G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30006908
Length (bp)1129
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30006908) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30006908) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30006908) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30006908) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006908

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30006908h1SMcG0005000 SmedASXL_010396SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30006908h1SMcG0005000 dd_24149dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
pharynx tipSMED30006908h1SMcG0005000 dd_24149dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30006908h1SMcG0005000 dd_Smed_v4_24149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006908h1SMcG0005000 dd_Smed_v4_24149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006908h1SMcG0005000 dd_Smed_v4_24149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30006908h1SMcG0005000 dd_Smed_v4_24149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30006908h1SMcG0005000 dd_Smed_v6_24149_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: K1R151 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10008673 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 6.188e-17
Identity = 75/311 (24.12%), Postives = 150/311 (48.23%), Query Frame = 1
Query:   91 HVAAITCLSTSVLCCLGTIFYSIYLQKHGKSFRRAPLINRFQVYLAIANLGFCTWHLIDHIYVITSLSRL-DESVCKFIGYMFIMTFNCLGIISCFVTFSAFIIVILERKVVCVXXXXXXXXXXXXQLKFWTFDVFLWVVGTILPITISSIALACGWLGFNSQWCGIRINIPIKGNLIEIIFSGLVMWINISLSLVTYGSILFKVIRSTIRVNHIKKTDKLKKIMSTDNKNMAKRFVIFLMILFIQWFPLSTYLVFNSIGLKP-PQILMTFVITFTNLGGVFTLGIFIWTRQRAAKSVGALEMKTMTTHIE 1017
            H+ A+TC+S S +C +  +  S +  K  K+F R     RF VYLA+ + GF   H  DH++++   + +  + +C+F G+   +  +   ++   V  +AF+++   +++         +     +L  WTF           P   S++A   G LG N  +C       +KG +  + F+ + + + + +++V Y     ++ + T R+ H+  + +L     T  +NM+    +F++  FIQW+ ++ + V+  +     PQ+L   V TF+N+GG+  L +++  RQR      +L+ +  T   E
Sbjct:   33 HIPALTCISLSFICVVIVLTLS-FRHKSYKTFFRWTRSERFVVYLALCDGGFNLAHFTDHLHIVIVRNHVYPKELCEFYGFNLAVFVSAQNLMVNIVAINAFVLIYFSKQI--------PFGKKDYRLLLWTFGA---------PFLFSALAGILGQLGPNGTFCYFD---GVKGTVANLFFTTVPLALILVMNIVLYILTWIRIHKETKRL-HLGDSSQLMSANFTAARNMS----LFVVAFFIQWWAMAIFGVWAYVTPDNVPQLLFHLVTTFSNIGGILNLIVYLIIRQRLILRKRSLKQQKKTQGTE 317          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: R7U5G3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_205792 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 8.967e-16
Identity = 73/310 (23.55%), Postives = 141/310 (45.48%), Query Frame = 1
Query:   91 HVAAITCLSTSVLCCLGTIFYSIYLQKHGKSFRRAPLINRFQVYLAIANLGFCTWHLIDHIYVITSLSRLDESVCKFIGYMFIMTF-NCLGIISCFVTFSAFIIVILERKVVCVXXXXXXXXXXXXQLKFWTFDVFLWVVGTILPITISSIALACGWLGFNSQWCGIRINIPIKGNLIEIIFSGLVMWINISLSLVTYGSILFKVIRSTIRVNHIKKTDKLKKIMSTDNKNMAKRFVIFLMILFIQWFPLSTYLVFNSIGLKPPQILMTFVITF-TNLGGVFTLGIFIWTRQR-AAKSVGALEMKTMTTH 1011
