Innexin

Overview
NameInnexin
Smed IDSMED30006907
Length (bp)1563
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30006907) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30006907) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30006907) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30006907) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006907

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30006907h1SMcG0006554 SmedASXL_001826SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30006907h1SMcG0006554 dd_Smed_v4_10567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006907h1SMcG0006554 dd_Smed_v4_10567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006907h1SMcG0006554 dd_Smed_v4_10567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30006907h1SMcG0006554 dd_Smed_v6_10567_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 265.388 bits (677), Expect = 6.286e-84
Identity = 136/375 (36.27%), Postives = 228/375 (60.80%), Query Frame = 2
Query:  290 IFFRIGQLFRVPYGGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWR---VWSRRVPI--LLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYK 1399
            + + +  +F+  +     DFVD+LNY +TS ++  F II+  +QYVG PIQCWVP +FT +WE+Y EN CWV+NTY+ LP       ++   + R ISYYQWV  VLA +A+  ++P ++WR    W   + +  L + A +A   D + R   +  +   +E+  E     R++  + G C+        VTLL++F+++L++ N V Q+FM+  F+GT+   +G  + RDLLNG E ++S  FPRVT C  +VR +G +    +T+QCVL IN F EK+++FLWFW+ +++ ++ ++   W +   LP + ++F+R+YL+A  +  +TD +   +FV K LG DG+F ++ +S  + D++A ++   LW+N+ 
Sbjct:    2 LLYYLAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYY-LPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQ---REVTDVSGMCVQK-RWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVH--HHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFN 367          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 265.388 bits (677), Expect = 6.286e-84
Identity = 136/375 (36.27%), Postives = 228/375 (60.80%), Query Frame = 2
Query:  290 IFFRIGQLFRVPYGGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWR---VWSRRVPI--LLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYK 1399
            + + +  +F+  +     DFVD+LNY +TS ++  F II+  +QYVG PIQCWVP +FT +WE+Y EN CWV+NTY+ LP       ++   + R ISYYQWV  VLA +A+  ++P ++WR    W   + +  L + A +A   D + R   +  +   +E+  E     R++  + G C+        VTLL++F+++L++ N V Q+FM+  F+GT+   +G  + RDLLNG E ++S  FPRVT C  +VR +G +    +T+QCVL IN F EK+++FLWFW+ +++ ++ ++   W +   LP + ++F+R+YL+A  +  +TD +   +FV K LG DG+F ++ +S  + D++A ++   LW+N+ 
Sbjct:    2 LLYYLAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYY-LPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQ---REVTDVSGMCVQK-RWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVH--HHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFN 367          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 264.233 bits (674), Expect = 7.665e-83
Identity = 136/375 (36.27%), Postives = 228/375 (60.80%), Query Frame = 2
Query:  290 IFFRIGQLFRVPYGGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWR---VWSRRVPI--LLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYK 1399
            + + +  +F+  +     DFVD+LNY +TS ++  F II+  +QYVG PIQCWVP +FT +WE+Y EN CWV+NTY+ LP       ++   + R ISYYQWV  VLA +A+  ++P ++WR    W   + +  L + A +A   D + R   +  +   +E+  E     R++  + G C+        VTLL++F+++L++ N V Q+FM+  F+GT+   +G  + RDLLNG E ++S  FPRVT C  +VR +G +    +T+QCVL IN F EK+++FLWFW+ +++ ++ ++   W +   LP + ++F+R+YL+A  +  +TD +   +FV K LG DG+F ++ +S  + D++A ++   LW+N+ 
Sbjct:    2 LLYYLAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYY-LPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQ---REVTDVSGMCVQK-RWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVH--HHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFN 367          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 253.447 bits (646), Expect = 2.771e-79
Identity = 146/371 (39.35%), Postives = 214/371 (57.68%), Query Frame = 2
Query:  344 DFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPI----LLRSAREASFPDREIRRKAISCLVAALEE------QTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNED 1426
