SMED30006914

Overview
NameSMED30006914
Smed IDSMED30006914
Uniprot Best hit5-hydroxytryptamine receptor 2A OS=Sus scrofa OX=9823 GN=HTR2A PE=2 SV=1 (E=2.57868e-24)
Length (bp)2230
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30006914 (SMED30006914) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30006914 (SMED30006914) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006914

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006914SMESG000001324.1 SmedASXL_009278SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30006914SMESG000001324.1 dd_Smed_v6_18003_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30006914SMESG000001324.1 dd_Smed_v4_18003_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30006914SMESG000001324.1 dd_Smed_v4_18003_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30006914 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.011321:6323..8257 +8530
Homology
BLAST of SMED30006914 vs. Ensembl Human
Match: HTR2A (5-hydroxytryptamine receptor 2A [Source:HGNC Symbol;Acc:HGNC:5293])

HSP 1 Score: 108.227 bits (269), Expect = 3.433e-24
Identity = 68/177 (38.42%), Postives = 103/177 (58.19%), Query Frame = -3
Query: 1401 IQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTF 1925
            +Q  NW  L   ++ I+TI GN+LV ++V +EK+LQN  NYFL+SLA++D+L   LVMPVS + ++       WP  +++C  W  LDV F+  +I+HLC ISLDRY A+ NP+ + R   + ++ +LKI A W I   I+ P+ +  +  D        C      F+L    V+F
Sbjct:   71 LQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYG---YRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSR-TKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSFVSF 243          

HSP 2 Score: 65.855 bits (159), Expect = 1.363e-10
Identity = 53/172 (30.81%), Postives = 77/172 (44.77%), Query Frame = -3
Query:  174 TIEQNHTLVSQDSLSLNYRPLNASTPFLKNKSASIEKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNRSLKDVIRHL----EWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRN 674
            ++++  TL   D   L  R   AS  FL   S S EK   +   + P   T R                      T ++I   +KA +VLG +F LF++ + PFF+  I    C  SCN   +DVI  L     W+GY +S +NP+VY +FN  ++  F R +   CQ   N
Sbjct:  260 SLQKEATLCVSD---LGTRAKLASFSFLPQSSLSSEKLFQRSIHREPGSYTGR---------------------RTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCN---EDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQ--CQYKEN 402          
BLAST of SMED30006914 vs. Ensembl Human
Match: HTR2A (5-hydroxytryptamine receptor 2A [Source:HGNC Symbol;Acc:HGNC:5293])

HSP 1 Score: 108.227 bits (269), Expect = 3.433e-24
Identity = 68/177 (38.42%), Postives = 103/177 (58.19%), Query Frame = -3
Query: 1401 IQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTF 1925
            +Q  NW  L   ++ I+TI GN+LV ++V +EK+LQN  NYFL+SLA++D+L   LVMPVS + ++       WP  +++C  W  LDV F+  +I+HLC ISLDRY A+ NP+ + R   + ++ +LKI A W I   I+ P+ +  +  D        C      F+L    V+F
Sbjct:   71 LQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYG---YRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSR-TKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSFVSF 243          

HSP 2 Score: 65.855 bits (159), Expect = 1.363e-10
Identity = 53/172 (30.81%), Postives = 77/172 (44.77%), Query Frame = -3
Query:  174 TIEQNHTLVSQDSLSLNYRPLNASTPFLKNKSASIEKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNRSLKDVIRHL----EWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRN 674
            ++++  TL   D   L  R   AS  FL   S S EK   +   + P   T R                      T ++I   +KA +VLG +F LF++ + PFF+  I    C  SCN   +DVI  L     W+GY +S +NP+VY +FN  ++  F R +   CQ   N
Sbjct:  260 SLQKEATLCVSD---LGTRAKLASFSFLPQSSLSSEKLFQRSIHREPGSYTGR---------------------RTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCN---EDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQ--CQYKEN 402          
BLAST of SMED30006914 vs. Ensembl Human
Match: HTR2B (5-hydroxytryptamine receptor 2B [Source:HGNC Symbol;Acc:HGNC:5294])

HSP 1 Score: 93.9745 bits (232), Expect = 1.606e-19
Identity = 63/166 (37.95%), Postives = 95/166 (57.23%), Query Frame = -3
Query: 1449 KNTTESEIQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGC 1946
            K   E +    +W  L + ++ I TI GN LV L+V +EK+LQ   NYFL+SLAV+DLL    VMP+ A++ +  +     P  +C AW  LDV F+  +I+HLC IS+DRY A+  P++  +   +++  ++KI   W+I   IA P+ I  I  D  N +   C
Sbjct:   44 KQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPI-ALLTIMFEAMWPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATA-FIKITVVWLISIGIAIPVPIKGIETDVDNPNNITC 207          

HSP 2 Score: 68.5514 bits (166), Expect = 2.336e-11
Identity = 33/102 (32.35%), Postives = 60/102 (58.82%), Query Frame = -3
Query:  174 KQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNR-SLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRN 476
            +++      + + I   ++A +VLG +F LFLL + PFF+  I    C SCN+ +L+ ++    W+GY +S +NP+VY +FN  F+  F R +  N + +++
Sbjct:  303 RRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKS 404          
BLAST of SMED30006914 vs. Ensembl Human
Match: HTR2C (5-hydroxytryptamine receptor 2C [Source:HGNC Symbol;Acc:HGNC:5295])

HSP 1 Score: 80.4925 bits (197), Expect = 3.045e-15
Identity = 49/124 (39.52%), Postives = 79/124 (63.71%), Query Frame = -3
Query: 1485 LVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAI 1856
            LV ++V +EK+L N  NYFL+SLA++D+L   LVMP+S ++ +  D     P  +C  W SLDV F+  +I+HLC ISLDRY A+ NP+++ R   ++  + +KI   W I   ++ P+ ++ +
Sbjct:   73 LVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLS-LLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAI-MKIAIVWAISIGVSVPIPVIGL 194          

HSP 2 Score: 67.3958 bits (163), Expect = 4.677e-11
Identity = 35/96 (36.46%), Postives = 54/96 (56.25%), Query Frame = -3
Query:  168 TKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCP-SCNRSLKD-VIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRNNP 449
            T + I   RKA +VLG +F +FL+ + PFF+  I    C  SCN+ L + ++    W+GY  S +NP+VY +FN I++  F   L  N +  +  P
Sbjct:  299 TMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPP 394          
BLAST of SMED30006914 vs. Ensembl Human
Match: HTR2C (5-hydroxytryptamine receptor 2C [Source:HGNC Symbol;Acc:HGNC:5295])

HSP 1 Score: 80.4925 bits (197), Expect = 3.045e-15
Identity = 49/124 (39.52%), Postives = 79/124 (63.71%), Query Frame = -3
Query: 1485 LVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAI 1856
            LV ++V +EK+L N  NYFL+SLA++D+L   LVMP+S ++ +  D     P  +C  W SLDV F+  +I+HLC ISLDRY A+ NP+++ R   ++  + +KI   W I   ++ P+ ++ +
Sbjct:   73 LVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLS-LLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAI-MKIAIVWAISIGVSVPIPVIGL 194          

HSP 2 Score: 67.3958 bits (163), Expect = 4.677e-11
Identity = 35/96 (36.46%), Postives = 54/96 (56.25%), Query Frame = -3
Query:  168 TKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCP-SCNRSLKD-VIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRNNP 449
            T + I   RKA +VLG +F +FL+ + PFF+  I    C  SCN+ L + ++    W+GY  S +NP+VY +FN I++  F   L  N +  +  P
Sbjct:  299 TMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPP 394          
BLAST of SMED30006914 vs. Ensembl Celegans
Match: ser-1 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:O17470])

HSP 1 Score: 87.0409 bits (214), Expect = 1.731e-17
Identity = 50/144 (34.72%), Postives = 89/144 (61.81%), Query Frame = -3
Query: 1482 NLGLFIIPI---ITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIY 1904
             + LF++P+   I + GN LV +++  ++RL N  NYFL SLA++DLL   +VMP+S ++ V+  +   W   +CL +   DVF  + +I+H+  ISLDRY  ++ PL+ R      + +++KI   W++   ++CP+ +LA++
Sbjct:    8 GVALFLLPVLCLIGLIGNFLVCVAIATDRRLHNVTNYFLFSLALADLLVCCIVMPLSIVVEVRHGVWT-WSVSMCLLYVYSDVFLCSASIVHMSVISLDRYLGISQPLRTR--NRSKTLIFIKIAIVWVVTLLVSCPIAVLAMH 148          

HSP 2 Score: 59.3066 bits (142), Expect = 7.378e-9
Identity = 29/98 (29.59%), Postives = 50/98 (51.02%), Query Frame = -3
Query:  153 RNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHL-EWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRNNPHNLSS 443
            +++    KA +VL  +F  F +C+ PFF +     F    N  + D +  +  W+GY +S +NP++Y +FN  F+  F R+L   C     + H + S
Sbjct:  314 QDLANEHKATRVLAVVFACFFICWTPFFFINFLIGFGGE-NVQIPDWVASIFLWLGYVSSTINPIIYTVFNKRFRQAFVRILRCQCFHPLRDSHQMYS 410          
BLAST of SMED30006914 vs. Ensembl Celegans
Match: ser-1 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:O17470])

HSP 1 Score: 87.0409 bits (214), Expect = 2.075e-17
Identity = 50/144 (34.72%), Postives = 89/144 (61.81%), Query Frame = -3
Query: 1482 NLGLFIIPI---ITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIY 1904
             + LF++P+   I + GN LV +++  ++RL N  NYFL SLA++DLL   +VMP+S ++ V+  +   W   +CL +   DVF  + +I+H+  ISLDRY  ++ PL+ R      + +++KI   W++   ++CP+ +LA++
Sbjct:   56 GVALFLLPVLCLIGLIGNFLVCVAIATDRRLHNVTNYFLFSLALADLLVCCIVMPLSIVVEVRHGVWT-WSVSMCLLYVYSDVFLCSASIVHMSVISLDRYLGISQPLRTR--NRSKTLIFIKIAIVWVVTLLVSCPIAVLAMH 196          

HSP 2 Score: 59.6918 bits (143), Expect = 6.090e-9
Identity = 29/98 (29.59%), Postives = 50/98 (51.02%), Query Frame = -3
Query:  153 RNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHL-EWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRNNPHNLSS 443
            +++    KA +VL  +F  F +C+ PFF +     F    N  + D +  +  W+GY +S +NP++Y +FN  F+  F R+L   C     + H + S
Sbjct:  362 QDLANEHKATRVLAVVFACFFICWTPFFFINFLIGFGGE-NVQIPDWVASIFLWLGYVSSTINPIIYTVFNKRFRQAFVRILRCQCFHPLRDSHQMYS 458          
BLAST of SMED30006914 vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 77.0258 bits (188), Expect = 1.056e-14
Identity = 56/158 (35.44%), Postives = 93/158 (58.86%), Query Frame = -3
Query: 1503 NTTESEIQSANWINLG--------LFIIPIITICGNVLVALSVHVEKRLQ-NRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNW--PNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACP 1943
            N +ES+ + A  +NLG        +  + ++ I GN+LV ++V+ +++L+  R N+ +VSLAV+D+L   LVMP++    +  +I   W   N +C  W +LDV F   +I+H+C ISLDRYF++ +PL Y   +    R+++ I  SWI+   I  P
Sbjct:    5 NCSESDTKVAC-LNLGEAVLTISSMLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLT----LTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATR-TPLRMFIYIGVSWIVSLLICLP 156          

HSP 2 Score: 63.929 bits (154), Expect = 1.694e-10
Identity = 38/119 (31.93%), Postives = 63/119 (52.94%), Query Frame = -3
Query:  198 FPKYPLKLTDRMKFNNVPLLSMTSK-QSQRFQNHTKRNIR-KSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLH 548
             P+  +K+      N+ P   +T K + ++F    KR ++ K R+A  +LG +   F+L +LPFFL+Y+   F    + +   V +   W+GY  S +NPV+Y +FN  FK    + LH
Sbjct:  277 LPRQGVKIALDTNHNSPPASDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAF---GHEAPPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGLCKQLH 392          
BLAST of SMED30006914 vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 77.7962 bits (190), Expect = 1.134e-14
Identity = 59/156 (37.82%), Postives = 90/156 (57.69%), Query Frame = -3
Query: 1461 INLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANN--WP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILA---IYLDRTNGS 1907
            I L L ++ ++TI GN+LV LSV V KR++   N  L SLA +DLL   +VMP+S +     D+ +N  WP    +C  W + DV     +I++LC ISLDRYFA+ +PLKY R + +     L + A W I F +  P +++    +++D  N +
Sbjct:   74 IALFLVMLILLTIFGNILVVLSVVVYKRMRTFTNILLTSLATADLLVGLIVMPMSLL-----DLLHNHRWPLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLKYPRTRSRKMAAGL-LTAVWAISFVVCSPPWVIPSWNLFIDNNNNT 223          

HSP 2 Score: 64.3142 bits (155), Expect = 1.930e-10
Identity = 43/154 (27.92%), Postives = 74/154 (48.05%), Query Frame = -3
Query:  189 NASTPFLKNKSASIEKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSKQSQRFQ-NHTKRNIRKS---------RKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC--PSCNRSLKDVIRHL-EWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNC 611
            +A TP  KN    +  S      K   +   R++ NN     +  K  + +Q N   + +R S         RKA++ +G +   F++C++PFF++Y+ + F   P     +  +      W+GYS S+LNP++Y ++N  F+  FR LL   C
Sbjct:  400 SADTPVRKNTEVGVAPS----LSKRARQCNARLQPNN-----LLQKAHEHYQINGPGKAVRGSKEKMVYMRERKALKTIGIVVLGFIICWMPFFIMYLVEVFISDPVAESPIYRITSEFFLWLGYSNSVLNPIIYTMYNGDFRRCFRDLLSFGC 544          
BLAST of SMED30006914 vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 77.0258 bits (188), Expect = 1.191e-14
Identity = 56/158 (35.44%), Postives = 93/158 (58.86%), Query Frame = -3
Query: 1503 NTTESEIQSANWINLG--------LFIIPIITICGNVLVALSVHVEKRLQ-NRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNW--PNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACP 1943
            N +ES+ + A  +NLG        +  + ++ I GN+LV ++V+ +++L+  R N+ +VSLAV+D+L   LVMP++    +  +I   W   N +C  W +LDV F   +I+H+C ISLDRYF++ +PL Y   +    R+++ I  SWI+   I  P
Sbjct:    5 NCSESDTKVAC-LNLGEAVLTISSMLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLT----LTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATR-TPLRMFIYIGVSWIVSLLICLP 156          

