEHFL----LNAENATDHSH--LWHIPL--TYVNDTCSTSSGCKQVFLFKNKTATLEVPDSVKWLKFNYKSDGFYIVDYGMEGWMNLTEALKTNVNVLPHEDRASLINNLFSLS-RLGKVSFRQVLNLFEYLKNETETAPLTEALAQLNHIFRLLDKRS---------ELLLVSRMTKYILDHFRDLMDSQSWEEETSVSKQVLRSALLETACRLNRPNCTTQAKSVYDEWIASKKTKHIPGDLLRVVLSVAAQTE---VGWKELFDTYKHSIYDSEKRKTLEALASTQDVRKIVWILNAGLE 907          
BLAST of Aminopeptidase vs. Ensembl Cavefish
Match: lnpep (leucyl and cystinyl aminopeptidase [Source:NCBI gene;Acc:103042675])

HSP 1 Score: 244.973 bits (624), Expect = 6.010e-67
Identity = 213/793 (26.86%), Postives = 358/793 (45.15%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIR---QIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPN-LKGFLGMEHYGLITYEEP-VIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFAL--IKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYS--PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTG-------LRRTLFNFGCKMKFSFCFVITEAIVERW-KNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKYYAMGCS-----KVPWIIEKNID 2605
            LP SV P++Y LS+  +   +        QGN++I  +++  +  I LHSS+  +++   Q +   I        +A +F            +  + KG++Y++ I    + + +N   G  +  Y    G    L ATQF+P +AR  FPCFDEP FKA+F + I    EY  LSNMP+     +  +    ++   FE S  M  Y +AF + +F      +       ++A   +  + H+AL    +    +     I++PL+K+D + IP+ L G   ME++GLIT+ E  +++ N   P+   K L  S+I HE+AHQWFGNLVT   W DLWLNEGFAT+  Y    KV   E+    E LS+       D   +   + S +  P    VE  FD ++Y+KG  I+ ML   L +  F   +  YL + +  +    DLW SL++ S   + +  +++ W  Q  +P++ V+    K + L Q   +      +    D S   +W+IPL   + N+T +++    ++ ++ +         S  WL  N   + F+  DY    +  L+  L  N  ++P  +RA +I + + LS +  +    ++L LF Y++ ET+  P+  A+  L+ +  L + RS         E +L S   +++ D   D   S S           LR  L    C++    C    +++ + W  +        DLL V L    Q +     W+ L+       +D    K      S     K+ WI+   ++
Sbjct:  178 LPTSVRPVQYELSLFPNLTTMTF------QGNVTITLVVLQESKKIVLHSSDMKILKANFQGKEVPILEYKPWQQIAIKF------------SEEIKKGQEYVLNI--VYTANLSNSYDGFYNSSYSDTAGVRRVLAATQFEPLAARKAFPCFDEPAFKASFLIKIKREAEYISLSNMPKAK---TTPLPGGLFED-EFEKSVNMSTYLVAFIVANF-VSANANVSNTLVSVYAVPDKKDQVHYALEAATKLLHFYNTFFEIEYPLRKLDLVGIPDFLAG--AMENWGLITFRETTLLVGNHSSPID--KQLVTSVIAHELAHQWFGNLVTMRWWNDLWLNEGFATYMQYMSIEKVF-PELDIDNEFLSVRFRAMAKDSLNSSHPVSSKVTTP--EEVEEMFDSVSYEKGASILLMLNATLSEEAFRKGVIEYLTNYRGGNTENEDLWSSLSQVSKQSINVSQMMNTWTVQKGFPLVTVN-RAGKQVKLTQEHFL----LNAENATDHSH--LWHIPL--TYVNDTCSTSSGCKQVFLFKNKTATLEVPDSVKWLKFNYKSDGFYIVDYGMEGWMNLTEALKTNVNVLPHEDRASLINNLFSLS-RLGKVSFRQVLNLFEYLKNETETAPLTEALAQLNHIFRLLDKRS---------ELLLVSRMTKYILDHFRDLMDSQSWEEETSVSKQVLRSALLETACRLNRPNCTTQAKSVYDEWIASKKTKHIPGDLLRVVLSVAAQTE---VGWKELFDTYKHSIYDSEKRKTLEALASTQDVRKIVWILNAGLE 916          
BLAST of Aminopeptidase vs. Ensembl Cavefish
Match: anpepa (aminopeptidase N-like [Source:NCBI gene;Acc:103035985])

HSP 1 Score: 240.736 bits (613), Expect = 7.456e-66
Identity = 206/802 (25.69%), Postives = 373/802 (46.51%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRA---QGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRF--NITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQ----LLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAH--FALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIK----SAIAAPILSFVE--SKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYV-----SIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLN------TFNVS-SDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRR-TLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKY-YAMGCSKVPWIIEKNID 2605
            LP+++ P  Y + ++  F  +  N+  ++   +GN ++    +  T  I LH+ + + +  ++V +  SV +K    +R+  +I ++N   I L   ++    Y      FE     +     +SR  + P  + +     L+A+Q QP  AR VFPCFDEP  KA FS+TI    E    SN P    ++ I  +   W    FE +P+M  Y LAF +  F+  ++   + ++ RIWA+   I   H  ++L  T +    +E    + +PL+K+D +AIP+  G   ME++GLI Y E  +++ E    + +K    ++I HE+AHQWFGNLVT   W +LWL+EGFAT+ SY    KV   E  + +  L +   V+   +  +L      S+  A I +  E    FD ++Y KG  ++ ML   + +  F   +  YL ++++ S    DLW+ + + S   +E+++ GW  Q  YP+I +      I+Q + L L Q      +               W +P+        F  +P F K+E   ++L+         +++   +WLL N+NC  ++  +Y+   + +L  Q+  +H  IP I+R Q+I D ++L++    N +   L    Y+  ET+ +P  +A+N L     +F+    Y    KY+ K +   +  F  ++ ++  +         +    +  C      C  +   + + W+N +  +   +L     C  I   +  ++W   ++     S      K  YA+ C+K  W++ + ++
Sbjct:   64 LPDNLIPERYEVFLQPYFYTVLENNTVQSHVFKGNSTVTFKCVKDTRSIFLHALQ-LSVSNVKVTD--SVTRKNIEVERYEVHINKTNFFEIQLKEVLNGNGSYYELFTEFEGELLDDLAGLYMSRYTENPVNEDDDQKRFLMASQMQPTDARKVFPCFDEPALKAVFSITIIHRPETKARSNTPGEGKYTDI--DGEQWIVTKFEPTPIMSTYLLAFTVNQFT-DKEVKLENKEIRIWAKPEAINAGHASYSLQITKDILAFYEELFGLKYPLRKLDQIAIPDF-GAGAMENWGLIMYRETALLYEEGVSSTSNKEWIATVIAHELAHQWFGNLVTMKWWNNLWLSEGFATYISYLGVNKV---EPTWDILDLIVLKEVQPAMEVDSLNSSHPLSSTEAEIQTTAEISDLFDSISYSKGAAVLRMLCAHIGETAFFEGLKLYLKNNQYQSTDTTDLWKYMKEVSTEDVESIMYGWTEQVGYPVISINTSTGEIWQEQFL-LNQTGDYGLE---------------WQVPI-------RFMKSPLF-KVE--KEVLREKGPVARPAYDLKPGEWLLANINCTGYYRVNYDEENWYKLIDQMETDHHDIPLISRGQLIDDAFNLARAKYVN-VTLALSTTKYLINETEYIPWESALNNLQYFILMFDRSEVYGPMQKYLRKQVGPLYDYF-QEYTDNATVPEKHSEQFNQINAISVACSNDVQECTEMATKLFKDWRNGTNRIPP-NLKSTIYCSAIASGD-EDDWDFAWNQYEKASIATEKDKLRYALSCTKKMWLLNRYLE 825          
BLAST of Aminopeptidase vs. Ensembl Sea Lamprey
Match: ANPEP (alanyl aminopeptidase, membrane [Source:HGNC Symbol;Acc:HGNC:500])

HSP 1 Score: 277.33 bits (708), Expect = 4.761e-79
Identity = 242/856 (28.27%), Postives = 396/856 (46.26%), Query Frame = 2
Query:  179 ITHDPIQNKCCKCNKSTAAMTTEPPRPPVIEIENSIFYLPNSVWPLEYRLSMKFDFNQLKLNSDSRA--QGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLA-KRFNITRSNVIRIYLT-TNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYK--AHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKS-AIAAP---ILSFVE--SKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYS-------PVPIENVIDGWLTQSCYPIIYVSIYQNKSLN----LRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKF--SKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERW-KNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVK---YYAMGCSKVPWIIEKNIDIAYNVLKNFSKRNDFPHV 2659
            ++ DP      K   +  + TT PP PP    E   + LP SV P  Y + +K    +L    D      G ++I  +   +TD+I +HS++   +      NI    Q   +A   +  T++  + + LT   + K  +Y++    F      +  +G+   +Y T   + + +  +Q +P  AR  FPCFDEP  KA F +T+    E+  LSNMP +   ++  I    W    F  S +MP Y LAF I DF  ++    K    RIWA+K++I    A +ALN T +    FE   ++ + L K D +AIP+      ME++GL+TY E  +++N     + +K    +I+ HE+AHQWFGNLVT   W +LWLNEGFA++  Y    +V   E  + ++ L I N ++      AL  S  ++ P   +++  +  S FD ++Y KG  I+SM    L +  F   + +YL   +F +    DLW  L           PV +++++D W  Q  YP+++V+    K       L  NS++   T  S   Y      +W IP  I +   T  S  K+   + E++SD++        + W++LN+    ++   Y+   F  L  QL  NH  IP  NRAQ+I D + L+    +  + K L+  +Y+E E + VP  TA+N L  +N +F    +Y    KY+ K + + ++   N     F  S  +   ++    N  C      C      I ++W +N S  +   +L  V  CQ +   +  E W   +  + FQ   +   K     A+ CS  PWI+ + ++ A +    F ++ D   V
Sbjct:   47 VSSDP--KTTSKPLTTKPSTTTAPPYPPGPWNE---YRLPRSVIPTHYEVELK---PELYKQPDGLYIFSGQVNITMICKEQTDVILIHSNK---LNYSDNDNISLSGQNGPMAVNTWLATKTEYLVVQLTGAKLEKDMEYVLHAK-FRGE-LADDLAGLYRSEY-TENNETKIMATSQMEPTDARKTFPCFDEPDMKATFDITLIHKAEHVALSNMPVVYMSTATSIEED-WVHTKFNTSVVMPTYLLAFIISDFEKVEAVANKTL-IRIWAKKTEIAAGNAEYALNITGKILNFFEEYYDVPYVLPKSDQIAIPDFAAG-AMENWGLVTYRETALLYNPDVSSNGNKESVATIVTHELAHQWFGNLVTMRWWSELWLNEGFASYLEYIGTHEV---EPSWNIKALIILNDLQRAMSVDALASSRPLSVPHSEVMTPAQANSMFDTISYSKGACILSMTSSFLTEPVFVAGLKSYLKEMQFGNAVHQDLWRHLQWAVDNHTVTLPVAVKDILDRWTIQMGYPVVHVNTSSGKLTQSHFLLNPNSTV---TRPSEFDY------VWYIP--ITWKTSTNVSAIKWLNEQEEVFSDLVH------PTSWVILNVEAMGYYRVHYDDGNFQHLLDQLNLNHSAIPLQNRAQLIDDTFSLATA-AKVAIEKALETTVYLENEDEYVPWRTALNNLGYINEMFSTSKYYGSIQKYMLKQIENVYQIHKN---LSFVPSGHMDQYMQVYALNTACGYGKRECLESALTIFQKWMENKSSNVIHPNLRSVVYCQALAAGSILE-WDFAF--KLFQETTFPVEKEKLRSALACSTEPWILRRLLEYALD--STFIRKQDATSV 856          
BLAST of Aminopeptidase vs. Ensembl Sea Lamprey
Match: lnpep (leucyl/cystinyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-030131-1534])