            D +D+LNY +T+ ++ VF I++  +QYVG PIQCWVP  FT   E+Y EN CWVQNTYFL  H+ +P+N  E    R I YYQWV  VLA +A++ +VP ++WR+ S +  I    L++ A ++   D E R +A+  +   +EE      Q  SG R + +  I      G    A VT L+I V+IL+  N VGQIF++  F+G     +G+ V  DL+NG E + S  FPRVT C  +V+ +G +    +T+QCVL IN F EK+++FLWFW+ +L+  T  +   W     +P R++ FV +YL  ++     D +   RFV   L  DG+FLL+ V+  + +L   ++  TLWNNY   K     D
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAEREN-RQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSG----AAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVH--RHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNKEGKMHD 385          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 240.736 bits (613), Expect = 1.698e-73
Identity = 131/382 (34.29%), Postives = 221/382 (57.85%), Query Frame = 2
Query:  290 IFFRIGQLFRVPYGGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWR---VWSRRVPI--LLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTAR----VTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITS---TDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYK 1399
            I + +   FR  Y     DFVD+LNY +T+ +L  F +++  +QYVG PIQCWVP  FT + E+Y EN CWVQNTY++   ED+P   +   + R I YYQWV  +LA +A++ +VP ++WR    W   + +  L++ A +A   D EI+ + +  +   ++++  +  R    +  F     G N        VT+L+I +++L+ AN + Q F++   +G+N+  +G ++ +DL++  E + +  FPRVT C  +VR +G I    +T+QCVL IN F EK+++FLWFWF+   I+T  NT+ W L + +P + + FVR+YL+ L    +    D+    +F    L  DG+F+L+ +S  + +L++ ++   LW ++ 
Sbjct:   63 ILYYLASAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYS-RRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDELTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIH--RHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFN 441          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 101.679 bits (252), Expect = 4.061e-23
Identity = 99/377 (26.26%), Postives = 162/377 (42.97%), Query Frame = 2
Query:  356 QLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHE------------DVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFR-DLLNGNE--GQISETFPRVTYCTI-KVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHR 1438
            +++Y+ T  +LI F +++  RQY+G PI C V +      + Y    CW+ +T F +P               V ++     +V+Y  YYQWV  VL  QA++ +VP  +W+ W      +L     +   + E +      LV                       +G +N        F     L   N +GQI+ +  F+    +T+G  V +   L  +E    ++  FP+VT CT  K    G ++  ++   CVLP+N   EK+YVFLWFWFIILSI++ ++ +     V  P  R       L+A   +  ++E   V  V         FLL  + +    LI  +V   L       +++G+E   H+
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYF--------------------IGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQ--THDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEE---VELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDL-----SREMSGDEHSAHK 362          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 101.679 bits (252), Expect = 4.061e-23
Identity = 99/377 (26.26%), Postives = 162/377 (42.97%), Query Frame = 2
Query:  356 QLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHE------------DVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFR-DLLNGNE--GQISETFPRVTYCTI-KVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHR 1438
            +++Y+ T  +LI F +++  RQY+G PI C V +      + Y    CW+ +T F +P               V ++     +V+Y  YYQWV  VL  QA++ +VP  +W+ W      +L     +   + E +      LV                       +G +N        F     L   N +GQI+ +  F+    +T+G  V +   L  +E    ++  FP+VT CT  K    G ++  ++   CVLP+N   EK+YVFLWFWFIILSI++ ++ +     V  P  R       L+A   +  ++E   V  V         FLL  + +    LI  +V   L       +++G+E   H+
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYF--------------------IGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQ--THDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEE---VELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDL-----SREMSGDEHSAHK 362          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 101.679 bits (252), Expect = 4.061e-23
Identity = 99/377 (26.26%), Postives = 162/377 (42.97%), Query Frame = 2
