Two pore calcium channel protein 2

Overview
NameTwo pore calcium channel protein 2
Smed IDSMED30006904
Length (bp)2304
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Two pore calcium channel protein 2 (SMED30006904) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Two pore calcium channel protein 2 (SMED30006904) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006904

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30006904SMESG000058852.1 dd_Smed_v4_2960_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006904SMESG000058852.1 dd_Smed_v6_2960_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Two pore calcium channel protein 2 vs. Ensembl Human
Match: TPCN2 (two pore segment channel 2 [Source:HGNC Symbol;Acc:HGNC:20820])

HSP 1 Score: 247.284 bits (630), Expect = 1.785e-70
Identity = 226/736 (30.71%), Postives = 383/736 (52.04%), Query Frame = 3
Query:   81 QASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNG-----FDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDA--FKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAI--EISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMS---RKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKL-------DVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTH---VKSHYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDLQSPLRKCSFLCEHYPHF 2222
            QA  F+ DA +YRSINHRVD + + +Y   YS      + F I  +  LAF+E PSSL+  + +            P  +T S+E + LLV   D   + YLFG    +KN WLL    ++ VS +D+ VS++L      R+RR  RP F LQ S +MKK +K +  ++ ++ SV LLL + L +FT+  + +F G       D+   + +Q+   +  +LLVLLTTANNPD MI  Y+  +   IFF +F  IG    MN+L AI++ +FRG+++ S+QTSL RRRL  +A +EV+  +   E  A    V +      +V++   +    K  M++   S G+  +     + +   LD     K+    P Y+   L++ Q +F   YF+ +G +    N+++I +   +             L I   +FI  YL+E + K FA+G + Y S     F+ L+TV++L ++IS + ++R      R ++V   +++WD+ R+ N+L++ R   I+     +  + +T+  +   M++  G+L++++YV+A++G+N+F G +        +   N +  CG+F+QL+Y   NFDDF A++VTLW L++VNNW  F++A+          IY + WW+++ ++++N   A ++E + H    +SH       L    G+ +A                  T ++LF++ L EP E++L   L +       +PH 
Sbjct:   48 QAVVFIEDAIQYRSINHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAA---PWEPPCGLTESVEVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVCHEPLRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAGGKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGSLFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVL-SSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELD-RSVVKEHPPRPEYQSPFLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYYLLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVG-LLSLWDMTRMLNMLIVFRFLRIIPSMKLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIVALPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVNNWQVFLDAYR-RYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPRSH-------LQPLAGTPEATYQ--------------MTVELLFRDILEEPGEDELTERLSQ-------HPHL 748          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Human
Match: TPCN2 (two pore segment channel 2 [Source:HGNC Symbol;Acc:HGNC:20820])

HSP 1 Score: 224.557 bits (571), Expect = 1.138e-62
Identity = 202/622 (32.48%), Postives = 337/622 (54.18%), Query Frame = 3
Query:   81 QASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNG-----FDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDA--FKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAI--EISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMS---RKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKL-------DVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFE 1889
            QA  F+ DA +YRSINHRVD + + +Y   YS      + F I  +  LAF+E PSSL+  + +            P  +T S+E + LLV   D   + YLFG    +KN WLL    ++ VS +D+ VS++L      R+RR  RP F LQ S +MKK +K +  ++ ++ SV LLL + L +FT+  + +F G       D+   + +Q+   +  +LLVLLTTANNPD MI  Y+  +   IFF +F  IG    MN+L AI++ +FRG+++ S+QTSL RRRL  +A +EV+  +   E  A    V +      +V++   +    K  M++   S G+  +     + +   LD     K+    P Y+   L++ Q +F   YF+ +G +    N+++I +   +             L I   +FI  YL+E + K FA+G + Y S     F+ L+TV++L ++IS + ++R      R ++V   +++WD+ R+ N+L++ R   I+     +  + +T+  +   M++  G+L++++YV+A++G+N+F G +        +   N +  CG+F+QL+Y   NFDDF A++VTLW L++VNNW  F++A+ 
Sbjct:   48 QAVVFIEDAIQYRSINHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAA---PWEPPCGLTESVEVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVCHEPLRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAGGKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGSLFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVL-SSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELD-RSVVKEHPPRPEYQSPFLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYYLLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMV-GLLSLWDMTRMLNMLIVFRFLRIIPSMKLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIVALPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVNNWQVFLDAYR 663          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Human
Match: TPCN2 (two pore segment channel 2 [Source:HGNC Symbol;Acc:HGNC:20820])

HSP 1 Score: 162.925 bits (411), Expect = 8.002e-42
Identity = 155/471 (32.91%), Postives = 244/471 (51.80%), Query Frame = 3
Query:   81 QASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNG-----FDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDA--FKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAI--EISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLIL 1466
            QA  F+ DA +YRSINHRVD + + +Y   YS      + F I  +  LAF+E PSSL+  + +            P  +T S+E + LLV   D   + YLFG    +KN WLL    ++ VS +D+ VS++L      R+RR  RP F LQ S +MKK +K +  ++ ++ SV LLL + L +FT+  + +F G       D+   + +Q+   +  +LLVLLTTANNPD MI  Y+  +   IFF +F  IG    MN+L AI++ +FRG+++ S+QTSL RRRL  +A +EV+  +   E  A    V +      +V++   +    K  M++   S G+  +     + +   LD     K+    P Y+   L++ Q +F   YF+ +G +    N+++I +   +             L I   +FI  YL+E + K FA+G + Y S     F+ L+TV++L
Sbjct:   48 QAVVFIEDAIQYRSINHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAA---PWEPPCGLTESVEVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVCHEPLRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAGGKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGSLFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVL-SSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELD-RSVVKEHPPRPEYQSPFLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYYLLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLL 513          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Human
Match: TPCN2 (two pore segment channel 2 [Source:HGNC Symbol;Acc:HGNC:20820])