HSP 2 Score: 61.6178 bits (148), Expect = 8.862e-10
Identity = 36/105 (34.29%), Postives = 58/105 (55.24%), Query Frame = -3
Query:  198 NNVPLLSMTSK-QSQRFQNHTKRNIR-KSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLH 506
            N+ P   +T K + ++F    KR ++ K R+A  +LG +   F+L +LPFFL+Y+   F    + +   V +   W+GY  S +NPV+Y +FN  FK    + LH
Sbjct:  293 NSPPASDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAF---GHEAPPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGLCKQLH 394          
BLAST of SMED30006914 vs. Ensembl Fly
Match: 5-HT2B (gene:FBgn0261929 transcript:FBtr0303603)

HSP 1 Score: 93.9745 bits (232), Expect = 2.146e-19
Identity = 56/128 (43.75%), Postives = 85/128 (66.41%), Query Frame = -3
Query: 1491 TICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFIL 1874
            T  GN+LV L++  E+RLQN  NYFL+SLA++DL+ A LVMP+  + +VK        +E CL W  LDV F   +I+HLCTIS+DRY +L  P+++ R+K +  R+ LKI   W++  +++ PL ++
Sbjct:   87 TAAGNILVCLAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVKGYFPLG--SEHCLTWICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTR-RRVTLKIVFVWLLSIAMSLPLSLM 211          

HSP 2 Score: 69.707 bits (169), Expect = 7.128e-12
Identity = 34/97 (35.05%), Postives = 57/97 (58.76%), Query Frame = -3
Query:  201 SMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKD-VIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLL 488
            S+ S+ S R      R IR  +KA +VLG +F  F++ + PFF++ +    C  C   +   V   + W+GY++SM+NP+ Y IFN +F+  F+++L
Sbjct:  798 SVISRNSSRH----GRIIRLEQKATKVLGVVFFTFVILWSPFFVLNLLPTVCAECEERISHWVFDVVTWLGYASSMVNPIFYTIFNKVFRQAFKKVL 890          
BLAST of SMED30006914 vs. Ensembl Fly
Match: 5-HT2B (gene:FBgn0261929 transcript:FBtr0339322)

HSP 1 Score: 93.9745 bits (232), Expect = 2.146e-19
Identity = 56/128 (43.75%), Postives = 85/128 (66.41%), Query Frame = -3
Query: 1491 TICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFIL 1874
            T  GN+LV L++  E+RLQN  NYFL+SLA++DL+ A LVMP+  + +VK        +E CL W  LDV F   +I+HLCTIS+DRY +L  P+++ R+K +  R+ LKI   W++  +++ PL ++
Sbjct:   87 TAAGNILVCLAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVKGYFPLG--SEHCLTWICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTR-RRVTLKIVFVWLLSIAMSLPLSLM 211          

HSP 2 Score: 69.707 bits (169), Expect = 7.128e-12
Identity = 34/97 (35.05%), Postives = 57/97 (58.76%), Query Frame = -3
Query:  201 SMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKD-VIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLL 488
            S+ S+ S R      R IR  +KA +VLG +F  F++ + PFF++ +    C  C   +   V   + W+GY++SM+NP+ Y IFN +F+  F+++L
Sbjct:  798 SVISRNSSRH----GRIIRLEQKATKVLGVVFFTFVILWSPFFVLNLLPTVCAECEERISHWVFDVVTWLGYASSMVNPIFYTIFNKVFRQAFKKVL 890          
BLAST of SMED30006914 vs. Ensembl Fly
Match: 5-HT2B (gene:FBgn0261929 transcript:FBtr0330144)

HSP 1 Score: 93.9745 bits (232), Expect = 2.356e-19
Identity = 56/128 (43.75%), Postives = 85/128 (66.41%), Query Frame = -3
Query: 1491 TICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFIL 1874
            T  GN+LV L++  E+RLQN  NYFL+SLA++DL+ A LVMP+  + +VK        +E CL W  LDV F   +I+HLCTIS+DRY +L  P+++ R+K +  R+ LKI   W++  +++ PL ++
Sbjct:   87 TAAGNILVCLAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVKGYFPLG--SEHCLTWICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTR-RRVTLKIVFVWLLSIAMSLPLSLM 211          

HSP 2 Score: 69.707 bits (169), Expect = 7.028e-12
Identity = 34/97 (35.05%), Postives = 57/97 (58.76%), Query Frame = -3
Query:  201 SMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKD-VIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLL 488
            S+ S+ S R      R IR  +KA +VLG +F  F++ + PFF++ +    C  C   +   V   + W+GY++SM+NP+ Y IFN +F+  F+++L
Sbjct:  798 SVISRNSSRH----GRIIRLEQKATKVLGVVFFTFVILWSPFFVLNLLPTVCAECEERISHWVFDVVTWLGYASSMVNPIFYTIFNKVFRQAFKKVL 890          
BLAST of SMED30006914 vs. Ensembl Fly
Match: Oct-TyrR (gene:FBgn0004514 transcript:FBtr0078479)

HSP 1 Score: 84.3445 bits (207), Expect = 1.292e-16
Identity = 46/126 (36.51%), Postives = 71/126 (56.35%), Query Frame = -3
Query:  192 EKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGN 569
            E++ +K  P  P   T     +  PL   TS  +Q  +   K ++ K R+A + LG + G+F++C+LPFFL+Y+   FC +C  + K     + W+GY  S LNPV+Y IFN  ++  F+RLL  N
Sbjct:  479 EQTSLKLTP--PQSSTGVAAVSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTCCPTNK-FKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLLGLN 601          

HSP 2 Score: 68.9366 bits (167), Expect = 1.082e-11
Identity = 53/138 (38.41%), Postives = 79/138 (57.25%), Query Frame = -3
Query: 1494 LGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEV--CLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFI 1901
            L L +I ++TI GN+LV LSV   K L+   N+F+VSLAV+DL  A LV+P +    V   I   W   +  C  W + DV    ++I++LC I+LDRY+A+ +P+ Y + K    R+ L I   W++   I+ P  I
Sbjct:  114 LVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFN----VAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQ-KRTVGRVLLLISGVWLLSLLISSPPLI 246          
BLAST of SMED30006914 vs. Ensembl Fly
Match: Oct-TyrR (gene:FBgn0004514 transcript:FBtr0301930)

HSP 1 Score: 84.3445 bits (207), Expect = 1.292e-16
Identity = 46/126 (36.51%), Postives = 71/126 (56.35%), Query Frame = -3
Query:  192 EKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGN 569
            E++ +K  P  P   T     +  PL   TS  +Q  +   K ++ K R+A + LG + G+F++C+LPFFL+Y+   FC +C  + K     + W+GY  S LNPV+Y IFN  ++  F+RLL  N
Sbjct:  479 EQTSLKLTP--PQSSTGVAAVSVTPLQKKTSGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTCCPTNK-FKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRLLGLN 601          

HSP 2 Score: 68.9366 bits (167), Expect = 1.082e-11
Identity = 53/138 (38.41%), Postives = 79/138 (57.25%), Query Frame = -3
Query: 1494 LGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEV--CLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFI 1901
            L L +I ++TI GN+LV LSV   K L+   N+F+VSLAV+DL  A LV+P +    V   I   W   +  C  W + DV    ++I++LC I+LDRY+A+ +P+ Y + K    R+ L I   W++   I+ P  I
Sbjct:  114 LVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFN----VAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQ-KRTVGRVLLLISGVWLLSLLISSPPLI 246          
BLAST of SMED30006914 vs. Ensembl Zebrafish
Match: htr2ab (5-hydroxytryptamine (serotonin) receptor 2A, genome duplicate b [Source:ZFIN;Acc:ZDB-GENE-120215-60])

HSP 1 Score: 103.605 bits (257), Expect = 7.110e-23
Identity = 62/154 (40.26%), Postives = 96/154 (62.34%), Query Frame = -3
Query: 1482 TESEIQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIY 1937
            + S+    NW+ L + ++ IIT+ GN+LV ++V +E++LQN  NYFL SLA++D+L   LVMPV+   MV       WP    +C  W  LDV F+  +I+HLC ISLDRY A+ NP+ + R  +  ++  +KI A+W I   I+ P+ +L ++
Sbjct:   54 SSSDYVQKNWVALLISLVIIITVTGNILVIMAVSLERKLQNATNYFLRSLAITDMLLGILVMPVA---MVTILYGYTWPLPRTLCPIWIYLDVLFSTASIMHLCAISLDRYIAIRNPIHHSRS-NSLTKARVKIIAAWTISVVISMPVPVLGLH 203          

HSP 2 Score: 58.9214 bits (141), Expect = 1.220e-8
Identity = 32/104 (30.77%), Postives = 55/104 (52.88%), Query Frame = -3
Query:  177 TSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPS-CNRSL-KDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSR 482
             S+ S R    + ++I   +KA +VLG +F LF++ + PFF+  +    C S C+  L   ++    WVGY +S +NP +Y +FN  ++  F R +     + R
Sbjct:  293 ASRGSGR---RSMQSISNEQKASKVLGVVFLLFVIMWCPFFVTNVMAVVCGSVCDEDLVGGLMNVFVWVGYLSSAVNPFIYTLFNKTYRAAFARYMQCRYHEER 393          
BLAST of SMED30006914 vs. Ensembl Zebrafish
Match: htr2cl1 (5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled-like 1 [Source:ZFIN;Acc:ZDB-GENE-081104-48])

HSP 1 Score: 95.9005 bits (237), Expect = 3.474e-20
Identity = 73/177 (41.24%), Postives = 107/177 (60.45%), Query Frame = -3
Query: 1401 EIQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKG-CGPQSALFILTAVIVTF 1928
            E++  NW  L + +I I+TI GN+LV L+V +EK+LQN  N+FL SLAV+D+L   LVMP+S ++ +  D A   P+ +C  W  LDV F+  +I+HLC ISLDRY A+ NP+++ R   ++  + LKI A W I   I+ P+ ++ +  +R      G C     LFIL    V F
Sbjct:   64 EMKEKNWPALLILVIIILTIGGNILVILAVSLEKKLQNATNFFLRSLAVADMLVGILVMPIS-LINILYDYAWPLPSALCPIWIYLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAM-LKIAAVWTISIGISMPIPVIGLS-NREKVLKNGICALNEELFILVGSFVAF 237          

HSP 2 Score: 61.2326 bits (147), Expect = 2.633e-9
Identity = 33/95 (34.74%), Postives = 53/95 (55.79%), Query Frame = -3
Query:  186 HTKRN----IRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNRSL-KDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQ 452
            H +R     I+  R+A +VLG +F LFL  + PFF+  +    C  +C  +L  +++    WVGY +S +NP+VY +FN  ++  F   +H  CQ
Sbjct:  342 HGRRGMMQAIKNERRASKVLGVVFFLFLFMWCPFFITNVLYVLCHRTCKETLLTELLNVFVWVGYISSGVNPLVYTLFNKTYRRAFSNYMH--CQ 434          
BLAST of SMED30006914 vs. Ensembl Zebrafish
Match: htr2cl1 (5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled-like 1 [Source:ZFIN;Acc:ZDB-GENE-081104-48])

HSP 1 Score: 95.9005 bits (237), Expect = 3.474e-20
Identity = 73/177 (41.24%), Postives = 107/177 (60.45%), Query Frame = -3
Query: 1401 EIQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKG-CGPQSALFILTAVIVTF 1928
            E++  NW  L + +I I+TI GN+LV L+V +EK+LQN  N+FL SLAV+D+L   LVMP+S ++ +  D A   P+ +C  W  LDV F+  +I+HLC ISLDRY A+ NP+++ R   ++  + LKI A W I   I+ P+ ++ +  +R      G C     LFIL    V F
Sbjct:   64 EMKEKNWPALLILVIIILTIGGNILVILAVSLEKKLQNATNFFLRSLAVADMLVGILVMPIS-LINILYDYAWPLPSALCPIWIYLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAM-LKIAAVWTISIGISMPIPVIGLS-NREKVLKNGICALNEELFILVGSFVAF 237          

HSP 2 Score: 61.2326 bits (147), Expect = 2.633e-9
Identity = 33/95 (34.74%), Postives = 53/95 (55.79%), Query Frame = -3
Query:  186 HTKRN----IRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNRSL-KDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQ 452
            H +R     I+  R+A +VLG +F LFL  + PFF+  +    C  +C  +L  +++    WVGY +S +NP+VY +FN  ++  F   +H  CQ
Sbjct:  342 HGRRGMMQAIKNERRASKVLGVVFFLFLFMWCPFFITNVLYVLCHRTCKETLLTELLNVFVWVGYISSGVNPLVYTLFNKTYRRAFSNYMH--CQ 434          
BLAST of SMED30006914 vs. Ensembl Zebrafish
Match: htr2cl1 (5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled-like 1 [Source:ZFIN;Acc:ZDB-GENE-081104-48])

HSP 1 Score: 95.9005 bits (237), Expect = 3.486e-20
Identity = 73/177 (41.24%), Postives = 107/177 (60.45%), Query Frame = -3
Query: 1401 EIQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKG-CGPQSALFILTAVIVTF 1928
            E++  NW  L + +I I+TI GN+LV L+V +EK+LQN  N+FL SLAV+D+L   LVMP+S ++ +  D A   P+ +C  W  LDV F+  +I+HLC ISLDRY A+ NP+++ R   ++  + LKI A W I   I+ P+ ++ +  +R      G C     LFIL    V F
Sbjct:   63 EMKEKNWPALLILVIIILTIGGNILVILAVSLEKKLQNATNFFLRSLAVADMLVGILVMPIS-LINILYDYAWPLPSALCPIWIYLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAM-LKIAAVWTISIGISMPIPVIGLS-NREKVLKNGICALNEELFILVGSFVAF 236          

HSP 2 Score: 61.2326 bits (147), Expect = 2.698e-9
Identity = 33/95 (34.74%), Postives = 53/95 (55.79%), Query Frame = -3
Query:  186 HTKRN----IRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNRSL-KDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQ 452
            H +R     I+  R+A +VLG +F LFL  + PFF+  +    C  +C  +L  +++    WVGY +S +NP+VY +FN  ++  F   +H  CQ
Sbjct:  341 HGRRGMMQAIKNERRASKVLGVVFFLFLFMWCPFFITNVLYVLCHRTCKETLLTELLNVFVWVGYISSGVNPLVYTLFNKTYRRAFSNYMH--CQ 433          
BLAST of SMED30006914 vs. Ensembl Zebrafish
Match: htr2aa (5-hydroxytryptamine (serotonin) receptor 2A, genome duplicate a [Source:ZFIN;Acc:ZDB-GENE-070912-500])