Query:  356 QLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHE------------DVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFR-DLLNGNE--GQISETFPRVTYCTI-KVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHR 1438
            +++Y+ T  +LI F +++  RQY+G PI C V +      + Y    CW+ +T F +P               V ++     +V+Y  YYQWV  VL  QA++ +VP  +W+ W      +L     +   + E +      LV                       +G +N        F     L   N +GQI+ +  F+    +T+G  V +   L  +E    ++  FP+VT CT  K    G ++  ++   CVLP+N   EK+YVFLWFWFIILSI++ ++ +     V  P  R       L+A   +  ++E   V  V         FLL  + +    LI  +V   L       +++G+E   H+
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYF--------------------IGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQ--THDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEE---VELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDL-----SREMSGDEHSAHK 362          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 101.679 bits (252), Expect = 4.061e-23
Identity = 99/377 (26.26%), Postives = 162/377 (42.97%), Query Frame = 2
Query:  356 QLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHE------------DVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFR-DLLNGNE--GQISETFPRVTYCTI-KVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHR 1438
            +++Y+ T  +LI F +++  RQY+G PI C V +      + Y    CW+ +T F +P               V ++     +V+Y  YYQWV  VL  QA++ +VP  +W+ W      +L     +   + E +      LV                       +G +N        F     L   N +GQI+ +  F+    +T+G  V +   L  +E    ++  FP+VT CT  K    G ++  ++   CVLP+N   EK+YVFLWFWFIILSI++ ++ +     V  P  R       L+A   +  ++E   V  V         FLL  + +    LI  +V   L       +++G+E   H+
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYF--------------------IGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQ--THDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEE---VELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDL-----SREMSGDEHSAHK 362          
BLAST of Innexin vs. Ensembl Fly
Match: shakB (gene:FBgn0085387 transcript:FBtr0112571)

HSP 1 Score: 94.7449 bits (234), Expect = 7.420e-21
Identity = 99/378 (26.19%), Postives = 164/378 (43.39%), Query Frame = 2
Query:  356 QLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFL-----------LPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCL-GGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISET---FPRVTYCTI-KVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRI 1441
            +L+Y  T  +L+ F +II  RQYVG PI C   ++     E+     CW+Q+TY L           +P+  + N+D + +  ++  YYQWV   L  QA++ + P  +W+ W                         I  L+  L+    S A  ++ K +    L   +         +    +L + N +GQ+F+M +F      TFG+ V   +    E ++      FPR+T CT  K    G+++   +   C+LP+N   EK+Y+FLWFWFI+L+ LT L  +   + +  P  RV   R   + ++       RD +  + +       FLL  +      +I  DV   L N     +L  N+   HR+
Sbjct:   25 RLHYSITVMILMSFSLIITTRQYVGNPIDCVHTKDIP---EDVLNTYCWIQSTYTLKSLFLKKQGVSVPYPGIGNSDGDPADKKHYKYYQWVCFCLFFQAILFYTPRWLWKSWEG---------------------GKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENLRYHNWWAYRYYVCELLALINVIGQMFLMNRFFDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVE--KHDAICILPLNVVNEKIYIFLWFWFILLTFLTLLTLIYRVVIIFSPRMRVYLFRMRFRLVR-------RDAIEIIVRRSKMGDWFLLYLLGENIDTVIFRDVVQDLAN-----RLGHNQH--HRV 362          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 3.525e-78
Identity = 146/371 (39.35%), Postives = 214/371 (57.68%), Query Frame = 2
Query:  344 DFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPI----LLRSAREASFPDREIRRKAISCLVAALEE------QTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNED 1426
            D +D+LNY +T+ ++ VF I++  +QYVG PIQCWVP  FT   E+Y EN CWVQNTYFL  H+ +P+N  E    R I YYQWV  VLA +A++ +VP ++WR+ S +  I    L++ A ++   D E R +A+  +   +EE      Q  SG R + +  I      G    A VT L+I V+IL+  N VGQIF++  F+G     +G+ V  DL+NG E + S  FPRVT C  +V+ +G +    +T+QCVL IN F EK+++FLWFW+ +L+  T  +   W     +P R++ FV +YL  ++     D +   RFV   L  DG+FLL+ V+  + +L   ++  TLWNNY   K     D