HSP 1 Score: 230.335 bits (586), Expect = 1.245e-62
Identity = 179/647 (27.67%), Postives = 294/647 (45.44%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHS-----SENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQES----GIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKY--SPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKI--SIWNIPL-YIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQD-FYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKL 2188
            LP SV PL Y L +  +   L +      +G +S+  L+   TD + LH+     +E++L+           D  + +AK       + + +     +++G+ Y++ I       FT + S    G     Y+   G    L  TQF+P SAR  FPCFDEP FKA+F ++I  +  ++ LSNMP     +            +F+ S +M  Y +AF + DF  I    + G    I+    +  +  FAL   ++    +E   NI +PL K D +AIP+      ME++GL+TY E  ++   K       +    +I HE+AHQWFGNLVT   W DLWLNEGFATF  +     +  D +   +    +       D   +    + AA     +   FD ++Y KG  +++ML   L    F   I +YL    + +   +DLWESL ++    V +  V+  W+ Q  +P++ ++   +K L       I +K     I+  ++ I  S+W IPL +I   N T       S+ ++ +D         S++W+  N N   F+  DY    +   + +L  +   + P +RA ++ D FY L+    R D+   + L  ++  ET   P   A+  LD++
Sbjct:  201 LPRSVRPLHYHLCLHPNLTTLAV------EGYVSVWLLVDESTDHVVLHANNLTITESILVPADGAPAGGGADGSL-VAKLLRYEPRDQLMVCTRKPLTQGQMYLLNIT------FTGRLSTSFLGFYRSTYRAEDGSDRPLAVTQFEPTSARESFPCFDEPDFKASFDISIVRDAAHTTLSNMP----LNETVTRKDGLLEDTFKGSVVMSTYLVAFIVSDFKSISNKTKHGTNVSIYTSPGKEQQGSFALENAIKFLDFYEELFNISYPLPKQDLVAIPDFAAG-AMENWGLVTYRETALLLGPKASGVRDTLWVAQVIAHELAHQWFGNLVTMNWWNDLWLNEGFATFMEFVATGSLKPDWLMMDVFLTEVVMEALTQDSLPSSHAISSAAVGTMQIGEMFDSVSYNKGASVLNMLRTFLTPAVFVDGIRDYLLVHSYGNAHTDDLWESLTQHLGHSVNVTEVMGTWVRQRGFPLLTLTAV-DKELK------ITYKQEPFPIEPAETSITPSLWQIPLTFITSDNST-------SQSKLITDKQGDIAVTKSTEWIKANTNMTGFYVVDYGKDGWATFANKLTTSKSFLSPADRANLLNDVFYLLN--VGRVDVEDAMPLLSFLPNETSVTPWKVALMHLDRV 813          
BLAST of Aminopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007869.1 (pep scaffold:Pmarinus_7.0:GL476743:229821:259612:1 gene:ENSPMAG00000007088.1 transcript:ENSPMAT00000007869.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.808 bits (473), Expect = 6.695e-49
Identity = 140/506 (27.67%), Postives = 228/506 (45.06%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNV-IRIYLTTNVSKGE-----KYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNM-----------PEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIF---NYVRNFD----DYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYV-SIYQNKSLNLR 1735
            LP  V PL Y L++K D        DS  +G   I+  +   T  I ++ ++   I       I    +++N A  FN    +  + +   + +  G      +++ E+N+        +  G    KY    G+      TQF+   AR  FPC+DEP  KA F +T+   ++   LSNM           PE+       +   + +T      P+M  Y LAF + +F F++     G   R++    +  +  FAL    +T   ++   N+ +PL K+D +AI +      ME++GL+TY E  ++ + K   S SK     ++ HE+AHQWFGNLVT   W  LWLNEGFA++  Y     +  D  F   +  + F   +Y    +    D    I+  +  P  S V+  FD ++Y KG  ++ ML   +   +F   +  YL   +  +    DLWESL + S  P+  V+  W  Q  +P+++V S +Q +S  L 
Sbjct:   10 LPMDVLPLNYALTLKPDVK------DSTFEGREEILLEVKQPTGQIVMNCAD---IDINTASYIPEGGEEIN-ATGFNYQNEDEKVALSFPSTLEPGSGMLKIEFVGELND--------KMKGFYRSKYTAACGEARYAAVTQFEATDARRAFPCWDEPGIKATFDVTLIVPQDRVALSNMNVLERKPHEADPEL-------VEVRYART------PIMSTYLLAFVVGEFDFVEARSSDGVLVRVYTPLGKSEQGKFALEVATKTLPFYKDYFNVPYPLPKIDLIAIADFAAG-AMENWGLVTYRETALLVDPKNSSSASKQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFASWIEY-----LCVDHCFPEFDIWTQFVSTDYAPALELDALDNSHPIEVPVGHP--SEVDEIFDAISYSKGASVIRMLHDYIGDEDFKKGMNMYLTKFQHKNAATEDLWESLEQASGKPVAAVMSSWTKQMGFPVLHVYSEHQGESCTLH 476          
BLAST of Aminopeptidase vs. Ensembl Sea Lamprey
Match: ANPEP (alanyl aminopeptidase, membrane [Source:HGNC Symbol;Acc:HGNC:500])

HSP 1 Score: 184.496 bits (467), Expect = 5.291e-48
Identity = 156/560 (27.86%), Postives = 263/560 (46.96%), Query Frame = 2
Query:  638 SGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQI--YKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWK-DLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVE---------SKFDYLAYKKGFIIVSMLEKLLRKNNF---NLAITNYLNSSKFDSVTPNDLW----ESLNKYS---PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSR---IKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYS-DILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYI 2239
            +G    +Y    G  + L  TQ QP  AR  FPCFDEP  KA F +TI    E+  +SNMP I    +I   +  W+  +F  +  M  Y LAF + +F++I+K  E G + RIWAR   +   +A +ALN T      F     + +PL K D +A+P+      ME++GL+TY E  ++++     + +K    S++ HE+AHQ   N      W+ DLWLNEGFA++  Y  A      E  + L+ L + + +       +L+ S    P+ S  E           FD ++Y KG  ++ ML  ++ K      ++ +  YL + +  +   +DLW    +++NK +   P  ++ ++D W  Q  YP+I +     K    +++  I+ +    R     Y      +W++P+  M   E   ST     +   S ++++L      S W LL ++        Y+   ++RL  +L  N  +IP INRAQII D ++L++  +  D+   L   LY+  E    P    ++ +     + +  + + +  KYI
Sbjct:  192 AGFYRSEYTEETGNRKVLATTQMQPTDARKAFPCFDEPAMKATFDVTIKHKPEHKAISNMPIID-EKNITEGAITWRETTFNTTLKMSTYLLAFIVCEFTYIEKI-ENGTQIRIWARPQAVDDGQADYALNITGNILNFFADYYQVAYPLPKSDQIALPDFAAG-AMENWGLVTYRETALLYDPVQSSNGNKERVASVVAHELAHQVI-NFPLHRPWQSDLWLNEGFASYVEYLGADYA---EPSWELKDLFVMSDLHRVFSTDSLVSS---HPLSSAEEDINTPGEINELFDSISYSKGGSVLRMLSSVMSKPRVYASHVCMQTYLLAHQLSNAAVDDLWHHQQQAVNKNNVILPKTVKEIMDTWTLQMGYPVIKLDTSSGKV--TQEHFLIDPEAVVERPSPFNY------LWDVPITWM--KEGSNSTEWLLGVRGQSCELIKLQA--AISLWSLLPMSLLPLIGCHYDVANWNRLLDELKTNLEVIPVINRAQIIDDAFNLARA-KHIDVELALNTTLYLIDERKYQPWQATISSISYFKQMLDRSAVFGNMQKYI 728          
BLAST of Aminopeptidase vs. Ensembl Sea Lamprey
Match: ANPEP (alanyl aminopeptidase, membrane [Source:HGNC Symbol;Acc:HGNC:500])

HSP 1 Score: 159.844 bits (403), Expect = 8.347e-41
Identity = 144/619 (23.26%), Postives = 261/619 (42.16%), Query Frame = 2
Query:  872 CSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQI--YKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAH-QWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILS---------FVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLW----ESLNKYS---PVPIENVIDGWLTQSCYPIIYVSIYQNKSLN----------LRQNSSINFK-TFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYI-----------EKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGE---NWRLLYSNRNFQSWDYINVKYYAMGCSKVPWIIEK 2596
             +F  +  M  Y LAF + +F++I+K  E G + RIWAR   +   +A +ALN T      F     + +PL K D +A+P+      ME++GL+TY E  ++++     + +K    S++ HE+AH Q+   LV   +  DLWLNEGFAT+  Y  A      E  + ++ L +   +      F++   A + P+ S          +  +FD ++Y KG  ++ ML   +     ++ +  YL + +  +   +DLW    +++NK +   P  ++ ++D W  Q  YP+I +     K             + + S  N++       K D S  ++W     ++    TF       K                  W+LLN++   ++  +Y+   ++RL  QL  N  +IP INRAQII D ++L++  +  D+   L   LY+  E    P    ++ +     + +  + + +  KYI           +++++S +        + +   N+I         +  C    + C     AI   W  NS  +   +L     C  I      E    W++          D +     A+ CS+  WI+ +
Sbjct:    2 TTFNTTLKMSTYLLAFIVCEFTYIEKI-ENGTQIRIWARPQAVDDGQADYALNITGNILNFFADYYRVAYPLPKSDQIALPDFAAG-AMENWGLVTYRETALLYDPVQSSNGNKERVASVVAHELAHQQYLHKLVIMPTQNDLWLNEGFATYVQYLGADYA---EPSWEMKQLFV---ILELQHVFSMDSLASSHPLSSDESDINTPEEISEQFDSISYSKGGSVLRMLSSHMLMEASHVCMQTYLLAHQLSNAAVDDLWDHQQQAVNKNNVILPKTVKEIMDTWTLQMGYPVIKLDTSSGKVTQKHFLIDPEAVVERPSPFNYQWHVPITWKKDGSNNTVW-----LLIPESTFTELQSTDK------------------WVLLNVDEEGYYRVNYDVANWNRLLAQLKTNLEMIPVINRAQIIDDAFNLARA-KHIDVELALNTTLYLIDERKYQPWQATISSISYFKQMLDRSAVFGNMQKYILQQVLPLYIYYDELVSSNWNDVPPGHADQYNQVNAI---------SLACSNNHAPCQQNAIAIYHAWMTNSNFIIHANLKSTVYCAAIAAGGQAEWDFGWKMFKETSLATEADKLRD---ALACSEETWILNR 576          
BLAST of Aminopeptidase vs. Ensembl Yeast
Match: APE2 (Aminopeptidase yscII; may have a role in obtaining leucine from dipeptide substrates; APE2 has a paralog, AAP1, that arose from the whole genome duplication [Source:SGD;Acc:S000001640])