            H+AAI+ LS S+    G + Y +++    K+  + P+  R  VYLA+ +L F   H +DH Y++  L    + VC    + F+ TF     ++  F + +A  +V+LE++                 L     D  L+ +   +P+T+  I +A  +LG    WC + +  P  G ++  ++ G+ M +  +++ V YG+I  ++ R+ +      KT              AK  ++F+ +   QW+      +++  G  PP + +  +  F  NLGGV+   ++   R++ +  +  + E  T   H
Sbjct:   22 HIAAISSLSISIFTSSGVLIY-LFVTSTVKNLWKKPIGERLVVYLAVYDLCFSVTHELDHGYMLAVLDNPPDPVCMPFAF-FLQTFIMAQALLVLFTSVNAMYMVVLEKR-----------------LNLGERDWKLFAITLGVPVTVGFIGVAVPFLGPTGSWCMVDMR-PWYGPIVNTVY-GMTMVLVFAVNAVCYGAIYLRIRRAAM------KTAASSSNQGNKYHKAAKLMMLFVAVYLFQWWTYVAQALWSFAG--PPAVELYILSVFLINLGGVYNALVYTIIRKKYSGAAADSEEASTRKAH 302          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: K1QBZ6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10015086 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 9.862e-16
Identity = 77/325 (23.69%), Postives = 145/325 (44.62%), Query Frame = 1
Query:   79 YHASHVAAITCLSTSVLCCLGTIFYSIYLQKHGKSFRRAPLINRFQVYLAIANLGFCTWHLIDHIYVITSLSRL-DESVCKFIGYMFIMTFNCLGIISCFVTFSAFIIVILERKVVCVXXXXXXXXXXXXQLKFWTFDVFLWVVGTILPITISSIALACGWLGFNSQWCGIRINIPIKGNLIEIIFSGLVMWINISLSLVTYGSILFKVIRSTIRVNHIKKTDKLKKIMSTDNKNMAKRFVIFLMILFIQWFPLSTYLVFNSIGLKPPQILMTFVITFTNLGGVFTLGIFIWTRQRAAKSVGALEMKTMTTHIEK*RKNGLDIEN 1050
            +++ H+ AITC+  S +  +  +  S+ LQ   K+F       RF VYLA+ +  F   H +DH +++ + + +  + +C+F G+M         ++   V  + F+++  ++                  L F ++D  L +    LP    S+A   G LG N  +C       +KG L+ + F+ + +   + +++V Y     K+   + R+ H    +      S      AK   +F+   F QW+ ++ Y ++  I    PQ L  FV TF+N+GG+    ++I  R+R A +  A +M T     +  +     +EN
Sbjct:   41 FYSIHIPAITCIILSFISVVAILVASLRLQSI-KTFFSWTKSERFVVYLALCDGLFNVAHSMDHTHIVLTRNHVYPKELCEFYGFMLAEFITAQNLMVNVVALNVFVLIYFKK-----------------DLNFGSYDYRLLLYTFGLPCAGGSVAAYFGTLGPNGTFCYFD---GVKGELVNVFFTTVPLLAVLLMNIVFYAMTWRKISTESRRLQHTLGQEAATIRASLQ---AAKTMSLFVTAFFAQWWAMALYGIWQMIA-PVPQSLFQFVTTFSNIGGILNGVVYIIIRRRRA-TAKAKKMATKEKQFQDIKSVSEKVEN 339          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: K1R1R2 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10027331 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.015e-14
Identity = 71/299 (23.75%), Postives = 141/299 (47.16%), Query Frame = 1
Query:   79 YHASHVAAITCLSTSVLCCLGTIFYSIYLQKHGKSFRRAPLINRFQVYLAIANLGFCTWHLIDHIYV-ITSLSRLDESVCKFIGYMFIMTFNCLGIISCFVTFSAFIIVILERKVVCVXXXXXXXXXXXXQLKFWTFD--VFLWVVGTILPITISSIALACGWLGFNSQWCGIRINIPIKGNLIEIIFSGLVMWINISLSLVTYGSILFKVIRSTIRVNHIKKTDKLKKIMSTDNKNMAKRFVIFLMILFIQWFPLSTYLVFNSIGLKP-PQILMTFVITFTNLGGVFTLGIFIWTRQR 963