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAEREN-RQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSG----AAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVH--RHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNKEGKMHD 385          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 3.965e-70
Identity = 131/384 (34.11%), Postives = 222/384 (57.81%), Query Frame = 2
Query:  290 IFFRIGQLFRVPYGGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWR---VWSRRVPI--LLRSAREASFPDREIRRKAISCLVAALEEQTE--SGARFRKIKGIFGKCLGGVNPTAR----VTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITS---TDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYK 1399
            I + +   FR  Y     DFVD+LNY +T+ +L  F +++  +QYVG PIQCWVP  FT + E+Y EN CWVQNTY++   ED+P   +   + R I YYQWV  +LA +A++ +VP ++WR    W   + +  L++ A +A   D EI+ + +  +   ++++ +  +  R    +  F     G N        VT+L+I +++L+ AN + Q F++   +G+N+  +G ++ +DL++  E + +  FPRVT C  +VR +G I    +T+QCVL IN F EK+++FLWFWF+   I+T  NT+ W L + +P + + FVR+YL+ L    +    D+    +F    L  DG+F+L+ +S  + +L++ ++   LW ++ 
Sbjct:  122 ILYYLASAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYS-RRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIH--RHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFN 502          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23157|INX11_CAEEL (Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=inx-11 PE=3 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 5.232e-58
Identity = 127/392 (32.40%), Postives = 212/392 (54.08%), Query Frame = 2
Query:  335 EGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVP--NNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSR----RVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVN---PTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETT-FGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDER-------DCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNY----KRAKLAGN--EDDIHRI 1441
            E  D+ D+LNY  T  +L+ F ++I  +Q+ G+PI+C  P +F  SWE+YAEN CW Q+TYF+ P +DV     +   +  R +SYYQWV   L  QA     P  +W+ +S     R+  ++  A++++  + E+R K I  L   L       A   + K    K +  +N    +  ++ +++F ++L+  N   Q+++M  F+GTN    +G  V +D++ G   + S  FPR   C  +VR++  I+   Y++QCVL IN F EK++V LWFW++IL + +T++ VQW + +  P     FV+Q+L AL  + + ++R       D  +FV + L  DG+F+L+ VS  +  + A D+   L+  Y    K   + G+   DD+  I
Sbjct:   18 EDDDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPGSWEQYAENYCWSQDTYFVEPTQDVSLLKKEERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFSNHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERKKVQVHKTVTFLNFQYSSGFISWIYLFTKVLYFLNVFAQLYLMNYFLGTNRHHWYGFGVVQDIVQGEPWERSGYFPRAAVCDFEVRQVANIQ--RYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHL-ALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAYDFQDKNKDVQGSPVSDDLQTI 406          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 199.904 bits (507), Expect = 2.529e-57
Identity = 127/372 (34.14%), Postives = 195/372 (52.42%), Query Frame = 2
Query:  344 DFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRV----PILLRSAREASFPDREIRRKAISCLVAALEE--QTESGARFRKIKGI-FGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCV-RFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIH 1435
            D VD+L+Y  T+ LL  F I++  +QYVG  IQCW+P EF   WE+YAE+ C++QNT+F+    ++P  D E  +   I YYQWV IVLA QA M ++P  IW    ++     P ++  A      D E R K ++ LV  + +   T S   + +     FGK LG +      ++L+I ++++++AN   Q  ++ KF+G     +G   F DL  G E Q S  FPRVT C   VRK+  +    YT+QCVL IN F EK+Y+F+WFWF+ + I T +NT+     +     R  ++R  L    V    DE+  +  F    L  DG+ L++ +   +  ++  ++   L+  +    L  N D  H
Sbjct:   22 DAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGGWEQYAEDYCFIQNTFFIPERSEIP-GDVEDRQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSLYKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYRFGKGLGSM-----TSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLANVH--RYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSG-PVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGE-NLQHNRDFHH 383          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23027|INX5_CAEEL (Innexin-5 OS=Caenorhabditis elegans OX=6239 GN=inx-5 PE=3 SV=2)