HSP 1 Score: 93.5893 bits (231), Expect = 8.391e-20
Identity = 69/168 (41.07%), Postives = 100/168 (59.52%), Query Frame = -3
Query: 1401 GNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILA------IYLDR----TNGSYKGCGPQSALFI-LTAVIVTF 1865
            GN+LV ++V++E++LQN  NYFL+SLAV+D+L   LVMPVS   MV      +WP    +C  W  LDV F+  +I+HLC ISLDRY A+ NP+++ R   + SR   KI A W I   I+ P+ +L       ++ D     T+ S+   G   A F+ LT ++VT+
Sbjct:   21 GNILVIMAVNLERKLQNATNYFLMSLAVADMLLGLLVMPVS---MVTIVYGYSWPFPASLCPMWIYLDVLFSTASIMHLCAISLDRYVAIRNPIRHNRSNSR-SRARAKITAVWTISAGISMPIPVLGLRDHTKVFKDGSCLLTDNSFVLIGSFVAFFVPLTIMVVTY 184          

HSP 2 Score: 62.3882 bits (150), Expect = 9.159e-10
Identity = 32/95 (33.68%), Postives = 55/95 (57.89%), Query Frame = -3
Query:  186 FQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCP--SCNRSLKD-VIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQ 461
            F  H  ++I   +KA +VLG +F LF++ + PFF+  +    C   +CN ++ + ++    WVGY +S +NP+VY +FN  ++  F R +   CQ
Sbjct:  250 FGRHNMQSISNEQKASKVLGVVFFLFVVMWCPFFITNVLAVVCEPNACNANIMNRLLNVFVWVGYLSSAVNPLVYTLFNKTYRSAFARYIR--CQ 342          
BLAST of SMED30006914 vs. Ensembl Xenopus
Match: slc25a29 (solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 [Source:Xenbase;Acc:XB-GENE-5763797])

HSP 1 Score: 101.293 bits (251), Expect = 4.951e-22
Identity = 68/175 (38.86%), Postives = 99/175 (56.57%), Query Frame = -3
Query: 1401 NWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANN--WP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTF 1913
            NW  L    + ++TI GN+LV ++V +EK+LQN  NYFL+SLA++D+L   LVMPVS +     +I N+  WP   ++C  W  LDV F+  +I+HLC ISLDRY A+ NP+ + R   ++  L  KI A W I   I+ P+ +  +  D      + C      FI+    V F
Sbjct:   59 NWPALLTVTVILVTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSML-----NILNDYEWPLHRKLCPVWIYLDVLFSTASIMHLCAISLDRYIAIRNPIHHSRFNSRTKALA-KIIAVWTISVGISMPVPVFGLQDDSKVFDQENCSLSDENFIIIGSFVAF 227          

HSP 2 Score: 65.855 bits (159), Expect = 1.127e-10
Identity = 31/95 (32.63%), Postives = 56/95 (58.95%), Query Frame = -3
Query:  198 KQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNR-SLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLH 476
            K+   +   T ++I   +KA +VLG +F LF++ + PFF+  +   FC  SCN   + ++++   W+GY +S +NP+VY +FN  ++  F R + 
Sbjct:  285 KELAPYGRKTMQSISNEQKASKVLGIVFFLFVIMWCPFFITNVMAVFCKESCNEHVIGELLKVFVWIGYLSSAVNPLVYTLFNQTYRSAFSRYIQ 379          
BLAST of SMED30006914 vs. Ensembl Xenopus
Match: slc25a29 (solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 [Source:Xenbase;Acc:XB-GENE-5763797])

HSP 1 Score: 101.679 bits (252), Expect = 5.242e-22
Identity = 68/175 (38.86%), Postives = 99/175 (56.57%), Query Frame = -3
Query: 1401 NWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANN--WP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTF 1913
            NW  L    + ++TI GN+LV ++V +EK+LQN  NYFL+SLA++D+L   LVMPVS +     +I N+  WP   ++C  W  LDV F+  +I+HLC ISLDRY A+ NP+ + R   ++  L  KI A W I   I+ P+ +  +  D      + C      FI+    V F
Sbjct:   88 NWPALLTVTVILVTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSML-----NILNDYEWPLHRKLCPVWIYLDVLFSTASIMHLCAISLDRYIAIRNPIHHSRFNSRTKALA-KIIAVWTISVGISMPVPVFGLQDDSKVFDQENCSLSDENFIIIGSFVAF 256          

HSP 2 Score: 65.855 bits (159), Expect = 1.354e-10
Identity = 31/92 (33.70%), Postives = 55/92 (59.78%), Query Frame = -3
Query:  207 KQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNR-SLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRR 476
            K+   +   T ++I   +KA +VLG +F LF++ + PFF+  +   FC  SCN   + ++++   W+GY +S +NP+VY +FN  ++  F R
Sbjct:  314 KELAPYGRKTMQSISNEQKASKVLGIVFFLFVIMWCPFFITNVMAVFCKESCNEHVIGELLKVFVWIGYLSSAVNPLVYTLFNQTYRSAFSR 405          
BLAST of SMED30006914 vs. Ensembl Xenopus
Match: slc25a29 (solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 [Source:Xenbase;Acc:XB-GENE-5763797])

HSP 1 Score: 101.293 bits (251), Expect = 5.555e-22
Identity = 68/175 (38.86%), Postives = 99/175 (56.57%), Query Frame = -3
Query: 1401 NWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANN--WP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTF 1913
            NW  L    + ++TI GN+LV ++V +EK+LQN  NYFL+SLA++D+L   LVMPVS +     +I N+  WP   ++C  W  LDV F+  +I+HLC ISLDRY A+ NP+ + R   ++  L  KI A W I   I+ P+ +  +  D      + C      FI+    V F
Sbjct:   66 NWPALLTVTVILVTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSML-----NILNDYEWPLHRKLCPVWIYLDVLFSTASIMHLCAISLDRYIAIRNPIHHSRFNSRTKALA-KIIAVWTISVGISMPVPVFGLQDDSKVFDQENCSLSDENFIIIGSFVAF 234          

HSP 2 Score: 65.855 bits (159), Expect = 1.160e-10
Identity = 31/95 (32.63%), Postives = 56/95 (58.95%), Query Frame = -3
Query:  198 KQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNR-SLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLH 476
            K+   +   T ++I   +KA +VLG +F LF++ + PFF+  +   FC  SCN   + ++++   W+GY +S +NP+VY +FN  ++  F R + 
Sbjct:  292 KELAPYGRKTMQSISNEQKASKVLGIVFFLFVIMWCPFFITNVMAVFCKESCNEHVIGELLKVFVWIGYLSSAVNPLVYTLFNQTYRSAFSRYIQ 386          
BLAST of SMED30006914 vs. Ensembl Xenopus
Match: slc25a29 (solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 [Source:Xenbase;Acc:XB-GENE-5763797])

HSP 1 Score: 101.293 bits (251), Expect = 5.650e-22
Identity = 68/175 (38.86%), Postives = 99/175 (56.57%), Query Frame = -3
Query: 1401 NWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANN--WP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTF 1913
            NW  L    + ++TI GN+LV ++V +EK+LQN  NYFL+SLA++D+L   LVMPVS +     +I N+  WP   ++C  W  LDV F+  +I+HLC ISLDRY A+ NP+ + R   ++  L  KI A W I   I+ P+ +  +  D      + C      FI+    V F
Sbjct:   68 NWPALLTVTVILVTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSML-----NILNDYEWPLHRKLCPVWIYLDVLFSTASIMHLCAISLDRYIAIRNPIHHSRFNSRTKALA-KIIAVWTISVGISMPVPVFGLQDDSKVFDQENCSLSDENFIIIGSFVAF 236          

HSP 2 Score: 66.2402 bits (160), Expect = 1.117e-10
Identity = 31/95 (32.63%), Postives = 56/95 (58.95%), Query Frame = -3
Query:  198 KQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNR-SLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLH 476
            K+   +   T ++I   +KA +VLG +F LF++ + PFF+  +   FC  SCN   + ++++   W+GY +S +NP+VY +FN  ++  F R + 
Sbjct:  294 KELAPYGRKTMQSISNEQKASKVLGIVFFLFVIMWCPFFITNVMAVFCKESCNEHVIGELLKVFVWIGYLSSAVNPLVYTLFNQTYRSAFSRYIQ 388          
BLAST of SMED30006914 vs. Ensembl Xenopus
Match: HTR2C (5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled [Source:NCBI gene;Acc:100496012])

HSP 1 Score: 95.5153 bits (236), Expect = 4.256e-20
Identity = 62/155 (40.00%), Postives = 93/155 (60.00%), Query Frame = -3
Query: 1401 GNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTF 1865
            GN+LV ++V +EK+LQN  N+FL+SLAV+D+L   LVMPVS ++ +  D A   P ++C  W SLDV F+  +I+HLC ISLDRY A+ NP+++ R   ++  + +KI A W I   I+ P+ ++ +  D        C      F+L    V F
Sbjct:   84 GNILVIMAVSLEKKLQNATNFFLMSLAVADMLVGILVMPVS-LVTILYDYAWPLPRKLCPIWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAM-MKIAAVWTISIGISMPVPVIGLQDDSRVFVNSSCVLNDENFVLLGSFVAF 236          

HSP 2 Score: 67.0106 bits (162), Expect = 6.208e-11
Identity = 34/99 (34.34%), Postives = 56/99 (56.57%), Query Frame = -3
Query:  186 KQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSC-NRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQ 476
            K+   F+  T ++I   R+A +VLG +F LFL+ + PFF+  I    C  +C N  + +++    WVGY +S +NP+VY +FN  ++  F   +   CQ
Sbjct:  304 KEGALFRKGTMQSINNERRASKVLGIVFFLFLIMWCPFFITNIMSVLCKEACDNELMVELLNVFVWVGYVSSGINPLVYTLFNRTYRRAFASYIR--CQ 400          
BLAST of SMED30006914 vs. Ensembl Mouse
Match: Htr2a (5-hydroxytryptamine (serotonin) receptor 2A [Source:MGI Symbol;Acc:MGI:109521])

HSP 1 Score: 107.457 bits (267), Expect = 4.827e-24
Identity = 68/177 (38.42%), Postives = 102/177 (57.63%), Query Frame = -3
Query: 1401 IQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTF 1925
            +Q  NW  L   ++ I+TI GN+LV ++V +EK+LQN  NYFL+SLA++D+L   LVMPVS + ++       WP  +++C  W  LDV F+  +I+HLC ISLDRY A+ NP+ + R   + ++ +LKI A W I   I+ P+ +  +  D        C      F+L    V F
Sbjct:   71 LQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYG---YRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSR-TKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSFVAF 243          

HSP 2 Score: 65.0846 bits (157), Expect = 1.724e-10
Identity = 44/149 (29.53%), Postives = 74/149 (49.66%), Query Frame = -3
Query:  174 SIEKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSKQSQR-FQN------------HTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNRSLKDVIRHL-EWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRN 575
            S++K    C       L+ R K ++   L  +S  S++ FQ              T ++I   +KA +VLG +F LF++ + PFF+  I    C  SCN ++   + ++  W+GY +S +NP+VY +FN  ++  F R +   CQ   N
Sbjct:  260 SLQKEATLCVSD----LSTRAKLSSFSFLPQSSLSSEKLFQRSIHREPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQ--CQYKEN 402          
BLAST of SMED30006914 vs. Ensembl Mouse
Match: Htr2b (5-hydroxytryptamine (serotonin) receptor 2B [Source:MGI Symbol;Acc:MGI:109323])

HSP 1 Score: 104.375 bits (259), Expect = 4.188e-23
Identity = 73/196 (37.24%), Postives = 109/196 (55.61%), Query Frame = -3
Query: 1401 KNTTESEIQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTN-------------GSYKGCGPQSALFI-LTAVIVTF 1946
            K T E +  + +W  L +  + I TI GN+LV L+V +EKRLQ   NYFL+SLA++DLL    VMP+ A++ +  +     P  +C AW  LDV F+  +I+HLC ISLDRY A+  P++  +   +++  ++KI   W+I   IA P+ I  I  D  N             GS+   G  +A F  LT ++VT+
Sbjct:   43 KQTVEGQGHTVHWAALLILAVIIPTIGGNILVILAVALEKRLQYATNYFLMSLAIADLLVGLFVMPI-ALLTIMFEAIWPLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQANQCNSRATA-FIKITVVWLISIGIAIPVPIKGIETDVINPHNVTCELTKDRFGSFMVFGSLAAFFAPLTIMVVTY 236          

HSP 2 Score: 67.3958 bits (163), Expect = 3.531e-11
Identity = 31/93 (33.33%), Postives = 56/93 (60.22%), Query Frame = -3
Query:  174 TKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRS-LKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRN 449
            + + I   ++A + LG +F LFLL + PFF+  +    C SCN++ LK ++    W+GY +S +NP++Y +FN  F+  F R +  N + +++
Sbjct:  311 SAQTISNEQRASKALGVVFFLFLLMWCPFFITNLTLALCDSCNQTTLKTLLEIFVWIGYVSSGVNPLIYTLFNKTFREAFGRYITCNYRATKS 403          
BLAST of SMED30006914 vs. Ensembl Mouse
Match: Htr2c (5-hydroxytryptamine (serotonin) receptor 2C [Source:MGI Symbol;Acc:MGI:96281])

HSP 1 Score: 98.2117 bits (243), Expect = 3.994e-21
Identity = 58/143 (40.56%), Postives = 92/143 (64.34%), Query Frame = -3
Query: 1485 NWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAI 1913
            NW  L + +I I+TI GN+LV ++V +EK+L N  NYFL+SLA++D+L   LVMP+S ++ +  D     P  +C  W SLDV F+  +I+HLC ISLDRY A+ NP+++ R   ++  + +KI   W I   ++ P+ ++ +
Sbjct:   55 NWPALSIVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLS-LLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAI-MKIAIVWAISIGVSVPIPVIGL 195          

HSP 2 Score: 64.3142 bits (155), Expect = 2.920e-10
Identity = 32/96 (33.33%), Postives = 55/96 (57.29%), Query Frame = -3
Query:  168 TKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCP-SCNRSLKD-VIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRNNP 449
            T + I   +KA +VLG +F +FL+ + PFF+  I    C  +CN+ L + ++    W+GY  S +NP+VY +FN I++  F + L  + +  +  P
Sbjct:  300 TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPP 395          
BLAST of SMED30006914 vs. Ensembl Mouse
Match: Htr2c (5-hydroxytryptamine (serotonin) receptor 2C [Source:MGI Symbol;Acc:MGI:96281])