            +++ H+ A+ C+  S    + TI  S + QK  K+F       R  VYLA+ +  F   H +DH+++ IT      + +C+F G+M  +  +   ++   +  +AF+++ + R                 Q+KF   D  + LW  G   P   ++IA   G LG N  +C       +K  +   +F+ + + I + L+ + YG  L ++ +   +   IKKT   + +++      A+   +F+++  IQW+ ++ Y ++  I     P  +   V TF+N+GG+    ++I+ ++R
Sbjct:   27 FYSLHIPALICIFLSFASAILTIVLS-FRQKSFKTFFSWSKSERLVVYLAVCDAAFNMAHSMDHLHILITKDHVYPKELCQFYGFMLAVFISAQNLMVNVIAVNAFVLIFIGR-----------------QIKFGLKDYRLLLWTFGA--PFVCATIAALAGQLGPNGSFCYFD---GVKRTISNFLFTTVPLTIILLLNSILYGVTLREIYK---KEKDIKKTLGKQALITEMRHAAARAMSVFVLVFLIQWWAMAVYGLWTFIDPAAVPATIYHLVTTFSNIGGLLNFLVYIYIKRR 299          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: K1RBV9 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10027332 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.832e-14
Identity = 85/328 (25.91%), Postives = 152/328 (46.34%), Query Frame = 1
Query:   79 YHASHVAAITCLSTSVLCCLGTIFYSIYLQKHGKSFRRAPL--------INRFQVYLAIANLGFCTWHLIDHIYVITSLSRL-DESVCKFIGYMFIMTFNCLGIISCFVTFSAFIIVILERKVVCVXXXXXXXXXXXXQLKFWTFD--VFLWVVGTILPITISSIALACGWLGFNSQWCGIRINIPIKGNLIEIIFSGL----VMWINISLSLVTYGSILFKVIRSTIRVNHIKKTDKLKKIMSTDNKNMAKRFVIFLMILFI-QWFPLSTY--LVFNSIGLKPPQILMTFVITFTNLGGVFTLGIFIWTRQRAAKSVGALEMKTMTT 1008
            +++ HV A+TC+  S++  + TI  S         FR+ P           RF VY+AI +  F   H +DH+++ T+ S +   S+C+F G M +        +   V  +AF ++I  +                 QLKF   D  + LW+ G   P  +S IALA    G N  +C       + G L + + + L    ++ +N +L ++T+  +  + I   ++++  K++   K       K+ A R +   ++ FI QW+ ++ +   VF + G  PP I  T V TF+N+GG+  LG+++  R+R      A   ++ +T
Sbjct:   43 FYSLHVPALTCIFLSLISAILTITLS---------FRKIPRRAFFDWTKSERFIVYMAICDGAFNVAHSMDHLHIATTKSHVYPASLCQFYGVMLLEFIMAQTFMVNIVAVNAFTLMIFNK-----------------QLKFGKRDWRLLLWIFG--FPFLLSMIALAAKQFGPNGSFCFFD---GVNGELAQFLLTTLPLSVILIVNATLYVITWAKL--RSIEKHLKLSLGKQSSGSKM------KHAAVRAMSLFVLAFIFQWWAMALFGIWVFANPGSVPPAIHHT-VTTFSNVGGIVNLGVYLLIRKRVQYQGSASSDQSHST 330          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000060818.1 (SMESG000060818.1)

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 298/316 (94.30%), Postives = 299/316 (94.62%), Query Frame = 1
Query:   73 DFYHASHVAAITCLSTSVLCCLGTIFYSIYLQKHGKSFRRAPLINRFQVYLAIANLGFCTWHLIDHIYVITSLSRLDESVCKFIGYMFIMTFNCLGIISCFVTFSAFIIVILERKVVCVXXXXXXXXXXXXQLKFWTFDVFLWVVGTILPITISSIALACGWLGFNSQWCGIRINIPIKGNLIEIIFSGLVMWINISLSLVTYGSILFKVIRSTIRVNHIKKTDKLKKIMSTDNKNMAKRFVIFLMILFIQWFPLSTYLVFNSIGLKPPQILMTFVITFTNLGGVFTLGIFIWTRQRAAKSVGALEMKTMTTHIEK 1020
            DFYHASHVAAITCLSTSVLCCLGTIFYSIYLQKHGKSFRRAPLINRFQVYLAIANLGFCTWHLIDHIYVITSLSRLDESVCKFIGYMFIMTFNCLGIISCFVTFSAFIIVILERK                 LKFWTFDVFLWVVGTILPITISSIALACGWLGFNSQWCGIRINIPIKGNLIEIIFSGLVMWINISLSLVTYGSILFKVIRSTIRVNHIKKTDKLKKIMSTDNKNMAKRFVIFLMILF+QWFPLSTYLVFNSIGLKPPQILMTFVITFTNLGGVFTLGIFIWTRQRAAKSVGALEMKTMTTHIEK