HSP 1 Score: 196.823 bits (499), Expect = 5.980e-56
Identity = 122/384 (31.77%), Postives = 194/384 (50.52%), Query Frame = 2
Query:  329 GGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLL------PHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESG------ARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDC---VRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNY--KRAKLAGNEDD 1429
              E  D  D+ +YQ+TS LL    I++   QYVG+PIQCWVP +FTR+WE+YAE  C+++ TYFL           V + D  ++    + YYQW+ IVL  QA + ++P +IWR ++    + ++     S   R+I+       V A    T+ G        FR    +F +    V     +  L++ V+IL++AN V Q +++  F+ T    +G   F+DL+ G E + +  FPRVT C   +  +  +    +++QCV+ IN   EKVYVF WFW + + +LT  +   W +   L      F+  YL+      +  ER       FV K L  DG+F+ + V + S DL    + G +++ Y  + A+ A  +DD
Sbjct:   15 SAESNDIADRFSYQYTSTLLGFSAIMMAASQYVGRPIQCWVPAQFTRTWEKYAETYCFIKGTYFLPGAFASEGEMSVTSPDDAVTATPQVGYYQWIPIVLVLQAFLFYLPSIIWRTFNESCELKIKELAAVSEASRKIKSNMSDDQVKA----TKFGRYFFKKLNFRNESPVFKETGSVVASGKFLPALYLLVKILYLANIVLQFWILTYFLETKSWMWGWQTFQDLMAGREWETTGIFPRVTMCDFSIMDLTSVH--DHSIQCVIVINMLAEKVYVFFWFWLLFVGLLTVCSLAYWAVIYMLQSVGRNFIYSYLQQTPEFQTEQERGSFVPANFVDKCLTPDGVFISRLVQQNSGDLFTSIMLGEMFSLYRAREAEKAHKKDD 392          
BLAST of Innexin vs. TrEMBL
Match: Q2L6M9 (Innexin OS=Dugesia japonica OX=6161 GN=inx5 PE=2 SV=1)

HSP 1 Score: 779.245 bits (2011), Expect = 0.000e+0
Identity = 390/399 (97.74%), Postives = 398/399 (99.75%), Query Frame = 2
Query:  278 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSSTVV 1474
            MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSGLLIVFIIIIGIRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNN++ELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVR+LFIANN+GQIFMMKKFIGTNETTFGITVFRDLL+GNEGQIS TFPRVTYCTIKVRKMGQ+KPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVC+PLRRVQF+RQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSSTVV
Sbjct:    1 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSGLLIVFIIIIGIRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNEYELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRLLFIANNIGQIFMMKKFIGTNETTFGITVFRDLLDGNEGQISATFPRVTYCTIKVRKMGQVKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCVPLRRVQFIRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSSTVV 399          
BLAST of Innexin vs. TrEMBL
Match: C1LEY2 (Innexin OS=Schistosoma japonicum OX=6182 GN=inx PE=2 SV=1)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 266/394 (67.51%), Postives = 343/394 (87.06%), Query Frame = 2
Query:  278 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNR 1459
            M++    ++G+LFRVPYGGEGVDFVDQLNYQFTSG++++FI++IG RQYVGKP+ CWVPQEFT SWE+YAEN+CWVQNTYFLLP+E +P +DFE+ +VR+ISYYQWVAI+LAGQA+M+W+PH++WRVWS+RVP+LL++AREA+ PD+E+R KAISCLVAALEE +E+  R+R+ +GIF +CLGG  PT R+TLLF+ VR+ FIANN+GQI++MK FIGTN+T FG+ VF++LL G+E ++S  FPRVTYC +KVRK+GQ+KP SYTLQCVLP+NYF+EKVY+FLWFW+I+++ LT LNT  W   +CLP RRVQF+RQYLKALK ++ T+E +C RFV  NLGCDGIFLLQ+VS+ISSDLI LDVTG LW+NY+RAK+ G E++I R I+S+NR
Sbjct:    1 MDANNALKLGRLFRVPYGGEGVDFVDQLNYQFTSGIIVLFIVMIGFRQYVGKPLHCWVPQEFTSSWEDYAENICWVQNTYFLLPNEAIPEDDFEMLRVRHISYYQWVAIILAGQAMMAWIPHVLWRVWSKRVPVLLKNAREAAVPDKEVRHKAISCLVAALEEISEASKRYRRARGIFQRCLGGPPPTTRITLLFLIVRVFFIANNIGQIYVMKHFIGTNDTLFGLHVFQELLVGSEWEVSGLFPRVTYCDVKVRKLGQLKPASYTLQCVLPVNYFIEKVYIFLWFWYILMACLTILNTFLWITKLCLPYRRVQFIRQYLKALKQLSHTEETECARFVNNNLGCDGIFLLQAVSKISSDLIVLDVTGMLWSNYQRAKITGTEENIGRFIESINR 394          
BLAST of Innexin vs. TrEMBL
Match: A0A5K4F0R0 (Innexin OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 267/394 (67.77%), Postives = 342/394 (86.80%), Query Frame = 2
Query:  278 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNR 1459
            M++    ++G+LFRVPYGGEGVDFVDQLNYQFTSG++++FI++IG RQYVGKP+ CWVPQEFT SWE+YAEN+CWVQNTYFLLP+E +P +DFE+ +VR+ISYYQWVAI+LAGQA+M+WVPH++WRVWS+RVP+LL++AREA+ PD+E+R KAISCLVAALEE +E+  R+R+ +GIF +CLGG  PT R+TLLF+ VRI FIANN+GQI++MK FIGTN+T FG+ VF++LL G+E ++S  FPRVTYC +KVRK+GQ+KP SYTLQCVLP+NYF+EKVY+FLWFW+I+++ LT LNT  W   +CLP RRVQF+RQYLKALK ++ T+E +C RFV  NLG DGIFLLQ+VS+ISSDLI LDVTG LW+NY+RAK+ G E++I R I+S+NR