HSP 1 Score: 98.2117 bits (243), Expect = 3.994e-21
Identity = 58/143 (40.56%), Postives = 92/143 (64.34%), Query Frame = -3
Query: 1485 NWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAI 1913
            NW  L + +I I+TI GN+LV ++V +EK+L N  NYFL+SLA++D+L   LVMP+S ++ +  D     P  +C  W SLDV F+  +I+HLC ISLDRY A+ NP+++ R   ++  + +KI   W I   ++ P+ ++ +
Sbjct:   55 NWPALSIVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLS-LLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAI-MKIAIVWAISIGVSVPIPVIGL 195          

HSP 2 Score: 64.3142 bits (155), Expect = 2.920e-10
Identity = 32/96 (33.33%), Postives = 55/96 (57.29%), Query Frame = -3
Query:  168 TKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCP-SCNRSLKD-VIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRNNP 449
            T + I   +KA +VLG +F +FL+ + PFF+  I    C  +CN+ L + ++    W+GY  S +NP+VY +FN I++  F + L  + +  +  P
Sbjct:  300 TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPP 395          
BLAST of SMED30006914 vs. Ensembl Mouse
Match: Htr2c (5-hydroxytryptamine (serotonin) receptor 2C [Source:MGI Symbol;Acc:MGI:96281])

HSP 1 Score: 83.5741 bits (205), Expect = 4.012e-18
Identity = 53/119 (44.54%), Postives = 77/119 (64.71%), Query Frame = -3
Query: 1557 NWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSR 1913
            NW  L + +I I+TI GN+LV ++V +EK+L N  NYFL+SLA++D+L   LVMP+S ++ +  D     P  +C  W SLDV F+  +I+HLC ISLDR F+ + P  +   + QS R
Sbjct:   55 NWPALSIVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLS-LLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRSFS-SYPCDWTEGRKQSVR 171          
BLAST of SMED30006914 vs. UniProt
Match: sp|P50129|5HT2A_PIG (5-hydroxytryptamine receptor 2A OS=Sus scrofa OX=9823 GN=HTR2A PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.579e-24
Identity = 69/177 (38.98%), Postives = 104/177 (58.76%), Query Frame = -3
Query: 1401 IQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTF 1925
            +Q  NW  L   ++ I+TI GN+LV ++V +EK+LQN  NYFL+SLA++D+L   LVMPVS + ++       WP  +++C  W  LDV F+  +I+HLC ISLDRY A+ NP+ +RR   + ++ +LKI A W I   I+ P+ +  +  D        C      F+L    V+F
Sbjct:   71 LQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYG---YRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHRRFNSR-TKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSFVSF 243          

HSP 2 Score: 66.2402 bits (160), Expect = 5.246e-10
Identity = 37/106 (34.91%), Postives = 58/106 (54.72%), Query Frame = -3
Query:  174 KQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNRSLKDVIRHL----EWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRN 476
            ++   +   T ++I   +KA +VLG +F LF++ + PFF+  I    C  SCN   +DVI  L     W+GY +S +NP+VY +FN  ++  F R +   CQ   N
Sbjct:  301 REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCN---EDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQ--CQYKEN 401          
BLAST of SMED30006914 vs. UniProt
Match: sp|Q75Z89|5HT2A_BOVIN (5-hydroxytryptamine receptor 2A OS=Bos taurus OX=9913 GN=HTR2A PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.533e-23
Identity = 68/177 (38.42%), Postives = 102/177 (57.63%), Query Frame = -3
Query: 1401 IQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTF 1925
            +Q  NW  L   ++ I+TI GN+LV ++V +EK+LQN  NYFL+SLA++D+L   LVMPVS + ++       WP  +++C  W  LDV F+  +I+HLC ISLDRY A+ NP+ + R   + ++ +LKI A W I   I+ P+ +  +  D        C      F+L    V F
Sbjct:   71 LQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSTLTILYG---YRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSR-TKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADENFVLIGSFVAF 243          

HSP 2 Score: 68.9366 bits (167), Expect = 8.144e-11
Identity = 47/148 (31.76%), Postives = 73/148 (49.32%), Query Frame = -3
Query:  174 SIEKSPIKCFPKYPLKLTDRMKFNNVPLLSMTS---------KQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNRSLKDVIRHL----EWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRN 575
            S++K    C    P   T    F+ +P  S++S         ++   +   T ++I   +KA +VLG +F LF++ + PFF+  I    C  SCNR   DVI  L     W+GY +S +NP+VY +FN  ++  F R +   CQ   N
Sbjct:  260 SLQKEATLCVSD-PGTRTKLASFSFLPQSSLSSEKLFQRSIHREPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNR---DVIEALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQ--CQYKEN 401          
BLAST of SMED30006914 vs. UniProt
Match: sp|Q5R4Q6|5HT2A_PONPY (5-hydroxytryptamine receptor 2A OS=Pongo pygmaeus OX=9600 GN=HTR2A PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.649e-23
Identity = 68/177 (38.42%), Postives = 103/177 (58.19%), Query Frame = -3
Query: 1401 IQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTF 1925
            +Q  NW  L   ++ I+TI GN+LV ++V +EK+LQN  NYFL+SLA++D+L   LVMPVS + ++       WP  +++C  W  LDV F+  +I+HLC ISLDRY A+ NP+ + R   + ++ +LKI A W I   I+ P+ +  +  D        C      F+L    V+F
Sbjct:   71 LQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYG---YRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSR-TKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSFVSF 243          

HSP 2 Score: 67.3958 bits (163), Expect = 2.503e-10
Identity = 53/172 (30.81%), Postives = 77/172 (44.77%), Query Frame = -3
Query:  174 TIEQNHTLVSQDSLSLNYRPLNASTPFLKNKSASIEKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNRSLKDVIRHL----EWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRN 674
            ++++  TL   D   L  R   AS  FL   S S EK   +   + P   T R                      T ++I   +KA +VLG +F LF++ + PFF+  I    C  SCN   +DVI  L     W+GY +S +NP+VY +FN  ++  F R +   CQ   N
Sbjct:  260 SLQKEATLCVSD---LGTRAKLASFSFLPQSSLSSEKLFQRSIHREPGSYTGR---------------------RTMQSISNEQKACKVLGIVFSLFVVMWCPFFITNIMAVICKESCN---EDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQ--CQYKEN 402          
BLAST of SMED30006914 vs. UniProt
Match: sp|P50128|5HT2A_MACMU (5-hydroxytryptamine receptor 2A OS=Macaca mulatta OX=9544 GN=HTR2A PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.649e-23
Identity = 68/177 (38.42%), Postives = 103/177 (58.19%), Query Frame = -3
Query: 1401 IQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTF 1925
            +Q  NW  L   ++ I+TI GN+LV ++V +EK+LQN  NYFL+SLA++D+L   LVMPVS + ++       WP  +++C  W  LDV F+  +I+HLC ISLDRY A+ NP+ + R   + ++ +LKI A W I   I+ P+ +  +  D        C      F+L    V+F
Sbjct:   71 LQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYG---YRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSR-TKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSFVSF 243          

HSP 2 Score: 65.4698 bits (158), Expect = 8.140e-10
Identity = 37/98 (37.76%), Postives = 55/98 (56.12%), Query Frame = -3
Query:  174 HTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNRSLKDVIRHL----EWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRN 452
             T ++I   +KA +VLG +F LF++ + PFF+  I    C  SCN   +DVI  L     W+GY +S +NP+VY +FN  ++  F R +   CQ   N
Sbjct:  310 RTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCN---EDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQ--CQYKEN 402          
BLAST of SMED30006914 vs. UniProt
Match: sp|P28223|5HT2A_HUMAN (5-hydroxytryptamine receptor 2A OS=Homo sapiens OX=9606 GN=HTR2A PE=1 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 1.649e-23
Identity = 68/177 (38.42%), Postives = 103/177 (58.19%), Query Frame = -3
Query: 1401 IQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTF 1925
            +Q  NW  L   ++ I+TI GN+LV ++V +EK+LQN  NYFL+SLA++D+L   LVMPVS + ++       WP  +++C  W  LDV F+  +I+HLC ISLDRY A+ NP+ + R   + ++ +LKI A W I   I+ P+ +  +  D        C      F+L    V+F
Sbjct:   71 LQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYG---YRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSR-TKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSFVSF 243          

HSP 2 Score: 65.855 bits (159), Expect = 6.544e-10
Identity = 53/172 (30.81%), Postives = 77/172 (44.77%), Query Frame = -3
Query:  174 TIEQNHTLVSQDSLSLNYRPLNASTPFLKNKSASIEKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNRSLKDVIRHL----EWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRN 674
            ++++  TL   D   L  R   AS  FL   S S EK   +   + P   T R                      T ++I   +KA +VLG +F LF++ + PFF+  I    C  SCN   +DVI  L     W+GY +S +NP+VY +FN  ++  F R +   CQ   N
Sbjct:  260 SLQKEATLCVSD---LGTRAKLASFSFLPQSSLSSEKLFQRSIHREPGSYTGR---------------------RTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCN---EDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQ--CQYKEN 402          
BLAST of SMED30006914 vs. TrEMBL
Match: gnl|BL_ORD_ID|20300671 (tr|A0A193KUM1|A0A193KUM1_SCHMD GCR037 OS=Schmidtea mediterranea OX=79327 GN=gcr037 PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 2.213e-59
Identity = 130/213 (61.03%), Postives = 165/213 (77.46%), Query Frame = -3
Query: 1293 QSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTN---GSYKGCGPQSALFILTAVIVTFVXXXXXXXXXXXXTVHTIIVQTRRFDEMMINNPIKS 1922
            +   W  L L +IPIITI GN+LV +SV++EKRLQNRFNYFLVSLAVSD L A LVMPVS + MV  D+ N WP+++CLAW+SLDVFFTATTIIHLCTIS+DRY ALNNPL++ + K + S L++KI  SW+IPF IACPLF+ ++ ++  N    S+KGCGP +A+FI+TAVIVTF++PL+IM+I+YILTV TI  QT+  D    N   KS
Sbjct:   25 KDVKWAFLFLLLIPIITIFGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYS-LFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKS 236          

HSP 2 Score: 125.946 bits (315), Expect = 8.416e-27
Identity = 62/112 (55.36%), Postives = 78/112 (69.64%), Query Frame = -3
Query:  174 NVPLLSMTSKQSQRF--QNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRN 503
            NV L S  S  S+R    + + R I+KSRKAVQVLG +FGLF+ CY+PFF++Y+ DFFC SC      +I + EW+GYSASM+NPVVYHIFNP F+ TF RL+   C K  N
Sbjct:  356 NVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKVSN 467          
BLAST of SMED30006914 vs. TrEMBL
Match: gnl|BL_ORD_ID|20343537 (tr|A0A193KU74|A0A193KU74_SCHMD GCR027 OS=Schmidtea mediterranea OX=79327 GN=gcr027 PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 3.222e-46
Identity = 145/343 (42.27%), Postives = 196/343 (57.14%), Query Frame = -3
Query:  909 NWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRT--NGSYKGCGPQSALFILTAVIVTFVXXXXXXXXXXXXTVHTIIVQTRRFDEMMINNPIKS----PALSKFEFFSHSKTKRNMCVQNGSCDTSLEG--SNSSYHYSEKYELKPMINMNGKPYKSSKERKCFPQSTFSLVKMNSDENYELDSKKTLKLQNIFHSYDEENYIKTLDTLYRPRSSIDFNTQHLCSSYY 1913
            NW  +GLFIIP++++ GN LV +SV VE  L+ RFNYFLVSLA+SD L A LVMP+SA  M+         ++ CL W+SLDVFFTA+TIIHLCTIS+DRY AL NPLK    K   S L +++  +WIIPFSIACPLF+ A+ LD+T  + S+KGCGPQ+A FIL A IVTF IPLIIM +TY+LTV  + VQ +  +  + +N + S    P LS     S +K  R    +  S +  L G   NSS  +        ++N     +K ++    F  +   L K   +   E  S       N+     E+ Y +TL     P+  + F  Q    ++Y
Sbjct:   18 NWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRS-LVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSS----SLAKFTRTPSTKVMS-EKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPL-LAKTTRNNFVENTSMNLCGSDNLKPPLQEDQYKQTL-----PQRQVSFREQQKTKNHY 348          

HSP 2 Score: 108.612 bits (270), Expect = 5.499e-21
Identity = 64/209 (30.62%), Postives = 113/209 (54.07%), Query Frame = -3
Query:  183 YDETRALDRPEMLHLPTEQT-NHFTDESEKNQVSAETLTVTIEQNH--TLVSQDSLSLNYRPLNASTPFLKNKSASIEKSPIKCFP-KYPLKLTDRMKFNNVPLLSMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRS--LKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQK 791
            + ET   +  EM  L  + T N+F + +  N   ++ L   ++++     + Q  +S   +    +  +  N   ++ ++P+     +   K++++ K +         K++++      + I +SRKAVQ LG LF LF++CYLPFF+ Y+ DFF   C+ S   + ++  LEW+GYS SM NP+VYH FNPIF+ T++RL+   C +
Sbjct:  281 FKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPPLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYTKKKETEK----QLKQINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYR 485          
BLAST of SMED30006914 vs. TrEMBL
Match: gnl|BL_ORD_ID|18467494 (tr|A0A0K0PUK1|A0A0K0PUK1_PLADU Orphan G-protein coupled receptor 55 OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 6.640e-36
Identity = 105/214 (49.07%), Postives = 144/214 (67.29%), Query Frame = -3
Query: 1305 NTTESEIQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIAN-NWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTFVXXXXXXXXXXXXTVHTIIVQTRRFDEMMINN 1943
            N T  E  S NW  L  F I ++ + GNVLV L+V  E++LQN FNYFLVSLA+SD+LSATLVMP+S   ++KA I     P  +C+AW+SLDV FT++TIIHLC IS+DRY +L  PLKY   K ++    +KI   WI+ FSIA PLF+ +++ ++ +  YKGCGP++  F+L+A I +F +PL IM I YILTV  +  Q +    + +NN
Sbjct:   34 NATAKEQPSYNWPVLCFFTIVVLAMAGNVLVCLAVKFERKLQNMFNYFLVSLALSDMLSATLVMPLS---IIKAFIDELPVPKLMCVAWYSLDVLFTSSTIIHLCMISIDRYMSLKYPLKYGHAK-KTKHTVMKIVIVWILSFSIAGPLFLFSMFDNQEDVYYKGCGPETTTFVLSATISSFYLPLFIMTIMYILTVKALHAQRKTQQRLAVNN 243          