HSP 1 Score: 200.675 bits (509), Expect = 2.155e-53
Identity = 156/555 (28.11%), Postives = 261/555 (47.03%), Query Frame = 2
Query:  140 RNSTILFPKKVSKITHDPI----QNKCCKCNKSTAAMTTEPPRPPVIEIENSIFYLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRT-DMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVI----RIYLTTNVSKGEKYIIEINNFESHHFT----NQESGIISRKYQTP-QGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVS-IICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSY------KMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQN 1741
            + S +  P+ V  +   P+     + C KC K++  +   P R    EI      LP++V PL Y L+++ DF   K       +G++ I   I N   D ++L++                VD  ++ AK  ++T S +I    +   T    KG     + N F    FT    +  +G    KY+    G+ + +  TQ +P  AR  FPCFDEP  KA+F++T+ ++   + LSNM   + +   G      K   F  +P M  Y +AF + +  +++  + +    R++A         FA + T +T   FE+   I +PL K+D++A+        ME++GL+TY   V +  +K   +  ++  V+ ++ HE+AHQWFGNLVT   W+ LWLNEGFAT+ S+      +   KV    V   L+H    + +R+       +K A        +   FD ++Y KG  ++ M+ K L +  F   ++ YLN  K+ +    DLW++L   S   + +V++ W  +  +P+I VS   N  +  RQN
Sbjct:   57 KQSKLTPPRFVKIMNRRPLFTETSHACAKCQKTSQLLNKTPNR----EI------LPDNVVPLHYDLTVEPDFKTFKF------EGSVKIELKINNPAIDTVTLNT----------------VDTDIHSAKIGDVTSSEIISEEEQQVTTFAFPKGTMSSFKGNAFLDIKFTGILNDNMAGFYRAKYEDKLTGETKYMATTQMEPTDARRAFPCFDEPNLKASFAITLVSDPSLTHLSNMDVKNEYVKDGK-----KVTLFNTTPKMSTYLVAFIVAELKYVESKNFR-IPVRVYATPGNEKHGQFAADLTAKTLAFFEKTFGIQYPLPKMDNVAVHEFSAG-AMENWGLVTYR-VVDLLLDKDNSTLDRIQRVAEVVQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNEFQPEWKVWEQYVTDTLQHALSLDSLRSSHPIEVPVKKA------DEINQIFDAISYSKGASLLRMISKWLGEETFIKGVSQYLNKFKYGNAKTEDLWDALADASGKDVRSVMNIWTKKVGFPVISVSEDGNGKITFRQN 565          
BLAST of Aminopeptidase vs. Ensembl Yeast
Match: AAP1 (Arginine/alanine amino peptidase; overproduction stimulates glycogen accumulation; AAP1 has a paralog, APE2, that arose from the whole genome duplication [Source:SGD;Acc:S000001089])

HSP 1 Score: 167.162 bits (422), Expect = 6.347e-43
Identity = 110/368 (29.89%), Postives = 181/368 (49.18%), Query Frame = 2
Query:  629 NQESGIISRKYQTP-QGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVS-IICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPI--LSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQNK 1720
            +Q +G    KY     G+ + +  TQ +   AR  FPCFDEP  KA F++T+ +    + LSNM   +     G      K  +F  +P M  Y +AF + D  +++  + +    R+++         FA N    T R FE   NI++PL K+D +A+        ME++GL+TY    ++ + +   S  ++  V+ +I HE+AHQWFGNLVT   W+ LWLNEGFAT+ S+    K   +  +   E     N  R  +         I  P+     +   FD ++Y KG  ++ M+ K L +  F   ++ YLN  K+ +    DLW++L   S   + +V++ W  +  +P++ V  ++NK
Sbjct:  105 DQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGK-----KYTTFNTTPKMSTYLVAFIVADLRYVESNNFR-IPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHEFSAG-AMENWGLVTYRVIDLLLDIENS-SLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPE--WKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKGSSLLRMISKWLGEETFIKGVSQYLNKFKYGNAKTGDLWDALADASGKDVCSVMNIWTKRVGFPVLSVKEHKNK 462          
BLAST of Aminopeptidase vs. Ensembl Yeast
Match: TMA108 (Ribosome-associated, nascent chain binding factor; binds N-terminal region of nascent peptides during translation; recognizes target proteins via its putative metallopeptidase peptide-binding pocket [Source:SGD;Acc:S000001399])

HSP 1 Score: 127.872 bits (320), Expect = 1.663e-30
Identity = 142/558 (25.45%), Postives = 236/558 (42.29%), Query Frame = 2
Query:  272 IENSIFYLPNSVWPLEYRLSMKFDFNQLKLNSDSRA------QGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKM--NLAKRFNITRSNV-IRIYLTTNVSKGEKYIIEINNFESHH---FTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFR-----IWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYE------EPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVL---NDEVFYALEHLSIFNYV-----RNFDDYFALIKSAIA---APILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSK---FDSVTPNDLWESLNKY-SPVPIENVIDGWLTQSCYPIIYVSIYQNKS---LNLRQNSSINFKTFKSRIKYDDSKISIWNIPLY 1822
            + +++  L N V P  Y L ++ D  Q   N    A        N + +A I +      LHS + +++           D K+  +  K  +I  S   I++     +    +Y+ +I + ++HH   F   ++  + RK  T    +   +AT  QP SA  +FPC DEP  K+ F L I T+ +Y  +SN P +    +  ++SS      F  +P+M      F+I D  F+ KT+ K    R     I+A    I  A F L+T  +   L E      +PL K+D + +P L   + ME++G+IT +       P  + NE       +     +I HE+ HQW GN ++  SW+ LW NE FAT+    +A  +L    D   Y      +   V     R+  D        IA     I S     FD  AY KG I++  L+    +++    + +    +K     SV P D+W  + K+     I N +  W      P++ V + +        L Q+  IN  + + + + +D     + +PL+
Sbjct:    1 MSDNLLSLENPVVPSHYELRLEIDPKQSSPNFKGSAIIHLKFNPNSTTLASIEDSFTQFKLHSKDLIVLSAHATIGSTKFDLKISQDTGKHLSIFNSESPIQLSNDCPLILSVQYVGKIRDIKTHHDKTFGIFKTNFMDRKTGTANNHV---VATHCQPFSASNIFPCIDEPSNKSTFQLNIATDAQYKAVSNTP-VEMVEA--LDSSQKHLVKFAKTPLMTTSVFGFSIGDLEFL-KTEIKLEGDRTIPVSIYA-PWDIANAAFTLDTVQKYLPLLESYFKCPYPLPKLDFVLLPYLSD-MAMENFGMITIQLNHLLIPPNALANETV-----REQAQQLIVHELVHQWMGNYISFDSWESLWFNESFATW----LACHILEQNGDLSHYWTSEPYLLQQVEPTMCRDAADVNGRSIFQIAQRNTGIDSQTSDIFDPEAYTKGIIMLRSLQLATGESHLQKGLESVFEDTKTFHARSVKPMDIWNHIGKFLKSQNITNFVSSWTRTPGLPVVKVEVEEKDGKTQTKLTQHRFINQLSTEEKDQLEDVP---YQVPLF 537          
BLAST of Aminopeptidase vs. Ensembl Yeast
Match: LAP2 (Leucyl aminopeptidase yscIV with epoxide hydrolase activity; metalloenzyme containing one zinc atom; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus; also known as leukotriene A4 hydrolase [Source:SGD;Acc:S000004990])

HSP 1 Score: 74.7146 bits (182), Expect = 3.551e-14
Identity = 78/313 (24.92%), Postives = 136/313 (43.45%), Query Frame = 2
Query:  662 QTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKT--CSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEV--FYALEHLSIF----NYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLL-RKNNFNLAITNYL 1573
            QT  GK    + +Q +   AR++FPCFD P  K+ F+         SI S +P +  FS I I  +   T    FE    +P Y +  A  D S    +   G +  ++    ++    +     VE F     ++  ++     D L   +   + GME   + T+  P +I +++          + +I HE+AH W GNLVT  SW   WLNEG+  +   ++   +  +    F AL   S      + +++ + +  L+++       +  +  F  + Y+KGF ++  LE +L  K  F+  I +Y 
Sbjct:  173 QTKGGK--PYVFSQLEAIHARSLFPCFDTPSVKSTFTA--------SIESPLPVV--FSGIRIEDTSKDTNIYRFEQKVPIPAYLIGIASGDLS----SAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNM-TFATPTLIAHDR--------SNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDN---TDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYF 457          
BLAST of Aminopeptidase vs. Ensembl Nematostella
Match: EDO47790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL33])

HSP 1 Score: 254.603 bits (649), Expect = 7.567e-71
Identity = 214/804 (26.62%), Postives = 371/804 (46.14%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSE-NVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFAL--------IKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQ-------NSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRR-TLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVA-----LCQYIQMDNYG-ENWRLLYS---NRNFQSWDYINVKYYAMGCSKVPWIIEKNIDIAYNVLK 2626
            LP +V P+ Y + +     +L+    S    N      +   TD+I +HS+  NV    +  +   + DQ+  + KRF   ++    + + T +  G  Y++ +  FE+   ++Q +G+   +Y    GK   +  TQFQP  AR  FPC DEP  KA F++TI    ++  +SNMP     +  G          FE + +MP Y LA  + DF   +    +G   R +A   ++ + ++A +   +    FE   NI +PL K D +AIP+      ME++GL+TY E  ++W E       K    ++I HE+AHQWFGNLVT   W DLWLNEGFA+F  YK   KV   E  + ++   +   + + D  F+L        IK A+  P  + +   FD ++Y KG  I+ MLE  L +N F   +T YL    + +   +DLW++L + S   ++ V+D W  Q  YP++ +    +  + + Q       N++++   +KS  +        W IP        T+ +    S+ +M  +   ++    S  W+  N     F+  +Y+   ++ L  +L  +H      +RA I++D ++L++    N   +  +   Y+  ET+ VP   A++ ++ ++GL    S  P + KY+++ L    K+  +     F+ + S     +R ++ +  C+     C   T  + ++W      + D +   V      L  Y  + N G   W  +Y    N   QS + I +  YA+  SK  WII + ++ + +  K
Sbjct:   92 LPKNVVPVHYNVYLNIILKELRFTGTSEIHLN------VTQSTDLILVHSARMNVTSGSVMNK---AGDQQA-IKKRFWFEKNQFTVLQMETALEPG-PYVVMLG-FEAF-LSDQLNGLYRSQYTHKDGKNVTIATTQFQPTDARKAFPCLDEPALKATFNITIEHRPDFIAISNMPIWKNETRNGRTVDH-----FEKTVVMPTYLLAMVVCDFGVKETKSARGVMMRYYAPPDKVEQLNYAASIGNKILDDFEHYYNISYPLPKADMIAIPDFAAG-AMENWGLMTYRETALLWKEGTSSESYKQRVAAVIAHELAHQWFGNLVTMEWWDDLWLNEGFASFVEYKGVNKV---EPTWGMDDQFV---ITDSDTAFSLDGLVSSHPIKVAVNHP--AEINEIFDSISYNKGSCILRMLEDFLGENKFKKGLTRYLKRHAYGNAETDDLWKALKEESGQDVKGVMDTWTLQMGYPVVDIRRKNSSHVTVSQKHFLYDPNANVSASKYKSPYQ--------WVIPF-------TYKTKAMPSEKKMLINKTSVDLEWDSQGWMKANFGQRGFYRVNYDDSNWESLVNELEASHTTFTVSDRAGILKDAFNLARGKMLN-YTQAFETTRYLNKETEYVPWSAALSEINFISGLLSRSS--PAY-KYLQRYLQYQAKKQYDAL--GFKDAGSHLEKFQRSSILSIFCRNGEKSCVGNTTEMFKKW------MEDPEKNPVPSNFRNLVYYYGVANGGVREWDFVYKQFMNTRVQS-EAITL-LYALSASKETWIIGRFLEYSLDPAK 839          
BLAST of Aminopeptidase vs. Ensembl Nematostella
Match: EDO41846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S394])