Sbjct:    1 MDANNALKLGRLFRVPYGGEGVDFVDQLNYQFTSGIIVLFIVMIGFRQYVGKPLHCWVPQEFTSSWEDYAENICWVQNTYFLLPNEAIPEDDFEMLRVRHISYYQWVAIILAGQAMMAWVPHVLWRVWSKRVPVLLKNAREAAVPDKEVRHKAISCLVAALEEISEASKRYRRTRGIFQRCLGGPPPTTRITLLFLIVRIFFIANNIGQIYVMKHFIGTNDTLFGLHVFQELLIGSEWEVSGLFPRVTYCDVKVRKLGQLKPASYTLQCVLPVNYFIEKVYIFLWFWYILMASLTILNTFIWITKLCLPYRRVQFIRQYLKALKQLSHTEETECARFVNNNLGWDGIFLLQAVSKISSDLIVLDVTGMLWSNYQRAKITGTEENIGRFIESINR 394          
BLAST of Innexin vs. TrEMBL
Match: A0A4E0RM26 (Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 SV=1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 267/401 (66.58%), Postives = 338/401 (84.29%), Query Frame = 2
Query:  272 SIMESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSSTVV 1474
             +++ G  F++G+LFR PYGGEGVDFVDQLNYQFT GL+I+FI II +RQYVGKPIQCWVPQEFT+SWEEYAEN+CWV NTYFLLP+E++P +  +  KV++I YYQWV IVLAGQA+M+WVPHL+WRV SRR+P+LL+SAREA+ PDRE+R KA+SCLVA LEEQ ES +RFR+IK +  +CL GV P AR+T+LF+FVR LF+AN+VGQI++MK+F G N T FG+ + +DL  G E + +  FPRVTYCTIKVRKMGQ KP SYTLQCVLPIN F EK+YVFLWFWF+IL +LTTLNT+QW LN  LP+RRV +++QYLKAL++I+ST+ERDC RFV   LG DG+F+L  VS+I+SDLIALDVT TLW NY++AK+ G E+D++R++++VNR S+VV
Sbjct:    7 GLLDGGFVFKLGRLFRTPYGGEGVDFVDQLNYQFTGGLMIIFIAIISLRQYVGKPIQCWVPQEFTKSWEEYAENLCWVSNTYFLLPNEEIPTDQVDYEKVKFIGYYQWVVIVLAGQAMMAWVPHLLWRVGSRRLPLLLKSAREAAIPDRELRLKAVSCLVATLEEQAESQSRFRRIKSLLSRCLCGVTPNARLTMLFLFVRTLFVANSVGQIYLMKRFTGFNSTVFGLRLLQDLSAGVEWERTGHFPRVTYCTIKVRKMGQTKPASYTLQCVLPINNFTEKIYVFLWFWFVILGVLTTLNTLQWALNTMLPMRRVHYIKQYLKALRLISSTEERDCARFVNNTLGADGVFILHVVSKIASDLIALDVTATLWKNYRQAKITGTEEDVNRLLETVNRGSSVV 407          
BLAST of Innexin vs. TrEMBL
Match: A0A4E0R9P5 (Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 SV=1)

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 264/394 (67.01%), Postives = 338/394 (85.79%), Query Frame = 2
Query:  278 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNR 1459
            M+ G   ++ + F V YGGEGVDF+DQLNYQF+SG+L++FI++IG RQYVGKP+ CWVPQEFT SWE+YAEN+CWVQNTYFLLP+E +P  +FE+ KV++ISYYQWVAIVLAGQA+MSW+PH+ WRVWS+RVP+LLR+AREA+ PD+E+R KAISCLVAALEE +E+  RFR+ +G+F +CL G  PT  +TLLF+FVR+ FI NN+GQI++M+KFIGTN+T FG+ VF++LL G++ ++S  FPRVTYC +KVRK+GQ+KP SYTLQCVLP+NYF+EKVYVFLWFWFI+++ LT+LNT+QW  NVC+P RRV F+RQYLKALK ++ T+E +C RFV  +LGCDG+FLLQ+VSRISSDLI LDVTG LW+NY+RAK+ G E DI R I+S+NR
Sbjct:    1 MDPGGALKLSRFFHVAYGGEGVDFIDQLNYQFSSGILVMFIVMIGFRQYVGKPLDCWVPQEFTSSWEDYAENLCWVQNTYFLLPNEAIPEEEFEMLKVKHISYYQWVAIVLAGQAMMSWIPHICWRVWSKRVPVLLRNAREAAIPDKELRHKAISCLVAALEELSEASKRFRRTRGVFKRCLRGAPPTTHITLLFLFVRLAFIVNNIGQIYIMRKFIGTNDTFFGLHVFQELLTGSQWEVSGLFPRVTYCDVKVRKLGQLKPASYTLQCVLPVNYFIEKVYVFLWFWFILIAGLTSLNTLQWIFNVCVPFRRVYFIRQYLKALKQLSHTEETECARFVNSDLGCDGVFLLQAVSRISSDLIVLDVTGMLWSNYQRAKITGTEGDITRFIESINR 394          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000033444.1 (SMESG000033444.1)

HSP 1 Score: 790.03 bits (2039), Expect = 0.000e+0
Identity = 399/399 (100.00%), Postives = 399/399 (100.00%), Query Frame = 2
Query:  278 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSSTVV 1474
            MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSGLLIVFIIIIGIRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSSTVV
Sbjct:    1 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSGLLIVFIIIIGIRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSSTVV 399          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000068735.1 (SMESG000068735.1)

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 254/400 (63.50%), Postives = 333/400 (83.25%), Query Frame = 2
Query:  275 IMESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSSTVV 1474
            +MESG  F+IG+LF+ PYGGEGVDF DQLNYQFTSGL+++FI I+ IRQYVGKPIQCWVPQEFT++WEEYAEN+CWV NTYFLL  +++P +D E   V+YISYYQW+ IVLAGQA++SWVPHL WRV SRR+P+LLRSAREA  PDR++R KA+SC+VA+LEEQ ++  R R++KGIF +CLGG+ P  R+T+LFI VRI+FI N VGQI++M+KF+G+N   FG T+ +DLL G + +++  FPRVTYCTI VR+MGQ+K  SYTLQCVLPIN+F+EKVYVFLWFWFI+++ +T L+T+QW  N  LP++RV +VRQYLKA+++ITST+ERDC RFV  NLG DG+FLL  VS  +SDLI+LDVT TLW N+++AK+ G E+D+ R++++ NR+ + +
Sbjct:   11 LMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNRAGSSI 410          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000027007.1 (SMESG000027007.1)