HSP 2 Score: 97.8265 bits (242), Expect = 1.113e-17
Identity = 42/92 (45.65%), Postives = 60/92 (65.22%), Query Frame = -3
Query:  177 TKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLK-DVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSR 449
            T+ ++ K R+AVQVLG LF +F++ YLPFF  Y  +  C  C   +   +I   EW+ YS SM+NP++YHIFNP F+  F ++LH  C +SR
Sbjct:  365 TRSSLDKGRRAVQVLGILFAVFVVFYLPFFATYTINATCTKCQAFISPQMIMAFEWLAYSGSMVNPIIYHIFNPDFRRAFHKILHCKCSRSR 456          
BLAST of SMED30006914 vs. TrEMBL
Match: gnl|BL_ORD_ID|15727900 (tr|R7UD50|R7UD50_CAPTE G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_43688 PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 8.872e-33
Identity = 86/175 (49.14%), Postives = 121/175 (69.14%), Query Frame = -3
Query: 1401 NWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNG--SYKGCGPQSALFILTAVIVTF 1913
            NW  L LF+I +  I GN+LV L+V  E++LQ+ FN+FLVSLA+SD+LSATLVMP+S   +VK+ IA+  P    +C+AW+SLDV  T++TIIHLC IS+DRY +L  PL+Y   K    +   KI   W+I F IA PLF+ ++ LD T    +YKGCGP++  F+++A + +F
Sbjct:    5 NWAVLFLFLIVVAAIGGNILVCLAVRQERKLQSMFNFFLVSLALSDMLSATLVMPLS---IVKSLIADQLPVPKLMCVAWYSLDVLLTSSTIIHLCMISIDRYMSLKFPLRYGHAKRSCKQTLFKILLVWVISFCIAGPLFLFSM-LDTTQSAVAYKGCGPETPAFVISATVTSF 175          

HSP 2 Score: 90.5077 bits (223), Expect = 7.062e-16
Identity = 40/78 (51.28%), Postives = 55/78 (70.51%), Query Frame = -3
Query:  201 KSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKD-VIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLL 431
            + R+AVQVLG LF +F++CYLPFFL Y+    C SC   +   +I   EW+ YS S++NP++YHIFNP F+  F+RLL
Sbjct:  247 RRRRAVQVLGILFAVFVICYLPFFLTYVIKGTCRSCEPYISPRMIMAFEWLAYSGSVINPIIYHIFNPDFRRAFQRLL 324          
BLAST of SMED30006914 vs. TrEMBL
Match: gnl|BL_ORD_ID|21424449 (tr|A0A1S8WK07|A0A1S8WK07_9TREM 7 transmembrane receptor (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_09436 PE=3 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.759e-32
Identity = 92/186 (49.46%), Postives = 118/186 (63.44%), Query Frame = -3
Query: 1398 LGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQS-SRLYLKIFASWIIPFSIACPLFILAIYLDR-----------------TNGSYKGCGPQSALFILTAVIVTFV 1901
            + L +IP+ TI GN+ V L+V++E+RL++RFN FLVSLA+SDLL A LVMPVSA  M+     N     +CL  +S+D+FFTATTIIHLC+ISLDRY AL  P    R   +    L  +IF SW +PFSIA PLF+ A+  +R                 T+ SYKGCGP    F+LTA+ VTFV
Sbjct:   10 IALCLIPLGTIWGNICVCLAVYLERRLRHRFNLFLVSLAISDLLCAILVMPVSAWHMIATRPQNR---ILCLVSYSMDIFFTATTIIHLCSISLDRYLALRRPFGRNRAVPKIFQSLVFRIFMSWFVPFSIAGPLFVFALKWERGDEEFIVTMTPESANITTSKSYKGCGPNDKSFVLTAIGVTFV 192          

HSP 2 Score: 101.679 bits (252), Expect = 8.513e-19
Identity = 45/92 (48.91%), Postives = 56/92 (60.87%), Query Frame = -3
Query:  162 IRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRNNPHN 437
            I   ++AV+V+  LFGLF+ CY PFF+VY     CP C    +  I HLEW+GY  SMLNPVVYH FN  F+ TFRR+    C+     PH 
Sbjct:  395 IHSGKRAVRVIAVLFGLFVTCYTPFFIVYTISVVCPQCRSWAEPAIPHLEWLGYLNSMLNPVVYHSFNSTFRRTFRRIFQCACR----TPHE 482          
BLAST of SMED30006914 vs. Ensembl Cavefish
Match: htr2ab (5-hydroxytryptamine (serotonin) receptor 2A, genome duplicate b [Source:ZFIN;Acc:ZDB-GENE-120215-60])

HSP 1 Score: 105.916 bits (263), Expect = 1.062e-23
Identity = 67/172 (38.95%), Postives = 107/172 (62.21%), Query Frame = -3
Query: 1401 NWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKG-CGPQSALFILTAVIVTF 1913
            NW+ L + +  +IT+ GN+LV ++V +E++LQN  NYFL+SLA++D+L   LVMPVS M+ +  +    +P  +C  W  LDV F+  +I+HLC ISLDRY A+ NP+++ R   + +R  +KI A+W I   I+ P+ ++ +Y D +   + G C  +   F+L    V F
Sbjct:   81 NWVALLILLAIVITVTGNILVIMAVSLERKLQNATNYFLMSLAITDMLLGLLVMPVS-MVTILYNYRWPFPFVLCPIWIYLDVLFSTASIMHLCAISLDRYIAIRNPIQHSRSNSR-ARARVKIAAAWTISVGISMPVPVIGLY-DHSKVFHNGSCQLKEDNFVLIGSFVAF 249          

HSP 2 Score: 63.1586 bits (152), Expect = 6.304e-10
Identity = 34/100 (34.00%), Postives = 57/100 (57.00%), Query Frame = -3
Query:  177 SQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPS-CNRSLK-DVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSR 470
            S+ F   T ++I   +KA +VLG +F LF++ + PFF+  +    C S C+ SL   ++    WVGY +S +NP++Y +FN  ++  F R L    ++ R
Sbjct:  316 SRPFVRRTMQSISNEQKASKVLGVVFFLFVIMWCPFFVTNVLLVVCDSACDPSLMIGLLNVFVWVGYLSSAVNPLIYTLFNKTYRAAFARYLRCRYREQR 415          
BLAST of SMED30006914 vs. Ensembl Cavefish
Match: htr2cl1 (5-hydroxytryptamine receptor 2C-like [Source:NCBI gene;Acc:103044140])

HSP 1 Score: 93.2041 bits (230), Expect = 2.008e-19
Identity = 57/127 (44.88%), Postives = 84/127 (66.14%), Query Frame = -3
Query: 1485 GNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAI 1865
            GN+LV L+V +EK+LQN  N+FL SLAV+D+L   LVMP+S ++ +  D A   PN +C  W  LDV F+  +I+HLC ISLDRY A+ NP+++ R   + ++  LKI A W I   I+ P+ ++ +
Sbjct:   83 GNILVILAVSLEKKLQNATNFFLRSLAVADMLVGILVMPIS-LINILYDYAWPLPNALCPIWIYLDVLFSTASIMHLCAISLDRYVAICNPIQHSRFNSR-TKAMLKIAAVWTISIGISMPIPVIGL 207          

HSP 2 Score: 61.2326 bits (147), Expect = 2.189e-9
Identity = 31/86 (36.05%), Postives = 50/86 (58.14%), Query Frame = -3
Query:  213 HTKRN----IRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNRS-LKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTF 452
            H +R     I+  R+A +VLG +F LFLL + PFF+  +    C  +CN   L +++    W+GY +S +NP+VY +FN  ++  F
Sbjct:  340 HGRRGMMQAIKNERRASKVLGVVFFLFLLMWCPFFITNVLFVLCRGACNEPLLNELLNVFVWIGYISSGVNPLVYTLFNKTYRRAF 425          
BLAST of SMED30006914 vs. Ensembl Cavefish
Match: htr2b (5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled [Source:ZFIN;Acc:ZDB-GENE-081022-57])

HSP 1 Score: 87.8113 bits (216), Expect = 8.931e-18
Identity = 62/148 (41.89%), Postives = 94/148 (63.51%), Query Frame = -3
Query: 1494 SEIQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFI 1931
            ++++  +W +L + I+ I TI GN+LV L+V +E++LQN  NYFL+SLAV+DLL   LVMP++   +V     + WP    +C  W  LDV F+  +I+HLC ISLDRY A+  P+++ + K ++  L  KI   W+I   IA P+ I
Sbjct:   26 ADVEELHWASLLIIIVIIPTIGGNILVILAVSLERKLQNATNYFLMSLAVADLLVGLLVMPIA---LVTVLFNSGWPLPEFLCPIWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQHSQYKSRAKALA-KIALVWLISIGIAIPIPI 169          

HSP 2 Score: 64.6994 bits (156), Expect = 1.950e-10
Identity = 39/126 (30.95%), Postives = 67/126 (53.17%), Query Frame = -3
Query:  192 PKYPLKLTDRMKFNNV--PLLSMTSKQS--QRFQNHTKR---NIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKD-VIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGN 545
            P   L + D +K + +  P+  +T  +   +R     KR   N+   ++A +VLG +F LF++ + PFF+  +    C SC+  L + ++    WVGY +S +NP+VY +FN  F+  F R +  N
Sbjct:  259 PPEKLAMLDGIKRDQILNPVNPITGDEMPIRRLSTIGKRSMQNLSNEQRASKVLGIVFMLFVVMWCPFFITNVTSVLCKSCDMGLVERLLDIFVWVGYISSGVNPLVYTLFNKTFREAFTRYIMCN 384          
BLAST of SMED30006914 vs. Ensembl Cavefish
Match: htr2cl2 (5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled-like 2 [Source:ZFIN;Acc:ZDB-GENE-120215-109])

HSP 1 Score: 84.7297 bits (208), Expect = 2.898e-17
Identity = 85/278 (30.58%), Postives = 131/278 (47.12%), Query Frame = -3
Query: 1107 WINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIAN-NWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTFVXXXXXXXXXXXXTV-----HTIIVQTRRFDEMMIN--NPIKSPALSKFEFFSHSKTKRNMCVQNGSCDTSLEGSNSSYHYSEKYELKPMINMNGKPYKSSKERK 1910
            W  L + +    T+ GN+LV L+V +EK+LQN  N+FL SLAV+D+L   LVMP S +     +I N +WP    +C  W  LDV F+  +I+HLC ISLDRY  + NP+++ R  + S R   KI   W I   ++ P+ ++ +  ++       C      F+L    V F +PL+IM++ Y LTV     HT      R   + +N   P   P++S     +   +                 +N S   ++   L P+    G P +    R 
Sbjct:    1 WPALIILVFIFFTVGGNILVILAVSLEKKLQNATNFFLRSLAVADMLVGVLVMPASLL-----NILNYSWPLPQVLCPMWIFLDVLFSTASIMHLCAISLDRYIGIRNPIQHSRS-NSSCRAMAKITVVWTISM-VSLPIPVIGLQDEQKVFVNGTCQLNEPHFVLVGSFVAFFVPLLIMVVCYCLTVKVLQQHTAAFSQDRGSYVNVNPKQPSPQPSVSGISLLNEEPS-----------------TNQSKGAAQPLSLSPLTGHEGPPQRGQGRRG 254          

HSP 2 Score: 60.8474 bits (146), Expect = 2.094e-9
Identity = 51/177 (28.81%), Postives = 79/177 (44.63%), Query Frame = -3
Query:  186 VSAETLTVTIEQNHTLV-SQDSLS-LNYRPLNASTPFLKNKSASIEKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSKQSQRFQNHTKRN----IRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQ 698
            V    LTV + Q HT   SQD  S +N  P        K  S     S I    + P     +     + L  +T  +    +   +R     I+  R+A +VLG +F LFL+ + PFF+  +    C +   +L  ++    WVGY +S +NP+VY +FN  ++  F R  H  C+
Sbjct:  174 VVCYCLTVKVLQQHTAAFSQDRGSYVNVNP--------KQPSPQPSVSGISLLNEEPSTNQSKGAAQPLSLSPLTGHEGPPQRGQGRRGMTQAIKNERRASKVLGVVFFLFLVMWCPFFITNVVVAVCQNNCSNLFRLLEVFVWVGYVSSGVNPLVYTLFNKTYRHAFSR--HLQCR 340          
BLAST of SMED30006914 vs. Ensembl Cavefish
Match: ENSAMXT00000030313.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002256.1:13944:20614:-1 gene:ENSAMXG00000030546.1 transcript:ENSAMXT00000030313.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 5.204e-17
Identity = 58/138 (42.03%), Postives = 89/138 (64.49%), Query Frame = -3
Query: 1524 SEIQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWII 1931
            ++++  +W +L + I+ I TI GN+LV L+V +E++LQN  NYFL+SLAV+DLL   LVMP++   +V     + WP    +C  W  LDV F+  +I+HLC ISLDRY A+  P+++ + K ++  L  KI   W+I
Sbjct:   35 TDVEELHWASLLIIIVIIPTIGGNILVILAVSLERKLQNATNYFLMSLAVADLLVGLLVMPIA---LVTVLFNSGWPLPEFLCPIWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQHSQYKSRAKALA-KIALVWLI 168          
BLAST of SMED30006914 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006953.1 (pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 gene:ENSPMAG00000006283.1 transcript:ENSPMAT00000006953.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 2.259e-20
Identity = 59/132 (44.70%), Postives = 84/132 (63.64%), Query Frame = -3
Query: 1485 TICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPN--EVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAI 1874
            TI GNVLV L+V +EK+LQ   NYFL+SLAV+D+L   LVMP+S + ++       WP    +C  W  LDV F+  +I+HLC ISLDRY A+  P+++ R   ++  L LKI A W+I   I+ P+ +L +
Sbjct:   38 TIAGNVLVILAVSLEKKLQTATNYFLMSLAVADMLVGILVMPISLLNILYG---FKWPLPLSLCPVWIYLDVLFSTASIMHLCAISLDRYIAIKKPIEHSRFNSRTKAL-LKILAVWVISVGISMPVPVLGL 165          