HSP 1 Score: 241.891 bits (616), Expect = 4.734e-67
Identity = 180/656 (27.44%), Postives = 307/656 (46.80%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFY----------SYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVP----IENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFK---TFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMR 2209
            LP+SV P EY + ++      KL+ D    GN+S+       TD I +H+ +   +R  +   +    + + + +  N  +  +  I +   + KGE Y+++I+ F +     + +G     Y+   G    L  T F+P  AR  FPCFDEP  KA F++ I    E+  LSNMP     S   I+        FE S  M  Y +AF + DF   + T ++G   R+WA +  I +  +AL+  V+    +E+   + +PL K D +AIP+      ME++GLITY    ++++ +     +K     ++ HE+AHQWFGNLVT   W DLWLNEGFA+F            ++M  + L D+       LS+     N D        ++     + + S FD ++Y KG  I+ ML+  L  + F   +  YLN  KF +   N LW++  +         +++V+D W  Q  +P++ +    + ++  +++  I+ K   + +S+  Y       W IP      N+    T K + +E   D +Q +    +S W+  N   + F+  +Y+   ++RL  QL  +H  +   +RA ++ D ++L++  +   L   L L  Y+  E   VP   A++ +    G  E R
Sbjct:   12 LPSSVTPEEYTVILR-----PKLDPDFTFSGNVSVRVKCNEDTDYIFIHAKQ---MRLTKFEVLNQGKEPLKIMETANCEKLEMFSIKVKGGLKKGESYVLQID-FNAV-LAEKLTGFYKSSYKDKDGNTRYLATTHFEPTDARAAFPCFDEPALKAVFNMVIYRKAEHVSLSNMPIKETESGQVIDV-------FEPSVKMSTYLVAFVVCDFKSKEATTKRGTLVRVWAPEDNIDEGDYALSEAVKILSYYEKFFAVRYPLPKQDLIAIPDFAAG-AMENWGLITYRLTSLLYDPEVSSDSNKQWVAVVVAHELAHQWFGNLVTMKWWNDLWLNEGFASFVENIGVNHTTPEWRMMEQFLLDKT-----QLSM-----NLDQLSNSHPISVVVKDPAEINSLFDTISYDKGAAIIRMLKSFLGDDVFQKGLQKYLNKHKFGNAETNQLWDAFTEVCSTKNFRDVKSVMDTWTLQMGFPVVTIKQRGDSAVASQKHFRIHPKVKPSLRSQFDYK------WIIPFTYYTQND---KTKKKAWIE--KDNVQFDYNPATSGWIKANYEQHGFYRVNYDAENWERLKQQLDTDHEKLSAADRAGLLDDAFNLARAGEL-PLTTALDLTKYLTKEEMYVPWAAALSNM----GFLESR 623          
BLAST of Aminopeptidase vs. Ensembl Nematostella
Match: EDO40850 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S604])

HSP 1 Score: 218.009 bits (554), Expect = 3.614e-59
Identity = 192/725 (26.48%), Postives = 320/725 (44.14%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNR-EYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKV---LNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLW-----ESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNE---TFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRS-FYPDWNKYIEKILNSTFKR--FLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNSL 2422
            L + V P  Y + +          +D R +G + I   I   T  + LH  +++ I  + V   +    K  +A+ F    + +  I L +    G     +I  +     TN   G+   +Y+ P G     +A+Q  P  AR V PCFDEP+FKA F++T+  +R EY  LSNMP  S F    +     +T  FE +P M  Y LA AIVDF    +  +   +   +A      +  +A     +    + +   ID+PL K D +A+P+   F  ME++GL+ Y E  ++W E       K     ++ HE+AHQWFGNLVT   W DLWLNEGFA++  Y     V    N    + +E LS    +        +I+  I+ P  + +    D + Y KG  I+ ML+  L  + F   +  YL    + S   +DLW     ES  + S V ++NV+D W  Q  +P++ +          RQN + +F   +SR  + D+++S   +   I F N     F    + +    +S IL+     + + WL  N     ++  +Y+   +D +  QL  NH +    +RA  I+D + L+ +       K L L  Y+  ET  VP     + +  +     +    Y +  KY+  I  + +++  F++   +  +L+       R  + +  CK K   C    + +   W ++++
Sbjct:    8 LSDDVIPYHYNVDLSVSL------ADKRTRGRVEIFVRIARATKHLMLHC-KHLNISAVSVTK-YDGSGKAEIARHFWYKETQLYVIVLKSWFLSGSG---DIKIWYRGLVTNDLVGLYQDEYKQPSGGKSIYVASQLFPTEARKVLPCFDEPKFKATFTITLVHDRPEYLTLSNMPAKSTF----LQGDSRRTV-FEQTPKMSTYLLALAIVDFRNKTQITDGKVEVSFYAAPHMTGQLSYAQMVADKVLPFYAQYFGIDYPLPKADMIALPDFV-FRAMENWGLVMYREENLLWREDTSSEVHKQYVGELVSHELAHQWFGNLVTMTWWDDLWLNEGFASYVWYLGLDAVEPEWNLMNQFIVETLSNAQILDGMTSSHPIIR-PISDP--AKMGDLLDSITYDKGACILRMLDDFLGTDTFVTGVKKYLKEHVYGSAQTDDLWNALTEESCRRDSCVDVKNVMDTWTLQMGFPVVSIK---------RQNGT-HFSVTQSRFLF-DTRVS--KLQETIPFSNSWIIPFTFIKQDNPQTKHSLILKQQG-TIRTRWLKGNYQHRGYYLVNYDNSNWDAIITQLKTNHTVFSSADRAGAIKDAFYLA-RVGLLPYAKALSLTEYMVNETAYVPWKALSDSVHYIEIKLPITGNAYSNLQKYLAYISRNIYRKLSFIDKGSHLDKLT-------RGMILSMNCKAKVESCTRKAKKMFRDWMDDTV 690          
BLAST of Aminopeptidase vs. Ensembl Nematostella
Match: EDO38460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCU3])

HSP 1 Score: 213.772 bits (543), Expect = 9.038e-58
Identity = 174/646 (26.93%), Postives = 293/646 (45.36%), Query Frame = 2
Query:  239 TTEPPRPPVIEIENSIFY----LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSE----NVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKS-AIAAPILSFVESK--FDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESL-----NKYSPVPIENVIDGWLTQSCYPIIYVSIYQNK--SLNLRQN-------SSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDIL-QLNTF-NVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRN 2095
            T EP RP       +  +    LP  V P+ Y L     F  + L+ D    G + I   +   T +I +H+      ++ IR+   +    + Q     K       N   +       +   Y++ I+      ++    G     +    G+    +ATQF+P  AR  FPCFDEP  KA F++TI    +Y  LSNMP    + S  I+    +   FE S +M  Y +AF + DF + +   E   K R+++R+  +    +A+    +  +LF++  ++ + L K+D + +P   G   ME++GLI Y E  ++WN++     +K     II HE+AHQWFGN+VT A W DLWLNE FAT  +YK A      E  + ++   + + V        L  S  I  P++S  E    FD ++Y KG  ++ MLE ++  + F   +  YL +  + +   +DLWES       + S V ++ ++D W  Q  YP++ +   ++K  S  + Q        ++++   +KS   Y       W IP   +   +  A      +    S +L  L+ + N S+ W+  N     F+  +Y    +D L+ QL  NH ++   +RA ++ + + L+   Q N
Sbjct:    6 TEEPTRPAGPATPGTEAWWNVRLPYGVIPVHYNL-----FLNVTLDRD-HFHGKVDIYINVFKATKIIIVHNRRLNVSDIDIRKTGSQGSLGIRQHFPFKK-------NQFYVMEAEQSLEPSLYVVSIS--YKGFYSKGLRGFYRSSFTQNNGQRVYFVATQFEPVKAREAFPCFDEPGMKATFNITIAHRPDYVALSNMP---IYQSKIIDGQ--RHDYFEQSVVMSTYLVAFTVGDFYYKETVTENNVKMRVYSRREALDTTEYAIRVGRDVLKLFDQYYDMGYSLTKLDMIGLPEF-GPGAMENWGLIKYRESYLLWNKESSED-AKYNVARIIAHELAHQWFGNIVTMAWWDDLWLNEAFATLMAYKGADAA---EPSWHVDQHFLVDTVEVAMTLDGLASSHPIRVPVISPDEIGEIFDAISYSKGATVLRMLEYIIGNDTFIDGLRRYLKTHAYGNANTDDLWESFRQASCTRGSCVDVKYIMDTWTLQMGYPVVMIKKAKDKTPSFAVTQKHFLFDPMANVSASKYKSPYNYK------WMIPFTYVTDQQLQAQNRWMDRNSSKSRVLASLHHYRNSSNTWIKGNHGNLGFYLVNYEDDNWDALADQLRTNHTVLGVADRAGLLFNAFKLAMGSQLN 620          
BLAST of Aminopeptidase vs. Ensembl Nematostella
Match: EDO44762 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUV9])

HSP 1 Score: 210.69 bits (535), Expect = 1.535e-56
Identity = 147/503 (29.22%), Postives = 242/503 (48.11%), Query Frame = 2
Query:  614 SHHFTNQESGIISRKYQTPQGKIEQLLA-TQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFAT----------FYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQ---NKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSS-DWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLS 2077
            +    ++  G    KY    G+ E+  A TQF+P  AR  FPC+DEP  KA F +T+   ++   LSNM  I   ++ G NS   K   +  +P+M  Y LAF + +F +++ +D  G   R++  K +  +  FAL   V+T   ++    I +PL K+D +AIP+      ME++GL+TY E  ++ + +   S +K     ++ HE+AHQWFGNL     W  LWLNEGFA+          F  Y + T+ +  ++  ALE     + ++N       I+  +  P  + ++  FD ++Y KG  ++ ML + +   +F   +  YLN  K+ + + +DLW+ L + S  P+  V++ W  Q  +P++ V   Q   ++ L + QN    F    S    D      W +P+ I     T  S P    L + +D   +   +V    W+ LN     F+   Y+  + + L L  + N  L PP +R  +  D Y LS
Sbjct:  105 TGELNDKMKGFYRSKYM--DGEQEKYCAVTQFEPTDARRAFPCWDEPSCKATFDVTLVVPQDRVALSNMNVIEERAAEGNNS--LKVVKYARTPIMSTYLLAFVVGEFDYVEGSDSDGVAVRVYTPKGKSIQGQFALEVAVKTLPFYKDYFGIKYPLPKMDLIAIPDFAAG-AMENWGLVTYRETALLIDPENSSSATKQWVALVVGHEIAHQWFGNL---EWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVTSDLARALE----LDALKNSHP----IEVPVGHP--AEIDEIFDAISYSKGASVIRMLHQYIGDKDFRAGLNQYLNKFKYSNASTDDLWDYLGEASGKPVAKVMNSWTKQMGFPVLTVKAEQKGNDRELTITQN---KFCADGSATGADQR----WKVPVCI--STCTSLSEPAVKTL-LEADSCSVQVSDVQPHQWIKLNPGQVGFYRVKYSPDMLE-LMLPAISNLTL-PPRDRLGLQNDLYALS 577          
BLAST of Aminopeptidase vs. Ensembl Medaka
Match: si:ch211-106j24.1 (aminopeptidase N [Source:NCBI gene;Acc:101170261])