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 265/399 (66.42%), Postives = 328/399 (82.21%), Query Frame = 2
Query:  278 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSSTVV 1474
            M +GIF +I + F+VPYGG  VDFVDQLNYQFTSGLL VF+IIIG RQY+GKPIQCWVPQEFT++WEEYAEN+CWVQNTYFL P ED+P  D EL+K++YISYYQWVAIVL+GQA+MSW+P+L+WR++S++V +LL SA+EAS PD  +RRKA+S LV ALEEQ++   +F K KGI  + L  +NP  R+T +FI VRILF+ N  GQI +M+ FIG+++  FG  VF+ LL  ++ QISETFPRVTYCT+KVRK+GQ++PGSYTLQCVLP+NYFVEKVYVFLWFWFIIL +LTT++T QW  NVC+P  RVQF+RQYLKALKVI+  +E+DC RFV K LGCDGIFLL SVS++SSDLIALDV G LW N+K AK  GNE D++ +I S++R   VV
Sbjct:    1 MNAGIFLKIIRFFKVPYGGADVDFVDQLNYQFTSGLLAVFVIIIGFRQYMGKPIQCWVPQEFTKAWEEYAENLCWVQNTYFLSPEEDIPRTDVELNKMKYISYYQWVAIVLSGQALMSWIPYLVWRLFSQKVIVLLNSAKEASIPDWSVRRKAVSYLVNALEEQSQINNQFYKRKGIVRRYLTEINPAYRITFIFIVVRILFVTNCFGQIIIMRIFIGSSDFMFGYNVFQYLLRNHQWQISETFPRVTYCTVKVRKLGQLRPGSYTLQCVLPVNYFVEKVYVFLWFWFIILGVLTTISTAQWIANVCIPPWRVQFIRQYLKALKVISGPEEKDCNRFVNKKLGCDGIFLLHSVSKLSSDLIALDVAGHLWQNFKMAKSQGNEVDLNNLIQSIHRGPNVV 399          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000051126.1 (SMESG000051126.1)

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 249/393 (63.36%), Postives = 321/393 (81.68%), Query Frame = 2
Query:  278 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIK-GIFGK-CLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDS 1450
            ME+  F +IG+ F   YGG  +DFVDQLNYQ+++GLL +FI IIG RQYVGKPIQCWVPQ+FT+SWEEYAEN+CW+Q+TY LL +ED+P +DFE+  ++YISYYQWVAIV+ GQA+MS++PHLIWR+WS+R+PILL++AREAS PDRE+R KAI C+V  LEE TE+  R+R+ + GIF +      NP+ R+T+LF+FVR LFI NN+GQI++MK FI TN T FGI V  DLL G E +    FPR+TYCTI VRK GQIK  S+T QCVLPIN+FVEK+YVFLW WF +L++LTTLNT+QW L VCLP ++ QF+++YLKALK+I++++ R+C RFV +NLGCDGIF+LQ+VS++SSDLIALDVT TLW NY++AKL G EDDI R +++
Sbjct:    1 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTGLLFIFISIIGFRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFTLLAVLTTLNTLQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMET 393          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000032206.1 (SMESG000032206.1)

HSP 1 Score: 457.988 bits (1177), Expect = 5.247e-159
Identity = 216/385 (56.10%), Postives = 290/385 (75.32%), Query Frame = 2
Query:  278 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSXXXXXXXXXXXXRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDI 1432
            M+S    ++G++FR P GG+GV F+D LNYQ++S +L+VFI IIG RQY+GKPIQCWVPQEFTR+WE+YAEN+CWVQNTYFL P + VP++D EL    +ISYYQW+ IV+  QAV+ ++P +IWRV SRR P+LLR+++EA  PDRE+RRKA++CLVAALEEQ     RFRK      K L G+ P A +                 Q+++M+ F+GTN TTFG+ +F+D+L G++ ++S  FPRVT+C +++RKMGQIKP  YTLQCVLPINYFVEK+Y FLWFWF+ L+  T+ NT+QW +++ +  R+V FV  YLKALK ++ST+ERDC RFV   LG DGIFLL++V+ ++SDL+ALDVTG +W NYK AK+ G E+D+
Sbjct:    1 MDSDSILKLGRIFRSPLGGDGVSFIDVLNYQYSSAVLVVFIAIIGTRQYIGKPIQCWVPQEFTRAWEDYAENICWVQNTYFLPPEKAVPDSDVELHSAEFISYYQWIVIVMGAQAVLCYLPQIIWRVGSRRFPVLLRNSKEAILPDRELRRKAVACLVAALEEQAIRNCRFRKNNSTIYKLLCGLGPGAELR----------------QLYLMRDFLGTNHTTFGVMIFQDILAGHDWKVSGHFPRVTFCPVEIRKMGQIKPAIYTLQCVLPINYFVEKIYAFLWFWFVSLACATSFNTLQWFIDLFVKNRQVVFVSNYLKALKQLSSTEERDCGRFVEVVLGNDGIFLLRAVANVASDLMALDVTGIMWRNYKHAKVTGTEEDM 369          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-16.286e-8436.27Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-16.286e-8436.27Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-17.665e-8336.27Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-92.771e-7939.35Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
unc-71.698e-7334.29Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx24.061e-2326.26gene:FBgn0027108 transcript:FBtr0301860[more]
Inx24.061e-2326.26gene:FBgn0027108 transcript:FBtr0071005[more]
Inx24.061e-2326.26gene:FBgn0027108 transcript:FBtr0332314[more]
Inx24.061e-2326.26gene:FBgn0027108 transcript:FBtr0071006[more]
shakB7.420e-2126.19gene:FBgn0085387 transcript:FBtr0112571[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL3.525e-7839.35Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL3.965e-7034.11Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q23157|INX11_CAEEL5.232e-5832.40Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|Q19746|INX3_CAEEL2.529e-5734.14Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