HSP 2 Score: 64.6994 bits (156), Expect = 2.638e-11
Identity = 32/92 (34.78%), Postives = 53/92 (57.61%), Query Frame = -3
Query:  192 QNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPS--CNR-SLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGN 458
            Q  T + I   ++A +VLG +F LF+  + PFF+  +    CP+  CNR ++  ++    WVGY +S +NP+VY +FN  ++  F R +  N
Sbjct:  302 QKRTMQAITNEQRASKVLGIVFLLFVGMWCPFFITNVLSALCPADACNRHAMAALLDVFVWVGYVSSGVNPLVYTLFNRTYRQAFARYIACN 393          
BLAST of SMED30006914 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004593.1 (pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1 gene:ENSPMAG00000004184.1 transcript:ENSPMAT00000004593.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 3.676e-19
Identity = 61/131 (46.56%), Postives = 82/131 (62.60%), Query Frame = -3
Query: 1485 GNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANN--WP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAI 1865
            GN+LV L+V +EK+LQ   NYFL+SLAV+DLL    VMP+S +     +I  N  WP   E+C  W  LDV F+  +I+HLC ISLDRY A+  P+++ R   +S  L LKI A W I   IA P+ +L +
Sbjct:   21 GNLLVILAVWLEKKLQTATNYFLMSLAVADLLVGLTVMPISVI-----NILYNMRWPLPCEMCPVWVFLDVLFSTASIMHLCAISLDRYIAIKRPIQHSRFNSRSKTL-LKITAVWAISIGIASPIPVLGL 145          

HSP 2 Score: 67.781 bits (164), Expect = 2.496e-12
Identity = 32/106 (30.19%), Postives = 64/106 (60.38%), Query Frame = -3
Query:  174 TSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLE---WVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRN 482
            T +++Q   + + + +   R+A +VLG +F LFL+ + PFF+  +    CP    S++ + + ++   WVGY +S +NP+VY +FN  ++  FRR +  + +++R+
Sbjct:  260 TLRRTQAAHSRSAQALSNERRASKVLGIVFTLFLVMWCPFFVTNVTSALCPESLCSVEAMAKLMDIFVWVGYVSSGVNPLVYTLFNQTYRQAFRRYVACDFRRARH 365          
BLAST of SMED30006914 vs. Ensembl Sea Lamprey
Match: si:dkey-247m21.3 (si:dkey-247m21.3 [Source:ZFIN;Acc:ZDB-GENE-091204-249])

HSP 1 Score: 75.0998 bits (183), Expect = 1.067e-14
Identity = 60/143 (41.96%), Postives = 92/143 (64.34%), Query Frame = -3
Query: 1521 ESEIQSANWINLGLF-IIPIITICGNVLVALSVHVEKRLQN-RFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFAL-NNPLKYRRDKHQSSRLYLKIFASWIIP 1934
            E+  Q+  +I  G+F II  +TI GN+LV ++V  ++ L+  + NYF+VSLAV+DLL A LVMP  A+  V+    N+WP  ++ C+   S DV FT  +I+HLC I+LDR++A+   PL Y ++K    R+ L + A W++P
Sbjct:   12 ETSSQAEKYILAGIFSIIIAVTILGNLLVVVAVCKDRHLRKIKTNYFIVSLAVADLLVAILVMPFGAVERVQ----NDWPYGDKFCIIRTSFDVMFTTASIMHLCCIALDRFYAICCKPLVY-QNKMTPLRVGLMLGACWVVP 149          

HSP 2 Score: 50.0618 bits (118), Expect = 9.880e-7
Identity = 31/97 (31.96%), Postives = 47/97 (48.45%), Query Frame = -3
Query:  201 SMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSL-KDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLL 488
            +M   QS RF++ TK        A + L  + G F LC+ PFF+  + D   P  N    + +     W+GY+ S LNP++Y   N  F+  F  +L
Sbjct:  244 TMVQTQSTRFRHETK--------AAKTLAIIMGCFCLCWAPFFINNVID---PFVNYDTPQQLWDAWLWLGYANSALNPLLYAFLNRSFRRAFLAIL 329          
BLAST of SMED30006914 vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 70.8626 bits (172), Expect = 3.799e-13
Identity = 35/96 (36.46%), Postives = 58/96 (60.42%), Query Frame = -3
Query:  201 MTSKQSQRFQNHTKR-NIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLL 485
            M+++  QR     +R +  + R+A + LG + G F++C+LPFF+  +    C SC  S  +V   L W+GY  S++NP++Y +FN  FK  FR+L+
Sbjct:  327 MSARLDQRRPCLQERISGSRERRAAKTLGLILGAFVVCWLPFFIKELVVNLCKSCAVS-PEVADLLTWLGYMNSLINPLIYTMFNEDFKSAFRKLV 421          

HSP 2 Score: 67.3958 bits (163), Expect = 4.082e-12
Identity = 47/120 (39.17%), Postives = 69/120 (57.50%), Query Frame = -3
Query: 1503 NVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACP 1862
            N LV  ++   ++L+   NY + SLAV+DLL A LVMPV+A  +V  + A      +C  W SLDV     +I+HLC I+LDR++A+ +  +Y   K    R  L I ASW++   I+ P
Sbjct:   65 NALVIAAISATRKLRQPANYLIGSLAVADLLVAALVMPVAAAYVVTGEWALG--GALCDLWLSLDVTCCTASILHLCAIALDRFWAITDAAEY-AHKRTPGRAALMIAASWLLAACISVP 181          
BLAST of SMED30006914 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001357.1 (pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 gene:ENSPMAG00000001226.1 transcript:ENSPMAT00000001357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 9.386e-13
Identity = 55/142 (38.73%), Postives = 83/142 (58.45%), Query Frame = -3
Query: 1503 QSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNW--PNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACP 1922
            Q+A    LG  I    +I GN  V  ++++E+ LQ   NY + SLAV+DLL + LV+PV+A+  V       W     VC A+ +LDV    ++I+HLC I+LDRY+A+ +P+ Y  +K    R  L I  +W++ FSI+ P
Sbjct:    2 QTATSSALGALIA--CSIAGNAFVLAAIYLERSLQTVANYLIGSLAVTDLLVSVLVLPVAALYQVLG----RWTLGQAVCDAFIALDVLCCTSSILHLCAIALDRYWAITDPVDY-VNKRTPRRAALMIAITWVVGFSISIP 136          
BLAST of SMED30006914 vs. Ensembl Nematostella
Match: EDO47359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMJ9])

HSP 1 Score: 72.7886 bits (177), Expect = 1.266e-13
Identity = 62/187 (33.16%), Postives = 99/187 (52.94%), Query Frame = -3
Query: 1401 KNTTESEIQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPN----EVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIY-LDRTNGSYKGCGPQSALFILTAVIVTF 1946
            KN+  S I SA +I     I+ ++TI GN+LV  SV   +RL++  NY +VSLAVSDLL  TL +P     ++  +   NWP+    E C  W  +D+  +  ++++L  IS DR  A+  PL+Y R+K  S R  + I   WI  ++ +C       +  + T  +Y  CG ++ ++I    +  F
Sbjct:   17 KNSVGSTIASACFI----VIVMLLTIMGNLLVCYSVFYYRRLRSPTNYLVVSLAVSDLLVGTLSLPFRLAQLLNEE---NWPSHLGREGCQFWIWVDMLCSGASMVNLAGISFDRLLAIKQPLRY-REKMTSKRALILILVVWI--YAASCAFLSFVEWEGESTIAAYPQCGIRARVYITLMALAAF 193          
BLAST of SMED30006914 vs. Ensembl Nematostella
Match: EDO34409 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPH3])

HSP 1 Score: 64.6994 bits (156), Expect = 3.607e-11
Identity = 44/145 (30.34%), Postives = 76/145 (52.41%), Query Frame = -3
Query: 1509 TESEIQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNW--PNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIA 1937
            T+  + +     + LF+I ++   GNVLV  ++++ +RL     YF+ S++ +DL    LV+PVS    V   +   W     +C  W     +F   +I +LC ++ DRY A+  P +Y   + +SSR+ L I A+W+  F +A
Sbjct:   11 TQPSVLALVLFEICLFVIAVV---GNVLVCRTIYLTRRLHFSAYYFIASMSTADLCLTLLVLPVSTAYYVTYQMRGAWIFGKAMCHMWTLASSWFATASIFNLCAVTWDRYVAMTTPFRY-YSRMRSSRVILMIGAAWMTSFILA 151          
BLAST of SMED30006914 vs. Ensembl Nematostella
Match: EDO35211 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM55])

HSP 1 Score: 60.077 bits (144), Expect = 9.853e-10
Identity = 34/104 (32.69%), Postives = 57/104 (54.81%), Query Frame = -3
Query:  201 NNVPLLSMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCN--RSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLL 506
            N+ P+L  TS+ S R Q   +R +    KA + L  + G FLLC+ P+ +  + +  CP C   +    + + ++W+ YS S LNP++Y   N  F+  F+R+L
Sbjct:  206 NSRPVL--TSQSSFRLQ---RRALSTDIKAAKTLAIVMGAFLLCWAPYIIALLLEVSCPRCVPFQDKYTLAKAVKWLVYSNSALNPIIYTALNRAFRDAFKRVL 304          

HSP 2 Score: 49.2914 bits (116), Expect = 3.084e-6
Identity = 43/134 (32.09%), Postives = 72/134 (53.73%), Query Frame = -3
Query: 1509 GLFIIPII-TICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP---NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIA 1898
            GL  + I+ TI GN LV  + ++ + L+   NYF+VSLA++DLL   + MP+    +V       WP   +E+   W   D+     +I++L  IS+DR++A+  P +Y + K    R  L I   W+  F+++
Sbjct:    6 GLLALLIVGTIFGNSLVCAAFYLFRDLRTVTNYFVVSLAIADLLVGFVSMPLWFTYLV-----FQWPPQNSEIYALWLCFDIATATASIMNLAVISVDRFYAITLPFQYSQ-KITKKRACLAIVFVWLYAFAVS 133          
BLAST of SMED30006914 vs. Ensembl Nematostella
Match: EDO32514 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUW4])

HSP 1 Score: 60.077 bits (144), Expect = 1.011e-9
Identity = 41/125 (32.80%), Postives = 71/125 (56.80%), Query Frame = -3
Query: 1527 LFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNW--PNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWI 1895
            L  + I+ + GN LV  +V V  RL +   Y ++S+A++D+L    V+PVS + +V  +++  W     VC  W   + +F+  +I+ LC I+ DRY A+ +PL+Y R + +SS    +I   W+
Sbjct:   32 LLTLSIVAVVGNSLVFHTVRVTSRLHSPPFYLILSVALADILVGVFVIPVSIVYLVFFEMSGIWVMGEAVCDVWVLANFWFSGASILSLCAITRDRYLAVTSPLQYLR-RMRSSHTAFQIVICWL 155          
BLAST of SMED30006914 vs. Ensembl Nematostella
Match: EDO37144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGS2])

HSP 1 Score: 55.0694 bits (131), Expect = 2.260e-8
Identity = 30/93 (32.26%), Postives = 51/93 (54.84%), Query Frame = -3
Query:  246 MKFNNVPLLSMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDV---IRHLEWVGYSASMLNPVVY 515
            M F    +L + S ++ R  N   R + K  K  + LG + G F++C+LPFF+V +   +C SC  +++ V      ++W+ Y  S LNP++Y
Sbjct:  158 MVFCYAGILVVVSSKA-RLSNRVGRRLDKEFKTAKSLGVVTGSFVICWLPFFIVSLSHKYCISCRVAIESVPAATSAVKWLHYLNSCLNPIIY 249          
BLAST of SMED30006914 vs. Ensembl Medaka
Match: htr2aa (5-hydroxytryptamine receptor 2A [Source:NCBI gene;Acc:101173822])

HSP 1 Score: 104.76 bits (260), Expect = 3.244e-23
Identity = 64/147 (43.54%), Postives = 95/147 (64.63%), Query Frame = -3
Query: 1485 QSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRR-DKHQSSRLYLKIFASWIIPFSIACPLFILAI 1922
            +  NW +L + ++  +T+ GN+LV L+V +EK+LQN  NYFL+SLAV+D+L   LVMPVS M+ +  D     P ++C  W  LDV F+  +I+HLC ISLDRY A+ NP+ + R + H  +R  +KI A W I   I+ P+ +L +
Sbjct:   85 EEKNWASLLILVVIAVTVMGNILVILAVSLEKKLQNATNYFLMSLAVADMLLGILVMPVS-MVTILYDYRWPLPPDLCPIWIYLDVLFSTASIMHLCAISLDRYIAIRNPIHHSRFNSHTKAR--IKIMAVWTISAGISMPIPVLGL 228          

HSP 2 Score: 64.6994 bits (156), Expect = 2.107e-10
Identity = 35/104 (33.65%), Postives = 56/104 (53.85%), Query Frame = -3
Query:  186 SMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC--PSCNRS-LKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQ 488
            S+ S     F   T ++I   +KA +VLG +F LF++ + PFF+  +    C   +CN   +  ++    WVGY +S +NP+VY +FN  ++  F R L   CQ
Sbjct:  314 SIRSVSGSLFGRRTMQSISNEQKASKVLGVVFFLFVVMWCPFFITNVLVVVCEPAACNAGVMGGLLNIFVWVGYLSSAVNPLVYTLFNKTYRAAFLRYLR--CQ 415          
BLAST of SMED30006914 vs. Ensembl Medaka
Match: htr2cl1 (5-hydroxytryptamine receptor 2C-like [Source:NCBI gene;Acc:101165845])

HSP 1 Score: 101.293 bits (251), Expect = 7.594e-22
Identity = 64/160 (40.00%), Postives = 99/160 (61.88%), Query Frame = -3
Query: 1485 KNTTESE------IQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAI 1946
            +N+T  E      I+  NW  L +  I  +TI GN+LV L+V +EK+LQN  N+FL SLAV+D+L   LVMP+S ++ +  D A   P+ +C  W  LDV F+  +I+HLC ISLDRY A+ NP+++ R   + ++  +KI A W I   ++ P+ ++ +
Sbjct:   58 ENSTSQEAVARNVIKDKNWPALLILFIIALTIGGNILVILAVSLEKKLQNATNFFLRSLAVADMLVGILVMPIS-LINILYDYAWPLPSALCPIWIYLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSR-TKAMMKIAAVWTISIGVSMPIPVIGL 215          

HSP 2 Score: 63.929 bits (154), Expect = 3.684e-10
Identity = 36/100 (36.00%), Postives = 55/100 (55.00%), Query Frame = -3
Query:  171 HTKRN----IRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNRSL-KDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRNN 452
            H +R     I+  ++A +VLG +F LFL+ + PFF+  +    C  SCN SL  D++    WVGY +S +NP+VY +FN  ++  F   +   CQ    N
Sbjct:  372 HGRRGMMQAIKNEKRASKVLGIVFFLFLIMWCPFFITNVTFVLCRGSCNESLLHDLLNLFVWVGYISSGVNPLVYTLFNKTYRRAFSSYIR--CQYKGTN 469          
BLAST of SMED30006914 vs. Ensembl Medaka
Match: htr2cl1 (5-hydroxytryptamine receptor 2C-like [Source:NCBI gene;Acc:101165845])