HSP 1 Score: 246.899 bits (629), Expect = 7.350e-68
Identity = 210/826 (25.42%), Postives = 384/826 (46.49%), Query Frame = 2
Query:  239 TTEPPRPPVIEIENSIFY-LPNSVWPLEYRLSMKFDFNQLKLNSDS--RAQGNLSIIALIINRTDMISLHSSE-NVLIRQIRVRNIFSVDQKM--NLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLAT-QFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAH--FALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYV--RNFDDYFALIKSAIAAPIL---------SFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYS--------PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKIS-IWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSK-KFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRL---SNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERW-KNNSLLLTDYDLLHVALCQYIQMDNYGE---NWRLLYSNRNFQSWDYINVKYYAMGCSKVPWIIEKNID 2605
            T  PP  P I  +    Y LP S+ P+ Y +++   + QL+ N+D      G  +++   +  TD+I +H  + N+   +     + S+D     ++ + + + R+  + + L   ++ G  YI++          +   G    +Y      +++++AT Q Q   AR  FPCFDEP  KA F++TI  +R+ + LSN  +I    ++ I++   +  +FE +  M  Y LAF + DFS+    ++     RIWA++  I + H  +ALN T      +++  N  +PL K+D +A+P+      ME++GL+TY E  ++++ +   + +K    ++I HE+AH WFGNLVT   W DLWLNEGFAT+  Y          V YA    ++ +++   +    FA+   A + P+          + ++  FD ++Y KG  ++ ML   L +  F + +++YL +  F +   +DLW+ L +          P+ +++++  W  Q  +P++ +     ++ N+ Q    +F      I    S+ + IW +P+  M          ++  L+  + + Q+       +W+L N N + FF  +Y+   +DRL   L  NH+ +P INRAQII D ++L++ K     L   L+   Y+  E D +P  +A+  L+    +F+    +     Y+ K +   FK F     N   +    N  Y  +        C+++   C  + +    +W +N S      +L     C  + +    E    WR+    RN            A+ CSK PW++ + ++
Sbjct:   53 TPVPPTIPFIPKDPWDHYRLPTSLIPVSYNVTL---WPQLEPNADGVYTFTGRSAVVFRCLRATDLIVIHCHKLNLTSIRGHHAELSSLDGAAVPDIQRTWLVVRTEFLVVQLRGRLTAGASYILQTEF--GGELADDLKGFYRSEYAV--NGVKKVIATSQMQATYARKAFPCFDEPAMKAIFNVTIIHSRDTTALSNGKQIYSGDTL-IDNKPVRVTAFEPTKRMSTYLLAFIVTDFSY-NYLNQSNLLVRIWAQREAIERGHGDYALNLTEPILHFYQKYYNTSYPLSKLDQIALPDFDAG-AMENWGLVTYRESALLFDPQLSSTGNKERVSTVISHELAHMWFGNLVTLRWWNDLWLNEGFATYVEYL--------GVDYAEPSWNMKDHIVLNDMQRAFAVDALASSHPLSRREEEVNTPAEIDEMFDTISYSKGSAVLRMLSAFLTERVFVVGLSSYLKTFAFSNTDDSDLWDHLQQAVDRTPGLGIPLSVKDIMSCWTLQMGFPVVTID---TRTGNINQT---HFLLDPDSIVERPSQFNYIWYVPVKWM---RNGVEQKQYWLLQKTASVDQMKV--SGQEWVLANTNVSGFFRVNYDQDNWDRLIDLLSTNHQALPAINRAQIIDDAFNLARAKIISTKL--ALRTTKYLSKERDYIPWKSALENLNYFILMFDRTEVFGVLQAYLRKQVRPLFKHFQMLTANWTIIPANHNDQYNQI--NAVKMACRVEVEGCRELIKGWYRQWMENPSHNPIHPNLRSTVYCHGVALGGVEEWDFTWRMC---RNATLVSEAMKLRSALACSKTPWLLNRYLE 842          
BLAST of Aminopeptidase vs. Ensembl Medaka
Match: ENSORLT00000042733.1 (aminopeptidase Ey-like [Source:NCBI gene;Acc:101163069])

HSP 1 Score: 238.424 bits (607), Expect = 6.050e-66
Identity = 189/674 (28.04%), Postives = 307/674 (45.55%), Query Frame = 2
Query:  674 GKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKA--HFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYS-----YKMATKVLND-----EVFYALEHLSIFNYVRNFDDYFALIKSAIAAP--ILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYS-------PVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKIS----IWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRF----LNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYS-NRNFQSWDYINVKYYAMGCSKVPWIIEKNID 2605
            G+ + +  TQ QP  AR  FPCFDEP  KA F +T+   +  + LSN     C S I       +T SFE + +M  Y LAFA+ DF  I+         R+WAR+  I +   ++AL         +E+  N  +PLKK D +AIP   G   ME++GLITY E V + + +   +  K   V +I HE+AH WFGNLVT   W DLWLNEGFA++ S     +   T  LND     E+  A+   + F          ++ ++ +  P  ILS     FD + Y KG  ++ M+   + +      +  YL   ++ +  P DLW+ L           P P+E +++ W+ Q  +P+I ++          Q  ++  K F S  K+   + S     W +P+  M   +        SK +  +D+         SDWL+ N+N   FF  +Y+   ++R+  +L   H  IP ++RAQII D ++L+   +  ++   L+   Y++ E + +P   A + L+    +   R  Y     +  + +   F       LN  ++  R S+ +Y  +  T+    CK++   C  +T      W  NS        L  A+          E W  ++S  R   + D  N+  YA+ C++ PW+I + ++
Sbjct:   77 GEEKVIATTQMQPTYARKAFPCFDEPALKAVFHVTLIHPQNTTALSNSMASECVSIIVDGQDLVRT-SFEPTKIMSTYLLAFAVCDFGHIRTEAGASVLIRVWARRKAIQRGMGNYALEKARPILPFYEKYFNTSYPLKKSDQIAIPGF-GPSAMENWGLITYGESVFLHDLEKSFNEDKETVVYMISHELAHMWFGNLVTLRWWNDLWLNEGFASYISSLGSDHAEPTWNLNDLSVPEEILEAMVEDAFF-----VSHPLSVKEAEVRTPQEILSL----FDGITYSKGAAVIRMMSNFVTEAVLTKGLQTYLKEFQYKNTVPKDLWKHLQMAVDEAGISLPRPVEEIMNRWVLQMGFPLITINT---------QTGNVTQKHFLSNPKHVVDRTSEFNYTWFVPITWMKNGKEEQKYWLLSKEDTNTDMAL-----GPSDWLVANINLTGFFRVNYDAENWERIFNKLNSRHEDIPLLSRAQIIDDAFNLA-DLEMVNMTVALRTTSYLDKEVEYMPWRRADSHLENFFHILRPRGIYGPLQAFFREKVTPLFHHHRELTLNWTKSPTRHSD-LYNQM--TVIKLACKLEVKDCSQLTLTWFREWMKNSTTNKIRPSLRDAVYCSAMAAGGVEEWDFMWSIYRKNDTSDPDNL-IYALSCTRQPWLINRYLE 720          
BLAST of Aminopeptidase vs. Ensembl Medaka
Match: enpep (glutamyl aminopeptidase [Source:NCBI gene;Acc:101155001])

HSP 1 Score: 237.654 bits (605), Expect = 1.055e-64
Identity = 185/659 (28.07%), Postives = 314/659 (47.65%), Query Frame = 2
Query:  245 EPP---RPPVIEIENSI-----FYLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVL--IRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSK---GEKYIIEINNFESHHFTNQESGIISRKYQ---TPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSA---IAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKIS-----IWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLL-LNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETD 2146
            EPP   R P +   +S      F LP+ + P+ Y L ++ D     L+ D+   G + I   + + T  + LH  E  +  +  ++   I    Q++ +   F       + +     ++    G+ Y++ ++      F    +G +   Y+   T +G  +++ AT  +P  AR  FPCFDEP  KA ++++IT +++Y  LSNMP+      +  N       SF+ S  M  Y + FA+  F F++K  ++G   RI+A+ SQ+  A FA NTT   F  FE   ++ + + K+D +AIP+  G   ME++GL+TY E  ++++++   S +K    S+I HE+ HQWFGN+VT   W DLWLNEGFA+F+ Y    K    E  + +  + I + V       AL+ S    +     + + S FD ++Y KG  ++ MLE  + ++ F      YL    F +    D W SL + S +PI +V+D W  Q  YP++++S+          NS ++ + F      D S+        W IP+           +  F K    S  L L  ++ S+D LL +N +   F+  +++  ++  +S QL+ +       +RA  I D + L++     D      L LY++ E D
Sbjct:   66 EPPPSGRGPCLPSSDSSGDWKNFRLPDYIKPVHYDLHLEPD-----LDKDTYT-GTVHIQVEVSSPTRHLWLHIRETFVSSMPTLKRLTIEGGQQEVAVKSCFEYKPEQYVVVEAAEELAPTTPGQPYLLSLD------FQGWLNGSVVGFYRVIYTEEGVTKKIAATDHEPTDARKSFPCFDEPNKKATYNISITHHKDYRALSNMPQEGQPEVLPGNK---LKTSFQKSVPMSTYLVCFAVHQFEFVEKISKRGIPLRIYAQPSQLGTAEFAANTTKVIFDYFEEYFDMFYSISKLDQIAIPDF-GTGAMENWGLVTYRETNLLYDDRESSSSNKQRVASVIAHELVHQWFGNIVTMDWWDDLWLNEGFASFFEYIGVEKA---EPSWGMRDIMIISDVLPVMVNDALLSSHPIIVDVSTPAEITSVFDAISYSKGASVLRMLEDWMGRDAFRDGCRKYLKDFYFKNAKTADFWASLAEVSGLPIADVMDTWTKQMGYPVLHLSVSDT-------NSKLSQRRFLLDPNADASQPPSPFGYTWTIPVKWHSTQSNKNVSVMFDK---NSKELILMNYSPSTDGLLKVNDDHMGFYRVNHDDHMWTDISQQLITDFSEFDAADRASFIDDVFSLARA-DVVDYGNAFNLTLYLQNEAD 694          
BLAST of Aminopeptidase vs. Ensembl Medaka
Match: anpepb (aminopeptidase N [Source:NCBI gene;Acc:101159739])

HSP 1 Score: 227.639 bits (579), Expect = 1.024e-61
Identity = 202/767 (26.34%), Postives = 346/767 (45.11%), Query Frame = 2
Query:  410 INRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLT----TNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTP--QGKIEQLLAT-QFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIY--KAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVE---------SKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYS-------PVPIENVIDGWLTQSCYPIIYV-----SIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPL-YIMFGNETFASTPKFSKLEMYSD-ILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRT-LFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVK--YYAMGCSKVPWIIEKNID 2605
            +  TD+I +HS++ +   ++   ++ S+      A     +R   +  YL     + + KG++Y +         FT + +  +   Y++   +G  ++++AT Q QP  AR  FPCFDEP  KA F +T+  +     LSN  E +  +++  +    +   F  +  M  Y LAF + D+ FI  ++  G   RI+ARK  I   +  +ALN T      FE   N  +PL K D +AIP+      ME++GLITY E  ++++E F  + +K    +II HE+AH WFGNLVT   W DLWLNEGFA++  Y  A +    E  + +  L + N V      FA+   A + P+ S  E           FD + Y KG  ++ ML   L ++ F   +  YL    F S    DLW+ L   +       P  I+ +++ W+ Q  +P++ +     +I Q   L    + S     F             W +P+ +I  G       PK+  L+  SD I ++ T    +DW+L NLN   ++  +Y+   +++L   L  +H  IP INRAQ++ D ++L++  +     + L+   Y+  E D +P  +A+N L+    +F+    Y     Y+ + +   F+ F     N  ++ +       +    +  CK   + C  + +     W    +     +L     C  I      E W   + N+  ++   I       A+ C+K PW++ + ++
Sbjct:   28 VEETDLILIHSNK-LNYTKLENGHLASLTSPAGTAPSITESRIQTVTQYLVLRLNSKLLKGQRYQLYTK------FTGELADDLGGFYRSEYFEGTEKKVIATTQMQPTDARKSFPCFDEPAMKAYFDITLRHDFGTVALSN-GEATGTTNVTSDGVTVQQTVFARTEKMSTYLLAFIVCDYDFIH-SNANGVLIRIFARKPAIAAGQGDYALNITGPILTFFEGYYNSSYPLPKSDQIAIPDFNAG-AMENWGLITYRETALLYDEAFSSNSNKERIATIIAHELAHMWFGNLVTLRWWNDLWLNEGFASYVEYLGANRA---EPGWNVADLIVLNDVHRV---FAVDALASSHPLSSKEEDIQKPEQISELFDSITYSKGASVLRMLSDFLTEDVFTKGLQTYLKEFAFGSTVYTDLWKHLQTAAEDNKVDLPTNIDTIMNTWVLQMGFPVVTIDTTTGTISQQHFLLDPDSVSPPSSPFNYE----------WIVPIRWIKTG---VVQPPKW--LQKKSDTIAEMQT--TGADWVLANLNVVGYYRVNYDSNNWNKLLGVLSTSHTTIPVINRAQLVDDSFNLARA-KIIPTVQALETTKYLNLERDYMPWQSAINNLNFFYLMFDRTEVYGPMQTYLNQKVTPLFEHFKTVTENWIKVPDDHLDQYNQVNAISMACKTGLTECTDLVKTWFSNWMTTDVNSIHPNLRSTVYCNAIAAGGANE-WDFAW-NKFKEATIAIEADKLRAALACTKEPWLLNRYLE 758          
BLAST of Aminopeptidase vs. Ensembl Medaka
Match: enpep (glutamyl aminopeptidase [Source:NCBI gene;Acc:101155001])