sp|Q23027|INX5_CAEEL5.980e-5631.77Innexin-5 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q2L6M90.000e+097.74Innexin OS=Dugesia japonica OX=6161 GN=inx5 PE=2 S... [more]
C1LEY20.000e+067.51Innexin OS=Schistosoma japonicum OX=6182 GN=inx PE... [more]
A0A5K4F0R00.000e+067.77Innexin OS=Schistosoma mansoni OX=6183 PE=4 SV=1[more]
A0A4E0RM260.000e+066.58Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 S... [more]
A0A4E0R9P50.000e+067.01Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 S... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033444.10.000e+0100.00SMESG000033444.1[more]
SMESG000068735.10.000e+063.50SMESG000068735.1[more]
SMESG000027007.10.000e+066.42SMESG000027007.1[more]
SMESG000051126.10.000e+063.36SMESG000051126.1[more]
SMESG000032206.15.247e-15956.10SMESG000032206.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006907 ID=SMED30006907|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1563bp
TATTGCTAATATGATGAGGAGTTGAATTTCATATTAATAAATATAGTTAA
ATTCGTATTTTTCATTCGACAAATTTTAATGCCGACTTTGAATGAGATTT
ATAACCGATGATCCATTTATCAAAATTAGTTCATTTAATTGCTTTATCAG
AACCGGATATTGATCTATGTTATCTTAACATCAATTAGAAGGCAAGAGAA
CAATAATCATAGAATAACCGATGATATCAACTGTTATTATAATAATCCTC
ATAATTGTATAGTATTGATTTTCTATCATGGAAAGTGGAATATTCTTTAG
AATCGGACAACTCTTTCGTGTTCCTTATGGAGGTGAAGGTGTCGACTTTG
TTGATCAGTTGAATTACCAGTTCACCAGTGGTCTGCTCATAGTCTTCATT
ATTATAATAGGAATCAGACAATATGTTGGCAAACCAATTCAATGTTGGGT
GCCACAAGAATTCACAAGGTCATGGGAAGAATATGCGGAAAATGTATGTT
GGGTACAAAACACATATTTTCTTCTACCACATGAAGATGTTCCAAACAAT
GATTTTGAGCTCAGTAAAGTCAGATACATTAGTTATTACCAATGGGTAGC
AATTGTTCTTGCTGGTCAAGCAGTAATGTCTTGGGTTCCTCATCTTATAT
GGAGAGTTTGGTCAAGGCGAGTTCCAATTCTTTTACGGTCAGCTAGAGAA
GCATCATTTCCAGATCGCGAAATCCGACGAAAAGCTATTTCCTGTCTTGT
AGCTGCTCTTGAAGAGCAAACTGAATCAGGAGCAAGATTTCGTAAAATCA
AAGGTATTTTCGGAAAGTGCTTAGGTGGAGTAAATCCAACTGCAAGAGTC
ACATTGTTATTCATTTTTGTCAGAATTCTTTTCATCGCTAATAATGTTGG
TCAGATCTTCATGATGAAAAAATTCATTGGAACTAACGAAACAACATTCG
GAATAACAGTCTTCCGTGATCTTCTAAATGGAAATGAAGGTCAAATTTCA
GAAACCTTTCCTAGAGTAACATATTGTACTATTAAAGTGCGTAAAATGGG
CCAAATCAAACCAGGCAGTTATACGCTACAATGTGTTCTGCCAATTAATT
ATTTTGTTGAAAAAGTCTACGTTTTCTTGTGGTTTTGGTTCATCATTCTA
AGCATTCTTACAACCCTCAATACTGTTCAATGGACACTCAATGTTTGTTT
ACCCTTGCGCAGGGTTCAATTTGTCAGGCAATATCTTAAAGCGCTCAAAG
TAATTACTAGTACAGATGAAAGAGACTGTGTCAGATTTGTTCGAAAGAAT
CTTGGTTGTGACGGCATATTTTTGTTGCAATCAGTCAGTAGAATATCCAG
TGACCTCATTGCTTTAGATGTTACTGGAACTTTGTGGAATAATTACAAAA
GAGCTAAATTAGCCGGTAACGAAGATGATATCCACAGAATCATTGACTCC
GTTAACCGTAGCTCTACTGTAGTATAGAAAAAAAGGTTTACTCTTTTTAC
TCTAAACATATTTATAAGAATTATTTTATTGATATTAATTCTTTTTATTG
AGACAAAAAGCCA
back to top

protein sequence of SMED30006907-orf-1

>SMED30006907-orf-1 ID=SMED30006907-orf-1|Name=SMED30006907-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=400bp
MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSGLLIVFIIIIGIRQYV
GKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRY
ISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIR
RKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRI
LFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYC
TIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTV
QWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLL
QSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSSTVV*
back to top
Aliases
The feature 'Innexin' has the following synonyms
Synonym
Dj-inx5
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 45..56
score: 52.67
coord: 103..125
score: 46.26
coord: 195..209
score: 29.33
coord: 73..82
score: 54.0
coord: 243..252
score: 54.8
coord: 269..285
score: 58.59
IPR000990InnexinPFAMPF00876Innexincoord: 23..373
e-value: 2.8E-107
score: 359.1
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 16..379
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 17..379
score: 31.488
NoneNo IPR availableTMHMMTMhelixcoord: 188..210
NoneNo IPR availableTMHMMTMhelixcoord: 106..128
NoneNo IPR availableTMHMMTMhelixcoord: 27..46
NoneNo IPR availableTMHMMTMhelixcoord: 280..302