Sbjct:   13 DFYHASHVAAITCLSTSVLCCLGTIFYSIYLQKHGKSFRRAPLINRFQVYLAIANLGFCTWHLIDHIYVITSLSRLDESVCKFIGYMFIMTFNCLGIISCFVTFSAFIIVILERK-----------------LKFWTFDVFLWVVGTILPITISSIALACGWLGFNSQWCGIRINIPIKGNLIEIIFSGLVMWINISLSLVTYGSILFKVIRSTIRVNHIKKTDKLKKIMSTDNKNMAKRFVIFLMILFVQWFPLSTYLVFNSIGLKPPQILMTFVITFTNLGGVFTLGIFIWTRQRAAKSVGALEMKTMTTHIEK 311          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000059407.1 (SMESG000059407.1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.847e-19
Identity = 55/180 (30.56%), Postives = 92/180 (51.11%), Query Frame = 1
Query:  469 LKFWTFDVFLWVVGTILPITISSIALACGWLGFNSQWCGIRINIPIKGNLIEIIFSGLVMWINISLSLVTYGSILFKVIRSTIRVNHIKKTDKLKKIMSTDNKNMAKRFVIFLMILFIQWFPLSTYLVFNSIGLKPPQILMT-FVITFTNLGGVFTLGIFIWTRQRAAKSVGALEMKTMT 1005
            L FW FD+    +G  +P+ +  + L  GW+GFN   C I   +     +I  IF  L +W N  L+++ Y +I+ K+I S+ R+  +   +  K   ++ +K    RFVIF++ LFIQW PLS   V+   G+    +++  FV+  TN GG+  L  ++  R+       +  + T T
Sbjct:   39 LPFWKFDLITVSIGFGIPLIMHIVGLCYGWIGFNGFVCVISQGLS-NALIINFIFGTLFLWSNFILTIICYSTIVGKLIISSSRIQKLMNQNTSKNNSNSVHKTTTVRFVIFVLALFIQWLPLSILWVYQMQGINDTDLMLNFFVVLLTNTGGMINLIYYLSFRRPKVAPQASQSVVTST 217          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000059417.1 (SMESG000059417.1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.188e-14
Identity = 48/137 (35.04%), Postives = 76/137 (55.47%), Query Frame = 1
Query:  616 LIEIIFSGLVMWINISLSLVTYGSILFKVIRSTIRVNHIKKTDKL--KKIMSTDNKNMAK---RFVIFLMILFIQWFPLSTYLVFNS-IGLKPPQILMTFVITFTNLGGVFTLGIFIWTRQRAAKSVGALEMKTMTT 1008
            ++ + + GL MW+N   S + Y +I+ K+I ST RV  +     L  +K  + D     K   RF+IF++ LFIQW PLS YLV+   I ++ P +L+  V  F+N+GG+  L  ++  R+R      A   +T+TT
Sbjct:    1 MLYLFYGGLFMWLNFISSFICYSAIIGKLIISTSRVQALTANKNLNSQKHNNPDKSLQMKTTLRFMIFMLALFIQWLPLSIYLVYQMLITVEIPLVLVGMVTIFSNIGGIINLIYYMSFRKRKVGPTAA-RPQTVTT 136          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000058044.1 (SMESG000058044.1)

HSP 1 Score: 60.077 bits (144), Expect = 3.603e-11
Identity = 37/115 (32.17%), Postives = 64/115 (55.65%), Query Frame = 1
Query:  646 MWINISLSLVTYGSILFKVIRSTIRVNHIKKTDKLKKIMSTD-NKNMAKRFVIFLMILFIQWFPLSTYLVFNSIG-LKPPQILMTFVITFTNLGGVFTLGIFIWTRQRAAKSVGA 984
            MW+N   SL+ Y +I+ K+I S++R+  +   + L +  + D  K +  RF+IF++ LFIQW PLS + +    G  + P  L   V+ FTN GG+  L  ++  R++   +  +
Sbjct:    1 MWLNFLFSLICYSAIIGKLITSSMRLKRLLN-ENLSRTNNIDIKKKLTVRFLIFILALFIQWLPLSIFWIIQMAGQYETPLWLNLMVVLFTNTGGIINLLYYLTFRRQKVYTTSS 114          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000058046.1 (SMESG000058046.1)

HSP 1 Score: 54.6842 bits (130), Expect = 6.000e-9
Identity = 36/117 (30.77%), Postives = 62/117 (52.99%), Query Frame = 1
Query:  616 LIEIIFSGLVMWINISLSLVTYGSILFKVIRSTIRVNHIKKTDKLKKIMSTDNKNMAKRFVIFLMILFIQWFPLSTYLVFNSIGLKPPQILMTFVITFTNLGGVFTLGIFIWTRQRA 966
            ++ +++ G V+ IN  +++  Y +I  K+I ++ RVN +      K   + D +    RF+IF++  FIQW P S + V  +    PP  L+  V+ F NLGGV   G ++  R+  