HSP 1 Score: 227.639 bits (579), Expect = 1.412e-61
Identity = 155/513 (30.21%), Postives = 257/513 (50.10%), Query Frame = 2
Query:  245 EPP---RPPVIEIENSI-----FYLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVL--IRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSK---GEKYIIEINNFESHHFTNQESGIISRKYQ---TPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMP-EISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSA---IAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQNKS 1723
            EPP   R P +   +S      F LP+ + P+ Y L ++ D     L+ D+   G + I   + + T  + LH  E  +  +  ++   I    Q++ +   F       + +     ++    G+ Y++ ++      F    +G +   Y+   T +G  +++ AT  +P  AR  FPCFDEP  KA ++++IT +++Y  LSNMP E+ C    G         SF+ S  M  Y + FA+  F F++K  ++G   RI+A+ SQ+  A FA NTT   F  FE   ++ + + K+D +AIP+  G   ME++GL+TY E  ++++++   S +K    S+I HE+ HQWFGN+VT   W DLWLNEGFA+F+ Y    K    E  + +  + I + V       AL+ S    +     + + S FD ++Y KG  ++ MLE  + ++ F      YL    F +    D W SL + S +PI +V+D W  Q  YP++++S+    S
Sbjct:   66 EPPPSGRGPCLPSSDSSGDWKNFRLPDYIKPVHYDLHLEPD-----LDKDTYT-GTVHIQVEVSSPTRHLWLHIRETFVSSMPTLKRLTIEGGQQEVAVKSCFEYKPEQYVVVEAAEELAPTTPGQPYLLSLD------FQGWLNGSVVGFYRVIYTEEGVTKKIAATDHEPTDARKSFPCFDEPNKKATYNISITHHKDYRALSNMPQEVKCRLLPGNKLK----TSFQKSVPMSTYLVCFAVHQFEFVEKISKRGIPLRIYAQPSQLGTAEFAANTTKVIFDYFEEYFDMFYSISKLDQIAIPDF-GTGAMENWGLVTYRETNLLYDDRESSSSNKQRVASVIAHELVHQWFGNIVTMDWWDDLWLNEGFASFFEYIGVEKA---EPSWGMRDIMIISDVLPVMVNDALLSSHPIIVDVSTPAEITSVFDAISYSKGASVLRMLEDWMGRDAFRDGCRKYLKDFYFKNAKTADFWASLAEVSGLPIADVMDTWTKQMGYPVLHLSVSDTNS 558          
BLAST of Aminopeptidase vs. Planmine SMEST
Match: SMESG000065015.1 (SMESG000065015.1)

HSP 1 Score: 1962.19 bits (5082), Expect = 0.000e+0
Identity = 973/978 (99.49%), Postives = 975/978 (99.69%), Query Frame = 2
Query:   77 MILKYLVSSIFLILTIRAENARNSTILFPKKVSKITHDPIQNKCCKCNKSTAAMTTEPPRPPVIEIENSIFYLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKYYAMGCSKVPWIIEKNIDIAYNVLKNFSKRNDFPHVSEIIIDDIPPDYLHGTTXXXXXXXXXXXYNTPNSINFLYRFKKDGLGVIYNSLLYPPHFPLPNSIVEYAIPTLSHYNFIIYLSHDKLKPRNVILKDAKSNIDWILKNNIENQLKSFV 3010
            MILKYLVSSIFLILTIRAENARNSTILFPKKVSKITHDPIQNKCCKCNKSTAAMTTEPPRPPVIEIENSIFYLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTD+KGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDY+GILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFT VNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCF ITEAIVERWKNNSLL TDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKYYAMGCSKVPWIIEKNIDIAYNVLKNFSKRNDFPHVSEIIIDDIPPDYLHGTTSLSNLLILSSIYNTPNSINFLYRFKKDGLGVIYNSLLYPPHFPLPNSIVEYAIPTLSHYNFIIYLSHDKLKPRNVILKDAKSNIDWILKNNIENQLKSFV
Sbjct:    1 MILKYLVSSIFLILTIRAENARNSTILFPKKVSKITHDPIQNKCCKCNKSTAAMTTEPPRPPVIEIENSIFYLPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDKKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYDGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTVVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGLRRTLFNFGCKMKFSFCFEITEAIVERWKNNSLLQTDYDLLHVALCQYIQMDNYGENWRLLYSNRNFQSWDYINVKYYAMGCSKVPWIIEKNIDIAYNVLKNFSKRNDFPHVSEIIIDDIPPDYLHGTTSLSNLLILSSIYNTPNSINFLYRFKKDGLGVIYNSLLYPPHFPLPNSIVEYAIPTLSHYNFIIYLSHDKLKPRNVILKDAKSNIDWILKNNIENQLKSFV 978          
BLAST of Aminopeptidase vs. Planmine SMEST
Match: SMESG000026219.1 (SMESG000026219.1)

HSP 1 Score: 209.149 bits (531), Expect = 2.770e-55
Identity = 188/661 (28.44%), Postives = 315/661 (47.66%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHS-SENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTC-SFEISPMMPVYNLAFAIVDFSFIQKTDEKG---RKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVR--NFDDYFALIKSAIAAPIL--SFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLW------------ESLNKYSPV-PIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSI----NFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSD--WLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLN 2191
            LP S+ P  Y + +  + +Q+K  + S   G + I A  +  TD + LH+ S  V   ++++ N       +++  R +     + RI         +K +I+++   +     +  G     Y+T  G  + L+ T  +P  AR  FPCFDEP FKANFSL +  ++++  L NMP     S+  + +  +  C S+E S  M  Y +A+ ++   +I           K RI+A K Q     FAL    +    FE    ID+PL K+D +AIP+      ME++GLITY+   ++ N K P    K     II HE+AHQWFGN+VT   W DLWLNEGFAT+  Y +A   +N E +  + H  +  +V   NFD    L    I  P+     +ES FD ++Y KG  +V MLE +L      + +  YL   ++ +   ++LW            ES ++ +PV  ++ V+  WL Q  +P++ ++    KS  L Q   +      K +KS   Y  +   +W+IP  I++  +T  +T    KL ++ D+     F ++ +  W+ LN+    F+  +Y+   +  L  QL  +      I+R+ ++ D + L +   +  +   ++L  Y++ ET  +P   A  +   +N
Sbjct:  100 LPKSIIPNAYAIYIHPNISQVKWKTFS---GLVKIEAKCMIGTDFVVLHAKSLTVDNPEVQIENNVVPITAISICPRLDQYYLKLSRI-----CKVNQKIVIKLSF--NGTLEKRLDGFYLSDYKTKTGVEKTLITTHMEPTFARQAFPCFDEPYFKANFSLRMVRDKDHHSLFNMP---LRSTEKLANGLY--CDSYETSVKMSTYLVAYMLLPLDYISLDGYASLNKTKIRIYAPKDQKDYTSFALEIAQKVLPFFENLFGIDYPLPKLDMIAIPDFSAG-AMENWGLITYKFFTLLLNPKSPKIQHKTSIAKIISHEIAHQWFGNIVTMDWWNDLWLNEGFATYSEY-LAGDYINRE-WGMIGHFYLEQFVDALNFDS--LLNSHPIQVPVKDPQEIESIFDQISYGKGASLVRMLEGVLGLETLKVGLKIYLQRYRYQTAVSDNLWTAFSEAYAKNNKESKDETNPVTKLQKVMSTWLNQMNFPLVTLTRKGPKSFRLTQERFLLHPNATKLWKSN--YTAAFNYVWSIP--ILYQTDTMNAT----KL-IWLDMKTSQDFELAQEYKWIKLNVGQTGFYRVNYDNQSWFDLIDQLRSDFTRFSNIDRSGLLSDAFTLVRA-GKLPVDIAMELASYLKNETHYIPWSIATQVFTDIN 730          
BLAST of Aminopeptidase vs. Planmine SMEST
Match: SMESG000039842.1 (SMESG000039842.1)

HSP 1 Score: 207.608 bits (527), Expect = 3.387e-55
Identity = 115/370 (31.08%), Postives = 185/370 (50.00%), Query Frame = 2
Query:  614 SHHFTNQESGIISRKYQTPQGKIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFLGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVR--NFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQN 1717
            S    ++  G     Y+T   +  ++  TQF+   AR  FPC+DEP  KA F +T+   +  + LSNMPE  C + +   S       +E SP+M  Y LAF I +  +++  D  G + R++  K +  +  FAL+    T   +    +I +PL K+D +AIP+      ME++GL+TY E +++ +E    S SK +   ++ HE AH WFGNLVT   W DLWLNEGFAT+  Y        +  F    + S   Y R  N D   +     +     S ++  FD ++Y KG  ++ ML   L    F   ++ YL   ++ +    DLW +L++ S + +  ++D W  Q+ +P++ V   Q+
Sbjct:   98 SGTLNDEMKGFYRSTYKTDSNEEIRMAVTQFEASDARRAFPCWDEPNIKATFDITLVVPKTKTALSNMPE-KCRTEV---SGSLVKIEYEKSPIMSTYLLAFVIGELDYVESHDSNGVRVRVYTAKDKSNRGRFALDVCCRTLPFYATYFDIVYPLPKMDLVAIPDFAAG-AMENWGLVTYRETMLLVDEHESSSLSKQIVALVVGHECAHMWFGNLVTMDWWTDLWLNEGFATWIEYLCVDYCYPE--FDIWTNFSSDEYARALNLDALRSSHPIQVTVHKPSEIDEIFDAISYSKGACVIRMLNDYLTNEKFKKGLSIYLKRHRYQNAVTADLWAALSEASGLKVAEMMDSWTNQTGFPVVSVEQVQD 460          
BLAST of Aminopeptidase vs. Planmine SMEST
Match: SMESG000033518.1 (SMESG000033518.1)

HSP 1 Score: 205.682 bits (522), Expect = 1.828e-54
Identity = 181/783 (23.12%), Postives = 342/783 (43.68%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQ-PESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGF-LGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLN-----KYSPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPL-YIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLND---FRNDFRLSNSIYTGLRRTL-FNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENW----RLLYSNRNFQSWDYINVKYYAMGCSKVPWIIE 2593
            LP  V P +YR++++  F      +D   +G+++I  +       +  H+ +N+  +Q  ++   S  + + +     I+    + I L   +   E + + +  F S  F  +++G     +     K+++  A     P  A+ VFPCFD+P+F++   L I  ++E  +  ++ +I     +      W    +E +P M VY   F+I  FS+I    ++G   ++WA + ++    F+L T  ++   +E   N  +   K+D +    +  + +G   YGL+   + ++   E   L   K + V++I HE+AHQW GN++    +  LW+ EG   F   K+ T  L   +   L  L         DD  +  + AI       VE  FD L +KKGF +  M++ ++ ++NF  A+   +       ++ NDLW  ++     K   + I+ ++  W ++  YP+I   +   +S+ + Q  +             D++   W +P+ Y++   E          L+  S ++++       DW LLN +   F+  +Y    +  L  QL  NH  IPPI R QI+ D ++   K Q      +  +  Y+E ET+      +  + D L    +MR  Y    KY +  +N   ++ L      ++D+R   ++   +R  L   + C+    +C   TEA  E +  +        L    LC  ++  +   NW    + L++ +   S+D   V   ++ C++ P IIE
Sbjct:   51 LPYFVRPTKYRITLQ-PFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKQSNLKITNSNSRPITIRSVLYISSRKWMLITLEETLQANEPFTVHLRRFSSK-FEKKKNGFYF--FHHTINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNII-HKEQFVSQSIMDIKETKEL---EDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYEIGSSTYGLVIIMDSILFIEEDKVLPSYKQIYVNMIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHKLATALTQTLTGLFA-------DDQVSNHRMAIYPYSAKHVEKFFDDLIFKKGFSLFKMIDGVVGEHNFQYAMQQIVKDETIGPLSANDLWRHIDRVLKHKDLKISIDFIMRDWQSKRGYPVINTKVISRRSIEITQYGN-----------QPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFVDMRPSY----KYFKAFMNKMIRKLLYQIDWMKSDYR---TLTIQMRDELMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGD-KSNWFNVLKFLHNPK--ASFDQKLVIVKSLSCTEDPEIIE 797          
BLAST of Aminopeptidase vs. Planmine SMEST
Match: SMESG000033518.1 (SMESG000033518.1)