HSP 1 Score: 101.293 bits (251), Expect = 7.594e-22
Identity = 64/160 (40.00%), Postives = 99/160 (61.88%), Query Frame = -3
Query: 1485 KNTTESE------IQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAI 1946
            +N+T  E      I+  NW  L +  I  +TI GN+LV L+V +EK+LQN  N+FL SLAV+D+L   LVMP+S ++ +  D A   P+ +C  W  LDV F+  +I+HLC ISLDRY A+ NP+++ R   + ++  +KI A W I   ++ P+ ++ +
Sbjct:   58 ENSTSQEAVARNVIKDKNWPALLILFIIALTIGGNILVILAVSLEKKLQNATNFFLRSLAVADMLVGILVMPIS-LINILYDYAWPLPSALCPIWIYLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSR-TKAMMKIAAVWTISIGVSMPIPVIGL 215          

HSP 2 Score: 63.929 bits (154), Expect = 3.684e-10
Identity = 36/100 (36.00%), Postives = 55/100 (55.00%), Query Frame = -3
Query:  171 HTKRN----IRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFC-PSCNRSL-KDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRNN 452
            H +R     I+  ++A +VLG +F LFL+ + PFF+  +    C  SCN SL  D++    WVGY +S +NP+VY +FN  ++  F   +   CQ    N
Sbjct:  372 HGRRGMMQAIKNEKRASKVLGIVFFLFLIMWCPFFITNVTFVLCRGSCNESLLHDLLNLFVWVGYISSGVNPLVYTLFNKTYRRAFSSYIR--CQYKGTN 469          
BLAST of SMED30006914 vs. Ensembl Medaka
Match: htr2b (5-hydroxytryptamine receptor 2B [Source:NCBI gene;Acc:101162203])

HSP 1 Score: 93.5893 bits (231), Expect = 1.022e-19
Identity = 63/147 (42.86%), Postives = 93/147 (63.27%), Query Frame = -3
Query: 1494 EIQSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWP--NEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFI 1928
            EIQ   W  L + ++ I TI GN+LV L+V +E++LQN  NYFL+SLAV+DLL   LVMP++   +V     + WP  + +C  W  LDV F+  +I+HLC ISLDRY A+  P+++ + K ++  + +KI   W+I   IA P+ I
Sbjct:   21 EIQ-LKWAALLIIMVIIPTIGGNILVILAVSLERKLQNATNYFLMSLAVADLLVGLLVMPIA---LVTVLYNSGWPLPDFLCPIWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQHSQYKSRAKAI-VKIALVWLISICIAIPIPI 162          

HSP 2 Score: 69.3218 bits (168), Expect = 5.867e-12
Identity = 37/99 (37.37%), Postives = 57/99 (57.58%), Query Frame = -3
Query:  165 RNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLE---WVGYSASMLNPVVYHIFNPIFKMTFRRLL---HGNCQKSRNNPH 443
            + +   ++A +VLG +F LF++ + PFF+  I    C SC+ S+  V R +E   WVGY +S +NP+VY +FN  F+  F R +   + N   SR  PH
Sbjct:  298 QTLSNEQRASKVLGIVFLLFVVMWCPFFITNITSALCTSCSASI--VSRLMEIFVWVGYVSSGINPLVYTLFNKTFREAFTRYITCNYSNSASSRTGPH 394          
BLAST of SMED30006914 vs. Ensembl Medaka
Match: ENSORLT00000005282.2 (pep primary_assembly:ASM223467v1:9:8571029:8576106:1 gene:ENSORLG00000004220.2 transcript:ENSORLT00000005282.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 2.952e-15
Identity = 55/135 (40.74%), Postives = 83/135 (61.48%), Query Frame = -3
Query: 1503 LGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNW--PNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACP 1901
            LG  I+   +I GN  V  ++ +E+ LQN  NY + SLAV+DL+ + LV+P++A+  V     N W    E+C  + SLDV    ++I+HLC I+LDRY+A+ +P+ Y  +K    R  L I A+W+I FSI+ P
Sbjct:   49 LGALIL--CSIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQV----LNKWTLGQEICDLFISLDVLCCTSSILHLCAIALDRYWAITDPIDY-VNKRTPMRAVLLICATWLIGFSISIP 176          

HSP 2 Score: 71.2478 bits (173), Expect = 1.414e-12
Identity = 35/109 (32.11%), Postives = 60/109 (55.05%), Query Frame = -3
Query:  201 NVPLLSMTSKQSQRFQNHTKRN--------IRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLL 503
            ++PL +     S  ++N  +RN        + + RK V+ LG + G F+ C+LPFF+V +   FCP        +   + W+GYS S+LNP++Y  FN  F+  F++++
Sbjct:  307 HLPLPNTPQSSSHGYENMNERNSGAKRKLALSRERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCPESCFMPDWLGAVINWLGYSNSLLNPIIYAYFNKDFQNAFKKII 415          
BLAST of SMED30006914 vs. Planmine SMEST
Match: SMESG000001324.1 (SMESG000001324.1)

HSP 1 Score: 1065.45 bits (2754), Expect = 0.000e+0
Identity = 529/530 (99.81%), Postives = 529/530 (99.81%), Query Frame = -3
Query:  147 MMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTFVXXXXXXXXXXXXTVHTIIVQTRRFDEMMINNPIKSPALSKFEFFSHSKTKRNMCVQNGSCDTSLEGSNSSYHYSEKYELKPMINMNGKPYKSSKERKCFPQSTFSLVKMNSDENYELDSKKTLKLQNIFHSYDEENYIKTLDTLYRPRSSIDFNTQHLCSSYYSIEKDQRFSDQNIPKQHFLSNIMYLKVDNTRPQLARTISYDETRALDRPEMLHLPTEQTNHFTDESEKNQVSAETLTVTIEQNHTLVSQDSLSLNYRPLNASTPFLKNKSASIEKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRNNPHNLSSFV 1736
            MMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTFVIPLIIMIITYILTVHTIIVQTRRFDEMMINNPIKSPALSKFEFFSHSKTKRNMCVQNGSCDTSLEGSNSSYHYSEKYELKPMINMN KPYKSSKERKCFPQSTFSLVKMNSDENYELDSKKTLKLQNIFHSYDEENYIKTLDTLYRPRSSIDFNTQHLCSSYYSIEKDQRFSDQNIPKQHFLSNIMYLKVDNTRPQLARTISYDETRALDRPEMLHLPTEQTNHFTDESEKNQVSAETLTVTIEQNHTLVSQDSLSLNYRPLNASTPFLKNKSASIEKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRNNPHNLSSFV
Sbjct:    1 MMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTFVIPLIIMIITYILTVHTIIVQTRRFDEMMINNPIKSPALSKFEFFSHSKTKRNMCVQNGSCDTSLEGSNSSYHYSEKYELKPMINMNCKPYKSSKERKCFPQSTFSLVKMNSDENYELDSKKTLKLQNIFHSYDEENYIKTLDTLYRPRSSIDFNTQHLCSSYYSIEKDQRFSDQNIPKQHFLSNIMYLKVDNTRPQLARTISYDETRALDRPEMLHLPTEQTNHFTDESEKNQVSAETLTVTIEQNHTLVSQDSLSLNYRPLNASTPFLKNKSASIEKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRNNPHNLSSFV 530          
BLAST of SMED30006914 vs. Planmine SMEST
Match: SMESG000001324.1 (SMESG000001324.1)

HSP 1 Score: 1063.91 bits (2750), Expect = 0.000e+0
Identity = 528/529 (99.81%), Postives = 528/529 (99.81%), Query Frame = -3
Query:  147 MVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTFVXXXXXXXXXXXXTVHTIIVQTRRFDEMMINNPIKSPALSKFEFFSHSKTKRNMCVQNGSCDTSLEGSNSSYHYSEKYELKPMINMNGKPYKSSKERKCFPQSTFSLVKMNSDENYELDSKKTLKLQNIFHSYDEENYIKTLDTLYRPRSSIDFNTQHLCSSYYSIEKDQRFSDQNIPKQHFLSNIMYLKVDNTRPQLARTISYDETRALDRPEMLHLPTEQTNHFTDESEKNQVSAETLTVTIEQNHTLVSQDSLSLNYRPLNASTPFLKNKSASIEKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRNNPHNLSSFV 1733
            MVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTFVIPLIIMIITYILTVHTIIVQTRRFDEMMINNPIKSPALSKFEFFSHSKTKRNMCVQNGSCDTSLEGSNSSYHYSEKYELKPMINMN KPYKSSKERKCFPQSTFSLVKMNSDENYELDSKKTLKLQNIFHSYDEENYIKTLDTLYRPRSSIDFNTQHLCSSYYSIEKDQRFSDQNIPKQHFLSNIMYLKVDNTRPQLARTISYDETRALDRPEMLHLPTEQTNHFTDESEKNQVSAETLTVTIEQNHTLVSQDSLSLNYRPLNASTPFLKNKSASIEKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRNNPHNLSSFV
Sbjct:    1 MVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTFVIPLIIMIITYILTVHTIIVQTRRFDEMMINNPIKSPALSKFEFFSHSKTKRNMCVQNGSCDTSLEGSNSSYHYSEKYELKPMINMNCKPYKSSKERKCFPQSTFSLVKMNSDENYELDSKKTLKLQNIFHSYDEENYIKTLDTLYRPRSSIDFNTQHLCSSYYSIEKDQRFSDQNIPKQHFLSNIMYLKVDNTRPQLARTISYDETRALDRPEMLHLPTEQTNHFTDESEKNQVSAETLTVTIEQNHTLVSQDSLSLNYRPLNASTPFLKNKSASIEKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSKQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRNNPHNLSSFV 529          
BLAST of SMED30006914 vs. Planmine SMEST
Match: SMESG000065390.1 (SMESG000065390.1)

HSP 1 Score: 218.779 bits (556), Expect = 4.487e-63
Identity = 130/213 (61.03%), Postives = 165/213 (77.46%), Query Frame = -3
Query: 1293 QSANWINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTN---GSYKGCGPQSALFILTAVIVTFVXXXXXXXXXXXXTVHTIIVQTRRFDEMMINNPIKS 1922
            +   W  L L +IPIITI GN+LV +SV++EKRLQNRFNYFLVSLAVSD L A LVMPVS + MV  D+ N WP+++CLAW+SLDVFFTATTIIHLCTIS+DRY ALNNPL++ + K + S L++KI  SW+IPF IACPLF+ ++ ++  N    S+KGCGP +A+FI+TAVIVTF++PL+IM+I+YILTV TI  QT+  D    N   KS
Sbjct:   25 KDVKWAFLFLLLIPIITIFGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYS-LFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKS 236          

HSP 2 Score: 125.946 bits (315), Expect = 1.982e-30
Identity = 62/112 (55.36%), Postives = 78/112 (69.64%), Query Frame = -3
Query:  174 NVPLLSMTSKQSQRF--QNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRN 503
            NV L S  S  S+R    + + R I+KSRKAVQVLG +FGLF+ CY+PFF++Y+ DFFC SC      +I + EW+GYSASM+NPVVYHIFNP F+ TF RL+   C K  N
Sbjct:  356 NVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKVSN 467          
BLAST of SMED30006914 vs. Planmine SMEST
Match: SMESG000032679.1 (SMESG000032679.1)

HSP 1 Score: 189.504 bits (480), Expect = 4.015e-52
Identity = 125/216 (57.87%), Postives = 151/216 (69.91%), Query Frame = -3
Query: 1329 WINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNG----------------------SYKGCGPQSALFILTAVIVTFVXXXXXXXXXXXXTVHTIIVQTRR 1910
            W  LGL IIP+ TI GN LV +SV +EKRLQNRFN+FLVSLA+SDLL A LVMPVSA  MV+ +   + P  +CLAW+SLDVFFT+TTIIHLC+ISLDRYF LNNPLKY   + +SS L LKI  +W+IPF IACPLFI A+ LD   G                      SYKGCGP +  FI+ + ++TFV+PL IMI+TYILTV +II QT +
Sbjct:   32 WPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSS-LPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQ 246          

HSP 2 Score: 103.219 bits (256), Expect = 8.683e-23
Identity = 56/100 (56.00%), Postives = 68/100 (68.00%), Query Frame = -3
Query:  177 KQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSR 476
            KQS+     T   +   +KAVQVLG LFGLFLLCYLPFF++Y+ DFFC  C      ++   EW+GYSASMLNP+VYHIFNP F+ TF RL+   C K R
Sbjct:  393 KQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKVR 492          
BLAST of SMED30006914 vs. Planmine SMEST
Match: SMESG000032682.1 (SMESG000032682.1)

HSP 1 Score: 189.504 bits (480), Expect = 6.540e-51
Identity = 125/216 (57.87%), Postives = 151/216 (69.91%), Query Frame = -3
Query: 1329 WINLGLFIIPIITICGNVLVALSVHVEKRLQNRFNYFXXXXXXXXXXXXXXVMPVSAMMMVKADIANNWPNEVCLAWFSLDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWIIPFSIACPLFILAIYLDRTNG----------------------SYKGCGPQSALFILTAVIVTFVXXXXXXXXXXXXTVHTIIVQTRR 1910
            W  LGL IIP+ TI GN LV +SV +EKRLQNRFN+FLVSLA+SDLL A LVMPVSA  MV+ +   + P  +CLAW+SLDVFFT+TTIIHLC+ISLDRYF LNNPLKY   + +SS L LKI  +W+IPF IACPLFI A+ LD   G                      SYKGCGP +  FI+ + ++TFV+PL IMI+TYILTV +II QT +
Sbjct:   32 WPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSS-LPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQ 246          