Sbjct:   21 ILNLLYGGAVVCINFVITVFCYIAITIKLIVTSDRVNKLMSK---KSTTTNDTRKTTLRFMIFVLCFFIQWLPFSLFTVLET----PPTNLILVVVVFCNLGGVINSGYYLAFRKSG 130          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1R1516.188e-1724.12Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
R7U5G38.967e-1623.55G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
K1QBZ69.862e-1623.69G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
K1R1R21.015e-1423.75G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
K1RBV93.832e-1425.91G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060818.10.000e+094.30SMESG000060818.1[more]
SMESG000059407.12.847e-1930.56SMESG000059407.1[more]
SMESG000059417.11.188e-1435.04SMESG000059417.1[more]
SMESG000058044.13.603e-1132.17SMESG000058044.1[more]
SMESG000058046.16.000e-930.77SMESG000058046.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006908 ID=SMED30006908|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1129bp
TTTATTTTGTCTATTTAGAAAACTTTAAATCGAACTGTTGATTATGTTTC
TTTTGAAAATTTATTTTTTTAGGATTTTTACCACGCAAGCCACGTCGCAG
CGATAACGTGCTTGTCGACGAGTGTTCTTTGCTGTCTAGGAACTATATTT
TATTCCATATATCTTCAGAAACACGGAAAGTCTTTCCGCAGAGCTCCTTT
GATCAATCGGTTTCAGGTTTACTTGGCCATTGCAAACTTGGGATTTTGCA
CCTGGCACTTGATAGATCATATTTATGTGATAACCTCTTTATCACGGCTT
GATGAATCGGTTTGTAAGTTCATAGGATATATGTTTATAATGACATTCAA
TTGCCTGGGCATTATTTCGTGCTTTGTGACATTCTCCGCGTTTATAATCG
TGATTTTGGAAAGAAAGGTAGTTTGTGTCTTTCTTTTTATTTCGTTTTGG
TTTTCTTCTATTTTACAGTTGAAATTCTGGACCTTCGACGTGTTCCTTTG
GGTAGTGGGAACTATCTTACCGATAACCATTTCATCTATTGCTTTAGCTT
GTGGTTGGCTGGGATTCAACTCTCAGTGGTGCGGAATTCGGATAAATATC
CCAATAAAAGGCAACTTAATTGAGATAATATTCAGTGGACTTGTCATGTG
GATTAATATTTCTTTGTCTCTCGTAACGTATGGGAGCATTCTATTTAAAG
TGATACGATCAACGATCAGAGTCAATCATATTAAGAAAACTGATAAATTG
AAGAAAATAATGAGCACTGATAATAAGAATATGGCGAAACGTTTTGTTAT
TTTCCTCATGATATTGTTTATTCAGTGGTTTCCATTGTCGACTTATTTGG
TGTTCAACTCAATCGGATTGAAACCTCCTCAGATATTAATGACATTTGTC
ATTACTTTTACTAATCTAGGGGGAGTTTTCACCCTAGGGATTTTCATCTG
GACCAGACAGAGAGCAGCGAAATCGGTTGGCGCGTTAGAAATGAAAACCA
TGACTACTCATATAGAAAAATGAAGGAAAAACGGTTTAGATATTGAGAAT
TTTCTTTCATCTTTTTTTACTTACAAATGTCAGCAGAAAATTTCATTTTT
CATCAGTTTTTAATAAATATAAGATCGGA
back to top

protein sequence of SMED30006908-orf-1

>SMED30006908-orf-1 ID=SMED30006908-orf-1|Name=SMED30006908-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=231bp
MFIMTFNCLGIISCFVTFSAFIIVILERKVVCVFLFISFWFSSILQLKFW
TFDVFLWVVGTILPITISSIALACGWLGFNSQWCGIRINIPIKGNLIEII
FSGLVMWINISLSLVTYGSILFKVIRSTIRVNHIKKTDKLKKIMSTDNKN
MAKRFVIFLMILFIQWFPLSTYLVFNSIGLKPPQILMTFVITFTNLGGVF
TLGIFIWTRQRAAKSVGALEMKTMTTHIEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002074pharynx tip
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 7..26
NoneNo IPR availableTMHMMTMhelixcoord: 30..52
NoneNo IPR availableTMHMMTMhelixcoord: 185..207
NoneNo IPR availableTMHMMTMhelixcoord: 155..175
NoneNo IPR availableTMHMMTMhelixcoord: 99..121