HSP 1 Score: 205.297 bits (521), Expect = 2.739e-54
Identity = 182/785 (23.18%), Postives = 345/785 (43.95%), Query Frame = 2
Query:  293 LPNSVWPLEYRLSMKFDFNQLKLNSDSRAQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFNITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQGKIEQLLATQFQ-PESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEISCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFRIWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGF-LGMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTASWKDLWLNEGFATFYSYKMATKVL--NDEVFYALEHLSIFNYVRNFDDYFALIKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLNSSKFDSVTPNDLWESLN-----KYSPVPIENVIDGWLTQSCYPIIYVSIYQNKSLNLRQNSSINFKTFKSRIKYDDSKISIWNIPL-YIMFGNETFASTPKFSKLEMYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRLIPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNLLDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLND---FRNDFRLSNSIYTGLRRTL-FNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQMDNYGENW----RLLYSNRNFQSWDYINVKYYAMGCSKVPWIIE 2593
            LP  V P +YR++++  F      +D   +G+++I  +       +  H+ +N+  +Q  ++   S  + + +     I+    + I L   +   E + + +  F S  F  +++G     +     K+++  A     P  A+ VFPCFD+P+F++   L I  ++E  +  ++ +I     +      W    +E +P M VY   F+I  FS+I    ++G   ++WA + ++    F+L T  ++   +E   N  +   K+D +    +  + +G   YGL+   + ++   E   L   K + V++I HE+AHQW GN++    +  LW+ EG   F   K+ T V   N ++  AL       +    DD  +  + AI       VE  FD L +KKGF +  M++ ++ ++NF  A+   +       ++ NDLW  ++     K   + I+ ++  W ++  YP+I   +   +S+ + Q  +             D++   W +P+ Y++   E          L+  S ++++       DW LLN +   F+  +Y    +  L  QL  NH  IPPI R QI+ D ++   K Q      +  +  Y+E ET+      +  + D L    +MR  Y    KY +  +N   ++ L      ++D+R   ++   +R  L   + C+    +C   TEA  E +  +        L    LC  ++  +   NW    + L++ +   S+D   V   ++ C++ P IIE
Sbjct:   51 LPYFVRPTKYRITLQ-PFIHYHNEADFYFRGSVTIECVSEKPIKRVMFHAGKNINFKQSNLKITNSNSRPITIRSVLYISSRKWMLITLEETLQANEPFTVHLRRFSSK-FEKKKNGFYF--FHHTINKVKRYGANVLHSPFYAKNVFPCFDDPQFESEIQLNII-HKEQFVSQSIMDIKETKEL---EDGWLVSMYEWTPAMQVYQFTFSINKFSYITDYSKRGHLIKLWAPEEKLKLCKFSLKTVRKSLDFYEEYFNSTYAFDKLDVVTTSKMPPYEIGSSTYGLVIIMDSILFIEEDKVLPSYKQIYVNMIHHEIAHQWIGNVLRMEWFDALWMIEGLVGFMEQKIRTHVTQYNHKLATALTQTLTGLFA---DDQVSNHRMAIYPYSAKHVEKFFDDLIFKKGFSLFKMIDGVVGEHNFQYAMQQIVKDETIGPLSANDLWRHIDRVLKHKDLKISIDFIMRDWQSKRGYPVINTKVISRRSIEITQYGN-----------QPDNREFTWPVPITYLVKNGEEKTDFRSVIWLKERSKLIEMEKVISDDDWFLLNPDQIGFYRVNYELSNWILLIHQLRSNHNAIPPIARLQILGDMFEFYSKGQILGAQTIFDVISYLENETEYTIWKYSKTIFDLLKSFVDMRPSY----KYFKAFMNKMIRKLLYQIDWMKSDYR---TLTIQMRDELMLTYACRFDHPYCKERTEAYFEYFLKDHYFAAPLYLYGSILCNGLRFGD-KSNWFNVLKFLHNPK--ASFDQKLVIVKSLSCTEDPEIIE 803          
The following BLAST results are available for this feature:
BLAST of Aminopeptidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LVRN7.657e-7928.62laeverin [Source:HGNC Symbol;Acc:HGNC:26904][more]
LVRN1.308e-7830.28laeverin [Source:HGNC Symbol;Acc:HGNC:26904][more]
LVRN3.924e-7429.62laeverin [Source:HGNC Symbol;Acc:HGNC:26904][more]
ENPEP1.143e-6827.13glutamyl aminopeptidase [Source:HGNC Symbol;Acc:HG... [more]
LNPEP4.389e-6727.57leucyl and cystinyl aminopeptidase [Source:HGNC Sy... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F49B2.61.512e-6127.41Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:G5EGH... [more]
anp-19.131e-5827.09Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:Q1HB0... [more]
anp-11.071e-5726.98Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:Q1HB0... [more]
Y67D8C.94.763e-5529.94Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:A8W76... [more]
Y67D8C.97.250e-5529.94Aminopeptidase [Source:UniProtKB/TrEMBL;Acc:A8W76... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG314458.180e-7526.73gene:FBgn0051445 transcript:FBtr0085401[more]
CG314458.180e-7526.73gene:FBgn0051445 transcript:FBtr0332431[more]
SP10291.168e-6925.24gene:FBgn0263236 transcript:FBtr0085400[more]
SP10291.168e-6925.24gene:FBgn0263236 transcript:FBtr0334868[more]
SP10291.168e-6925.24gene:FBgn0263236 transcript:FBtr0085399[more]
back to top
BLAST of Aminopeptidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lnpep1.064e-7228.40leucyl/cystinyl aminopeptidase [Source:ZFIN;Acc:ZD... [more]
lnpep1.737e-7228.40leucyl/cystinyl aminopeptidase [Source:ZFIN;Acc:ZD... [more]
lnpep2.034e-7228.40leucyl/cystinyl aminopeptidase [Source:ZFIN;Acc:ZD... [more]
anpepa1.592e-7026.84alanyl (membrane) aminopeptidase a [Source:ZFIN;Ac... [more]
BX005410.11.248e-6825.15si:ch211-106j24.1 [Source:NCBI gene;Acc:555478][more]
back to top
BLAST of Aminopeptidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LNPEP4.520e-7126.32leucyl/cystinyl aminopeptidase [Source:NCBI gene;A... [more]
LNPEP1.785e-6926.39leucyl/cystinyl aminopeptidase [Source:NCBI gene;A... [more]
LNPEP2.438e-6926.39leucyl/cystinyl aminopeptidase [Source:NCBI gene;A... [more]
ERAP13.055e-6926.79endoplasmic reticulum aminopeptidase 1 [Source:NCB... [more]
ERAP13.604e-6926.79endoplasmic reticulum aminopeptidase 1 [Source:NCB... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lvrn7.273e-7526.89laeverin [Source:MGI Symbol;Acc:MGI:1921824][more]
Enpep5.997e-6727.43glutamyl aminopeptidase [Source:MGI Symbol;Acc:MGI... [more]
Trhde3.886e-6428.52TRH-degrading enzyme [Source:MGI Symbol;Acc:MGI:23... [more]
Lnpep1.045e-6326.20leucyl/cystinyl aminopeptidase [Source:MGI Symbol;... [more]
Erap13.165e-6326.76endoplasmic reticulum aminopeptidase 1 [Source:MGI... [more]
back to top
BLAST of Aminopeptidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6Q4G3|AMPQ_HUMAN6.282e-7830.28Aminopeptidase Q OS=Homo sapiens OX=9606 GN=LVRN P... [more]
sp|O57579|AMPN_CHICK5.683e-7228.45Aminopeptidase Ey OS=Gallus gallus OX=9031 GN=ANPE... [more]
sp|Q07075|AMPE_HUMAN5.491e-6827.13Glutamyl aminopeptidase OS=Homo sapiens OX=9606 GN... [more]
sp|P50123|AMPE_RAT8.425e-6827.43Glutamyl aminopeptidase OS=Rattus norvegicus OX=10... [more]
sp|Q9UIQ6|LCAP_HUMAN3.865e-6627.57Leucyl-cystinyl aminopeptidase OS=Homo sapiens OX=... [more]
back to top
BLAST of Aminopeptidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5G2QQR13.452e-8328.45Aminopeptidase OS=Sus scrofa OX=9823 GN=LVRN PE=1 ... [more]
A0A480UYE28.654e-8328.45Aminopeptidase OS=Sus scrofa OX=9823 PE=3 SV=1[more]
F1RLE31.044e-8228.45Aminopeptidase OS=Sus scrofa OX=9823 GN=LVRN PE=1 ... [more]
A0A4X1U4I51.113e-8228.36Aminopeptidase OS=Sus scrofa OX=9823 GN=LVRN PE=3 ... [more]
A0A340WWQ95.275e-8228.68Aminopeptidase OS=Lipotes vexillifer OX=118797 GN=... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
erap1b1.011e-6927.50endoplasmic reticulum aminopeptidase 1 [Source:NCB... [more]
erap1a3.771e-6726.48endoplasmic reticulum aminopeptidase 1a [Source:ZF... [more]
lnpep5.269e-6726.86leucyl and cystinyl aminopeptidase [Source:NCBI ge... [more]
lnpep6.010e-6726.86leucyl and cystinyl aminopeptidase [Source:NCBI ge... [more]
anpepa7.456e-6625.69aminopeptidase N-like [Source:NCBI gene;Acc:103035... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANPEP4.761e-7928.27alanyl aminopeptidase, membrane [Source:HGNC Symbo... [more]
lnpep1.245e-6227.67leucyl/cystinyl aminopeptidase [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000007869.16.695e-4927.67pep scaffold:Pmarinus_7.0:GL476743:229821:259612:1... [more]
ANPEP5.291e-4827.86alanyl aminopeptidase, membrane [Source:HGNC Symbo... [more]
ANPEP8.347e-4123.26alanyl aminopeptidase, membrane [Source:HGNC Symbo... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
APE22.155e-5328.11Aminopeptidase yscII; may have a role in obtaining... [more]
AAP16.347e-4329.89Arginine/alanine amino peptidase; overproduction s... [more]
TMA1081.663e-3025.45Ribosome-associated, nascent chain binding factor;... [more]
LAP23.551e-1424.92Leucyl aminopeptidase yscIV with epoxide hydrolase... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO477907.567e-7126.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418464.734e-6727.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408503.614e-5926.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384609.038e-5826.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447621.535e-5629.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aminopeptidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-106j24.17.350e-6825.42aminopeptidase N [Source:NCBI gene;Acc:101170261][more]
ENSORLT00000042733.16.050e-6628.04aminopeptidase Ey-like [Source:NCBI gene;Acc:10116... [more]
enpep1.055e-6428.07glutamyl aminopeptidase [Source:NCBI gene;Acc:1011... [more]
anpepb1.024e-6126.34aminopeptidase N [Source:NCBI gene;Acc:101159739][more]
enpep1.412e-6130.21glutamyl aminopeptidase [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Aminopeptidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065015.10.000e+099.49SMESG000065015.1[more]
SMESG000026219.12.770e-5528.44SMESG000026219.1[more]
SMESG000039842.13.387e-5531.08SMESG000039842.1[more]
SMESG000033518.11.828e-5423.12SMESG000033518.1[more]
SMESG000033518.12.739e-5423.18SMESG000033518.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006924 ID=SMED30006924|Name=Aminopeptidase|organism=Schmidtea mediterranea sexual|type=transcript|length=3057bp
CTGCAATTTCAAATGACAGAGAGAATATCATTTTAGATCAAATGCCAAAC
TTATATTGTACGAGTGAAATTAGAAAATGATTCTCAAATATTTAGTTTCC
AGTATTTTTCTCATCCTCACTATACGAGCTGAGAATGCTAGAAATAGTAC
TATTCTATTTCCAAAGAAAGTCAGTAAAATTACCCATGACCCCATTCAAA
ATAAGTGCTGTAAATGTAACAAATCGACCGCCGCCATGACTACCGAGCCA
CCAAGACCCCCAGTTATTGAAATTGAAAACTCAATTTTCTATTTGCCAAA
CTCGGTCTGGCCATTAGAATATCGGTTATCGATGAAATTTGATTTTAATC
AATTGAAATTAAATTCCGATAGTCGAGCACAGGGAAACTTATCGATTATT
GCACTTATTATCAATCGGACCGACATGATATCCCTACATTCGTCAGAAAA
CGTACTAATTCGTCAAATACGAGTGAGAAACATTTTTTCAGTAGATCAAA
AAATGAATCTCGCAAAAAGGTTTAATATTACTCGCTCTAATGTCATAAGG
ATATACCTAACCACTAATGTGTCAAAAGGGGAGAAATACATTATTGAAAT
TAATAATTTTGAAAGCCATCATTTTACAAATCAGGAATCCGGAATCATTT
CGAGGAAATATCAAACCCCACAAGGCAAAATTGAACAGTTGTTGGCCACT
CAATTTCAGCCGGAATCAGCTCGAACAGTGTTTCCATGTTTTGACGAGCC
CCGGTTTAAAGCAAATTTTAGTTTGACAATTACGACAAATCGAGAATACT
CGATTTTAAGTAATATGCCGGAAATATCCTGTTTTTCGAGTATCGGTATT
AATTCCTCTTTTTGGAAGACTTGTTCATTTGAAATTTCTCCGATGATGCC
TGTCTATAATTTAGCATTTGCGATTGTCGACTTTAGCTTCATTCAGAAAA
CCGATGAAAAGGGAAGAAAATTTAGAATTTGGGCCAGAAAATCTCAAATT
TATAAAGCTCATTTTGCGTTGAATACCACAGTGGAAACGTTTAGACTTTT
TGAAAGACAATTGAACATAGATTTTCCGTTGAAGAAAGTAGATTCCTTAG
CTATTCCTAATCTTAAAGGATTTCTTGGAATGGAACATTATGGACTGATT
ACATACGAAGAACCGGTAATAATTTGGAACGAAAAATTTCCCTTATCCTT
TTCAAAAGTATTGTGTGTGTCTATAATCTGCCACGAAGTGGCTCATCAAT
GGTTTGGAAATTTAGTCACAACTGCATCTTGGAAGGATTTATGGTTGAAT
GAAGGATTTGCAACATTCTATTCGTATAAAATGGCAACGAAAGTTTTAAA
TGATGAAGTGTTTTACGCATTGGAACATTTGTCGATATTCAATTACGTTC
GGAATTTCGATGATTATTTTGCGCTAATTAAATCAGCAATTGCTGCCCCG
ATTCTCTCTTTTGTCGAATCAAAATTCGATTATCTCGCGTATAAAAAAGG
GTTTATTATTGTGAGTATGCTGGAGAAATTATTGCGAAAAAATAATTTCA
ACTTGGCAATAACGAATTATTTAAATAGTAGCAAATTCGATTCTGTTACT
CCAAATGATCTTTGGGAGAGTTTAAATAAGTATTCCCCAGTACCAATTGA
AAATGTTATAGATGGTTGGTTGACCCAATCTTGCTATCCTATTATTTATG
TCAGTATATACCAAAATAAGTCACTTAATTTGAGACAAAATTCATCTATT
AATTTTAAAACTTTTAAATCAAGAATTAAATATGACGATTCCAAGATCAG
TATTTGGAATATCCCATTATATATAATGTTTGGCAATGAAACCTTTGCGT
CGACACCTAAATTTAGTAAATTAGAAATGTACTCCGACATTCTTCAATTA
AATACATTTAACGTCTCTTCTGATTGGTTGCTATTGAATCTGAATTGCAA
TTCGTTTTTCACTACGGACTACAATGGAATTCTATTTGACAGATTGTCTT
TGCAACTCCTCAAAAACCATCGTCTTATTCCGCCGATAAATCGCGCTCAA
ATAATTCAAGATTTCTATGATTTATCTAAAAAATTCCAGAGAAATGATTT
ACACAAATTATTGAAATTGTTTCTTTACATCGAAGCCGAAACCGATCCAG
TTCCGATTTTTACTGCGGTTAATTTGTTGGATAAATTAAATGGACTCTTT
GAAATGAGATCGTTTTATCCGGATTGGAATAAATATATTGAGAAAATATT
AAATTCCACTTTTAAAAGATTCTTAAATGATTTCCGAAACGATTTCCGAT
TGTCGAATTCTATTTACACGGGTCTACGGAGGACGCTGTTTAATTTTGGT
TGTAAAATGAAATTTAGCTTCTGCTTCGTAATCACTGAGGCTATTGTGGA
AAGATGGAAAAATAATAGTTTATTGCTGACGGATTATGATTTGCTTCATG
TTGCACTTTGTCAGTATATACAAATGGATAATTACGGGGAAAACTGGCGA
CTATTGTACAGTAATAGAAACTTTCAGAGCTGGGATTACATCAATGTAAA
ATACTATGCAATGGGATGTTCTAAGGTTCCATGGATAATTGAGAAAAATA
TAGATATTGCCTACAATGTGTTGAAAAATTTCAGTAAAAGAAATGACTTT
CCGCATGTTTCAGAAATTATTATCGATGATATTCCTCCTGATTATCTCCA
TGGAACAACATCATTATCAAATCTTCTAATTCTTTCATCAATCTACAATA
CTCCCAATTCTATTAACTTTCTGTATCGGTTTAAAAAAGATGGACTTGGT
GTCATTTACAATTCTCTTTTATACCCCCCTCATTTCCCTTTGCCGAATTC
TATCGTCGAATATGCCATACCGACTCTGAGCCACTACAATTTTATAATCT
ATTTGTCACATGACAAATTAAAACCGAGAAATGTTATATTAAAAGATGCA
AAATCGAATATAGACTGGATTTTGAAAAACAACATCGAAAATCAACTAAA
AAGTTTTGTGTAAATTTTAATATTATTTATTAACTTGTTTTTTTTATTAG
ACGTAGC
back to top