HSP 2 Score: 100.523 bits (249), Expect = 1.082e-21
Identity = 53/92 (57.61%), Postives = 65/92 (70.65%), Query Frame = -3
Query:  201 KQSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSCNRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLL 476
            KQS+     T   +   +KAVQVLG LFGLFLLCYLPFF++Y+ DFFC  C      ++   EW+GYSASMLNP+VYHIFNP F+ TF RL+
Sbjct:  393 KQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLM 484          
The following BLAST results are available for this feature:
BLAST of SMED30006914 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HTR2A3.433e-2438.425-hydroxytryptamine receptor 2A [Source:HGNC Symbo... [more]
HTR2A3.433e-2438.425-hydroxytryptamine receptor 2A [Source:HGNC Symbo... [more]
HTR2B1.606e-1937.955-hydroxytryptamine receptor 2B [Source:HGNC Symbo... [more]
HTR2C3.045e-1539.525-hydroxytryptamine receptor 2C [Source:HGNC Symbo... [more]
HTR2C3.045e-1539.525-hydroxytryptamine receptor 2C [Source:HGNC Symbo... [more]
back to top
BLAST of SMED30006914 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ser-11.731e-1734.72SERotonin/octopamine receptor family; Serotonin re... [more]
ser-12.075e-1734.72SERotonin/octopamine receptor family; Serotonin re... [more]
octr-11.056e-1435.44OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
tyra-31.134e-1437.82TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
octr-11.191e-1435.44OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
back to top
BLAST of SMED30006914 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
5-HT2B2.146e-1943.75gene:FBgn0261929 transcript:FBtr0303603[more]
5-HT2B2.146e-1943.75gene:FBgn0261929 transcript:FBtr0339322[more]
5-HT2B2.356e-1943.75gene:FBgn0261929 transcript:FBtr0330144[more]
Oct-TyrR1.292e-1636.51gene:FBgn0004514 transcript:FBtr0078479[more]
Oct-TyrR1.292e-1636.51gene:FBgn0004514 transcript:FBtr0301930[more]
back to top
BLAST of SMED30006914 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr2ab7.110e-2340.265-hydroxytryptamine (serotonin) receptor 2A, genom... [more]
htr2cl13.474e-2041.245-hydroxytryptamine (serotonin) receptor 2C, G pro... [more]
htr2cl13.474e-2041.245-hydroxytryptamine (serotonin) receptor 2C, G pro... [more]
htr2cl13.486e-2041.245-hydroxytryptamine (serotonin) receptor 2C, G pro... [more]
htr2aa8.391e-2041.075-hydroxytryptamine (serotonin) receptor 2A, genom... [more]
back to top
BLAST of SMED30006914 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a294.951e-2238.86solute carrier family 25 (mitochondrial carnitine/... [more]
slc25a295.242e-2238.86solute carrier family 25 (mitochondrial carnitine/... [more]
slc25a295.555e-2238.86solute carrier family 25 (mitochondrial carnitine/... [more]
slc25a295.650e-2238.86solute carrier family 25 (mitochondrial carnitine/... [more]
HTR2C4.256e-2040.005-hydroxytryptamine (serotonin) receptor 2C, G pro... [more]
back to top
BLAST of SMED30006914 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Htr2a4.827e-2438.425-hydroxytryptamine (serotonin) receptor 2A [Sourc... [more]
Htr2b4.188e-2337.245-hydroxytryptamine (serotonin) receptor 2B [Sourc... [more]
Htr2c3.994e-2140.565-hydroxytryptamine (serotonin) receptor 2C [Sourc... [more]
Htr2c3.994e-2140.565-hydroxytryptamine (serotonin) receptor 2C [Sourc... [more]
Htr2c4.012e-1844.545-hydroxytryptamine (serotonin) receptor 2C [Sourc... [more]
back to top
BLAST of SMED30006914 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P50129|5HT2A_PIG2.579e-2438.985-hydroxytryptamine receptor 2A OS=Sus scrofa OX=9... [more]
sp|Q75Z89|5HT2A_BOVIN1.533e-2338.425-hydroxytryptamine receptor 2A OS=Bos taurus OX=9... [more]
sp|Q5R4Q6|5HT2A_PONPY1.649e-2338.425-hydroxytryptamine receptor 2A OS=Pongo pygmaeus ... [more]
sp|P50128|5HT2A_MACMU1.649e-2338.425-hydroxytryptamine receptor 2A OS=Macaca mulatta ... [more]
sp|P28223|5HT2A_HUMAN1.649e-2338.425-hydroxytryptamine receptor 2A OS=Homo sapiens OX... [more]
back to top
BLAST of SMED30006914 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203006712.213e-5961.03tr|A0A193KUM1|A0A193KUM1_SCHMD GCR037 OS=Schmidtea... [more]
gnl|BL_ORD_ID|203435373.222e-4642.27tr|A0A193KU74|A0A193KU74_SCHMD GCR027 OS=Schmidtea... [more]
gnl|BL_ORD_ID|184674946.640e-3649.07tr|A0A0K0PUK1|A0A0K0PUK1_PLADU Orphan G-protein co... [more]
gnl|BL_ORD_ID|157279008.872e-3349.14tr|R7UD50|R7UD50_CAPTE G_PROTEIN_RECEP_F1_2 domain... [more]
gnl|BL_ORD_ID|214244491.759e-3249.46tr|A0A1S8WK07|A0A1S8WK07_9TREM 7 transmembrane rec... [more]
back to top
BLAST of SMED30006914 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr2ab1.062e-2338.955-hydroxytryptamine (serotonin) receptor 2A, genom... [more]
htr2cl12.008e-1944.885-hydroxytryptamine receptor 2C-like [Source:NCBI ... [more]
htr2b8.931e-1841.895-hydroxytryptamine (serotonin) receptor 2B, G pro... [more]
htr2cl22.898e-1730.585-hydroxytryptamine (serotonin) receptor 2C, G pro... [more]
ENSAMXT00000030313.15.204e-1742.03pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30006914 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006953.12.259e-2044.70pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 ge... [more]
ENSPMAT00000004593.13.676e-1946.56pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1... [more]
si:dkey-247m21.31.067e-1441.96si:dkey-247m21.3 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
HTR1F3.799e-1336.465-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
ENSPMAT00000001357.19.386e-1338.73pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 g... [more]
back to top
BLAST of SMED30006914 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006914 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO473591.266e-1333.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344093.607e-1130.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352119.853e-1032.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325141.011e-932.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371442.260e-832.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30006914 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr2aa3.244e-2343.545-hydroxytryptamine receptor 2A [Source:NCBI gene;... [more]
htr2cl17.594e-2240.005-hydroxytryptamine receptor 2C-like [Source:NCBI ... [more]
htr2cl17.594e-2240.005-hydroxytryptamine receptor 2C-like [Source:NCBI ... [more]
htr2b1.022e-1942.865-hydroxytryptamine receptor 2B [Source:NCBI gene;... [more]
ENSORLT00000005282.22.952e-1540.74pep primary_assembly:ASM223467v1:9:8571029:8576106... [more]
back to top
BLAST of SMED30006914 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001324.10.000e+099.81SMESG000001324.1[more]
SMESG000001324.10.000e+099.81SMESG000001324.1[more]
SMESG000065390.14.487e-6361.03SMESG000065390.1[more]
SMESG000032679.14.015e-5257.87SMESG000032679.1[more]
SMESG000032682.16.540e-5157.87SMESG000032682.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006914 ID=SMED30006914|Name=SMED30006914|organism=Schmidtea mediterranea sexual|type=transcript|length=2230bp
CAAATTTGAGCCTAATAGGAGGGGTTCTTTTTTTGTGTTTATTAAAATTT
TTTTGTAATAAATTCTGTTCAGTGGCTGAACTTCATATAAACAAATTATA
ATTATTTATATTTTTAAAAATAATTTTCAATGAAAAAAAATCCTCAAACA
AAACTGCTTAAGTTATGTGGATTATTTCTGGATTTCTGACAATTTCCATG
AAGAAGTCGTCGAAATGTCATTTTGAAAATTGGATTAAATATATGATAAA
CAACTGGATTAAGCATTGACGCTGAATATCCCACCCATTCTAAATGCCGA
ATTACGTCTTTCAATGATCTATTACATGAGGGACAGAAGAAATCAAAAAT
ATACACTAAGAAAAACGGCAAATAACAAAGCAGAAAAAGACCAAATAGCG
TTCCCAATACTTGCACGGCTTTTCGACTTTTTCTAATATTTCTTTTCGTG
TGATTTTGAAATCTTTGACTTTGCTTGCTTGTCATGGACAACAGAGGAAC
ATTATTAAATTTCATTCTATCTGTTAGTTTTAATGGATATTTTGGAAAAC
ATTTGATTGGAGATTTTTCAATACTGGCAGATTTGTTCTTTAAGAAAGGG
GTTGAAGCATTAAGAGGTCGGTAATTTAATGAGAGTGAATCCTGTGAAAC
TAATGTGTGATTTTGTTCAATTGTTACTGTTAATGTCTCAGCACTGACTT
GGTTTTTTTCGGATTCATCTGTGAAATGATTTGTTTGTTCTGTTGGTAGG
TGAAGCATTTCAGGCCGATCCAATGCTCTTGTCTCATCATAGCTTATTGT
TCGAGCTAATTGGGGTCGAGTATTATCTACTTTGAGATACATAATGTTTG
ACAAAAAATGTTGCTTTGGTATATTCTGATCAGAAAATCTTTGATCCTTT
TCTATAGAATAATAAGAAGAACATAGATGTTGAGTGTTAAAATCAATAGA
AGATCTCGGCCTGTAAAGAGTGTCAAGAGTTTTGATATAATTTTCTTCAT
CATAACTGTGGAAAATGTTTTGCAGTTTCAAAGTTTTCTTTGAATCTAGC
TCATAGTTTTCATCTGAATTCATTTTTACCAAAGAAAAAGTTGATTGAGG
AAAACATTTTCTTTCTTTAGAACTTTTGTATGGTTTGCCATTCATGTTAA
TCATCGGTTTTAGTTCATATTTTTCTGAATAATGATAACTACTGTTAGAT
CCTTCAAGTGACGTATCGCAGCTGCCATTTTGCACGCACATGTTTCTTTT
GGTTTTCGAATGGCTGAAAAACTCAAATTTCGACAACGCCGGGGACTTAA
TTGGATTGTTTATCATCATTTCATCAAATCGTCTTGTTTGAACGATAATT
GTATGGACCGTTAGAATGTAAGTGATTATCATAATTATTAATGGTATAAC
AAATGTGACTATTACGGCTGTCAGTATAAAAAGTGCACTTTGCGGTCCAC
AACCTTTGTATGATCCGTTTGTTCGATCTAAATATATTGCAAGAATAAAC
AACGGACAAGCAATCGAAAAAGGAATTATCCATGAAGCAAAGATTTTCAA
ATAAAGCCTGGATGATTGATGCTTGTCTCTTCTGTATTTCAAAGGATTGT
TCAGAGCGAAATACCGATCAAGGGATATAGTGCACAGGTGAATGATCGTA
GTAGCTGTAAAGAACACATCGAGGCTGAACCAAGCAAGGCAAACTTCATT
TGGCCAATTATTTGCTATATCAGCCTTAACCATCATCATAGCAGAGACAG
GCATCACCAGAGTGGCACTCAGTAAGTCACTAACCGCCAGTGAAACAAGA
AAGTAATTGAAACGATTCTGAAGTCGTTTTTCAACATGAACAGATAGAGC
GACAAGTACATTTCCACAAATGGTTATTATTGGAATGATAAATAATCCTA
AATTGATCCAATTTGCAGATTGGATCTCTGATTCGGTTGTGTTTTTTGTC
GAAAGATTACTAGAAATGCTCATTGTTATCGTCGATGATATAAAATCGCC
TTTCGTATCAGGAGCTCTCAATCTGATCTGAATAGAATGAATCTCATTGT
TGTGATTTTTGATTTGCAGAGTCAGCTGAGATATTGCATTTTCACCAATC
ACTTTTCATTGAATTTGGGTTGGATTATTTTTCGGTTGAATTTTCTGACT
TTCTTCCTTGGAAATTCAACTGAAATAGCTTGACAAATGAATATTTCATG
ATTTATTAAATTTAAATTAAATTAAATTAA
back to top

protein sequence of SMED30006914-orf-1

>SMED30006914-orf-1 ID=SMED30006914-orf-1|Name=SMED30006914-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=610bp
MSISSNLSTKNTTESEIQSANWINLGLFIIPIITICGNVLVALSVHVEKR
LQNRFNYFLVSLAVSDLLSATLVMPVSAMMMVKADIANNWPNEVCLAWFS
LDVFFTATTIIHLCTISLDRYFALNNPLKYRRDKHQSSRLYLKIFASWII
PFSIACPLFILAIYLDRTNGSYKGCGPQSALFILTAVIVTFVIPLIIMII
TYILTVHTIIVQTRRFDEMMINNPIKSPALSKFEFFSHSKTKRNMCVQNG
SCDTSLEGSNSSYHYSEKYELKPMINMNGKPYKSSKERKCFPQSTFSLVK
MNSDENYELDSKKTLKLQNIFHSYDEENYIKTLDTLYRPRSSIDFNTQHL
CSSYYSIEKDQRFSDQNIPKQHFLSNIMYLKVDNTRPQLARTISYDETRA
LDRPEMLHLPTEQTNHFTDESEKNQVSAETLTVTIEQNHTLVSQDSLSLN
YRPLNASTPFLKNKSASIEKSPIKCFPKYPLKLTDRMKFNNVPLLSMTSK
QSQRFQNHTKRNIRKSRKAVQVLGTLFGLFLLCYLPFFLVYIFDFFCPSC
NRSLKDVIRHLEWVGYSASMLNPVVYHIFNPIFKMTFRRLLHGNCQKSRN
NPHNLSSFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR017452GPCR_Rhodpsn_7TM
IPR000276GPCR_Rhodpsn
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 102..124
score: 29.44
coord: 139..160
score: 19.91
coord: 183..206
score: 26.55
coord: 558..584
score: 26.33
coord: 55..76
score: 38.35
coord: 519..543
score: 27.52
coord: 22..46
score: 22.38
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 37..576
e-value: 2.3E-51
score: 174.7
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 108..124
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 508..590
e-value: 9.3E-25
score: 89.6
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 214..291
e-value: 3.9E-51
score: 176.3
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 426..507
e-value: 9.3E-25
score: 89.6
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 29..213
e-value: 3.9E-51
score: 176.3
NoneNo IPR availablePANTHERPTHR24247:SF205D(4) DOPAMINE RECEPTORcoord: 9..597
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 9..597
NoneNo IPR availableCDDcd150527tmA_5-HT2coord: 509..587
e-value: 4.76386E-14
score: 70.4198
NoneNo IPR availableCDDcd150527tmA_5-HT2coord: 21..209
e-value: 2.63596E-60
score: 199.847
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 20..601
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 182..204
NoneNo IPR availableTMHMMTMhelixcoord: 520..542
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 557..579
NoneNo IPR availableTMHMMTMhelixcoord: 140..162
NoneNo IPR availableTMHMMTMhelixcoord: 22..44
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 37..576
score: 34.534