protein sequence of SMED30006924-orf-1

>SMED30006924-orf-1 ID=SMED30006924-orf-1|Name=SMED30006924-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=979bp
MILKYLVSSIFLILTIRAENARNSTILFPKKVSKITHDPIQNKCCKCNKS
TAAMTTEPPRPPVIEIENSIFYLPNSVWPLEYRLSMKFDFNQLKLNSDSR
AQGNLSIIALIINRTDMISLHSSENVLIRQIRVRNIFSVDQKMNLAKRFN
ITRSNVIRIYLTTNVSKGEKYIIEINNFESHHFTNQESGIISRKYQTPQG
KIEQLLATQFQPESARTVFPCFDEPRFKANFSLTITTNREYSILSNMPEI
SCFSSIGINSSFWKTCSFEISPMMPVYNLAFAIVDFSFIQKTDEKGRKFR
IWARKSQIYKAHFALNTTVETFRLFERQLNIDFPLKKVDSLAIPNLKGFL
GMEHYGLITYEEPVIIWNEKFPLSFSKVLCVSIICHEVAHQWFGNLVTTA
SWKDLWLNEGFATFYSYKMATKVLNDEVFYALEHLSIFNYVRNFDDYFAL
IKSAIAAPILSFVESKFDYLAYKKGFIIVSMLEKLLRKNNFNLAITNYLN
SSKFDSVTPNDLWESLNKYSPVPIENVIDGWLTQSCYPIIYVSIYQNKSL
NLRQNSSINFKTFKSRIKYDDSKISIWNIPLYIMFGNETFASTPKFSKLE
MYSDILQLNTFNVSSDWLLLNLNCNSFFTTDYNGILFDRLSLQLLKNHRL
IPPINRAQIIQDFYDLSKKFQRNDLHKLLKLFLYIEAETDPVPIFTAVNL
LDKLNGLFEMRSFYPDWNKYIEKILNSTFKRFLNDFRNDFRLSNSIYTGL
RRTLFNFGCKMKFSFCFVITEAIVERWKNNSLLLTDYDLLHVALCQYIQM
DNYGENWRLLYSNRNFQSWDYINVKYYAMGCSKVPWIIEKNIDIAYNVLK
NFSKRNDFPHVSEIIIDDIPPDYLHGTTSLSNLLILSSIYNTPNSINFLY
RFKKDGLGVIYNSLLYPPHFPLPNSIVEYAIPTLSHYNFIIYLSHDKLKP
RNVILKDAKSNIDWILKNNIENQLKSFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004177aminopeptidase activity
GO:0008237metallopeptidase activity
GO:0008270zinc ion binding
GO:0042277peptide binding
GO:0046872metal ion binding
GO:0070006metalloaminopeptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001930Peptidase_M1
IPR042097Aminopeptidase_N-like_N
IPR034016M1_APN-typ
IPR014782Peptidase_M1_dom
IPR024571ERAP1-like_C_dom
Vocabulary: biological process
TermDefinition
GO:0043171peptide catabolic process
GO:0006508proteolysis
GO:0007165signal transduction
GO:0007267cell-cell signaling
GO:0008217regulation of blood pressure
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001930Peptidase M1, alanine aminopeptidase/leukotriene A4 hydrolasePRINTSPR00756ALADIPTASEcoord: 268..283
score: 36.16
coord: 383..398
score: 71.54
coord: 402..414
score: 69.23
coord: 216..231
score: 59.04
IPR024571ERAP1-like C-terminal domainPFAMPF11838ERAP1_Ccoord: 617..846
e-value: 5.7E-19
score: 68.8
NoneNo IPR availableGENE3DG3DSA:1.10.390.60coord: 287..535
e-value: 3.2E-63
score: 215.3
NoneNo IPR availableGENE3DG3DSA:1.25.50.20coord: 635..916
e-value: 5.0E-28
score: 100.1
NoneNo IPR availablePFAMPF17900Peptidase_M1_Ncoord: 79..277
e-value: 7.3E-28
score: 98.0
NoneNo IPR availablePANTHERPTHR11533PROTEASE M1 ZINC METALLOPROTEASEcoord: 48..856
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.606
NoneNo IPR availableSUPERFAMILYSSF55486Metalloproteases ("zincins"), catalytic domaincoord: 293..542
IPR014782Peptidase M1, membrane alanine aminopeptidasePFAMPF01433Peptidase_M1coord: 313..531
e-value: 1.4E-48
score: 165.3
IPR042097Aminopeptidase N-like , N-terminalGENE3DG3DSA:2.60.40.1730coord: 65..286
e-value: 1.4E-44
score: 154.9
IPR042097Aminopeptidase N-like , N-terminalSUPERFAMILYSSF63737Leukotriene A4 hydrolase N-terminal domaincoord: 71..283
IPR034016Aminopeptidase N-typeCDDcd09601M1_APN-Q_likecoord: 80..533
e-value: 2.14707E-118
score: 367.676