HSP 1 Score: 162.925 bits (411), Expect = 9.360e-42
Identity = 160/494 (32.39%), Postives = 251/494 (50.81%), Query Frame = 3
Query:   12 GLTVSVTTFCNPLI*IMTNLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNG-----FDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDA--FKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAI--EISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLIL 1466
            GLT   +    P      +L   QA  F+ DA +YRSINHRVD + + +Y   YS      + F I  +  LAF+E PSSL+  + +            P  +T S+E + LLV   D   + YLFG    +KN WLL    ++ VS +D+ VS++L      R+RR  RP F LQ S +MKK +K +  ++ ++ SV LLL + L +FT+  + +F G       D+   + +Q+   +  +LLVLLTTANNPD MI  Y+  +   IFF +F  IG    MN+L AI++ +FRG+++ S+QTSL RRRL  +A +EV+  +   E  A    V +      +V++   +    K  M++   S G+  +     + +   LD     K+    P Y+   L++ Q +F   YF+ +G +    N+++I +   +             L I   +FI  YL+E + K FA+G + Y S     F+ L+TV++L
Sbjct:   25 GLTTYRSIQVGPGAAARWDLCIDQAVVFIEDAIQYRSINHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAA---PWEPPCGLTESVEVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVCHEPLRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAGGKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGSLFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVL-SSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELDR-SVVKEHPPRPEYQSPFLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYYLLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLL 513          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Human
Match: TPCN2 (two pore segment channel 2 [Source:HGNC Symbol;Acc:HGNC:20820])

HSP 1 Score: 162.925 bits (411), Expect = 9.360e-42
Identity = 160/494 (32.39%), Postives = 251/494 (50.81%), Query Frame = 3
Query:   12 GLTVSVTTFCNPLI*IMTNLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNG-----FDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDA--FKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAI--EISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLIL 1466
            GLT   +    P      +L   QA  F+ DA +YRSINHRVD + + +Y   YS      + F I  +  LAF+E PSSL+  + +            P  +T S+E + LLV   D   + YLFG    +KN WLL    ++ VS +D+ VS++L      R+RR  RP F LQ S +MKK +K +  ++ ++ SV LLL + L +FT+  + +F G       D+   + +Q+   +  +LLVLLTTANNPD MI  Y+  +   IFF +F  IG    MN+L AI++ +FRG+++ S+QTSL RRRL  +A +EV+  +   E  A    V +      +V++   +    K  M++   S G+  +     + +   LD     K+    P Y+   L++ Q +F   YF+ +G +    N+++I +   +             L I   +FI  YL+E + K FA+G + Y S     F+ L+TV++L
Sbjct:   25 GLTTYRSIQVGPGAAARWDLCIDQAVVFIEDAIQYRSINHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAA---PWEPPCGLTESVEVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVCHEPLRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAGGKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGSLFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVL-SSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELDR-SVVKEHPPRPEYQSPFLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYYLLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLL 513          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Zebrafish
Match: tpcn2 (two pore segment channel 2 [Source:NCBI gene;Acc:777614])

HSP 1 Score: 265.003 bits (676), Expect = 7.173e-77
Identity = 223/753 (29.61%), Postives = 390/753 (51.79%), Query Frame = 3
Query:   63 TNLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETS----ANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEH--KESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQA--MSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRT--MSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKL----------DVHFFNKTQA----CGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAF-EMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDLQSPLRKCSFLCEHYPHFGRSY 2234
             +L+ +QA  F+ DA +YRSINHRVD   L++Y + YS      +   I  +  LAF+E PSSL+  S + +          P  +T  +E V L + ++D   ++       T  + WL +   +   S I + VSV +      R+RR  RP F LQ S LMKK +K + +T+ +I SV+LLL L + +FT+I + IF   DD   + ++Q+++     A  +LLVLLTTANNPD MI  Y+  +   IFF +F   G ++ MN++ AI++++FRG++L S+QTS+ RRRL ++A +EV+C   +  TS     ++ +V ++ F +V++   +  + +  ++K A       +   + + +   LD+   KE       P Y    L+ +Q ++   Y  ++G      NV+ I   +    E + ++     + I   IFI  YLIE + K  A G+K Y S +   F+  +TVL+L I+I     ++   +    +    + +W++ R+ N+L++ R   I+     +  + +T+ D+   +++  G+LL+++Y++A+LG+ +F G +          +    N T      CGTF+QL+Y   NFDDF +S++ L+ +++VNNWH F +A+     D  LV  Y + WW+ + ++++N   A ++E +T+             R +G +    + + Y           T Q++FK  + EPTEE+L + L +       +PH   S+
Sbjct:   56 ADLYVQQAVVFIEDAIKYRSINHRVDSGSLRLYRWYYSNLCQWGLGLTIAVVLALAFIERPSSLTYTSDIRVKP---KPWEPPCGMTEGIEIVCLCIFILDVTAKLLCTAYRNTHMHKWLCVKIPVGVASVIKWPVSVYVMCNQNLRVRRLIRPFFLLQNSSLMKKTLKCIKRTLPEIASVILLLALHICLFTMIGMLIFAKSDDPKQNGEWQTYFRNLPKALSSLLVLLTTANNPDVMIPAYSLNRGYSIFFILFSVFGTYLLMNLMTAIIYNQFRGYLLMSVQTSIIRRRLGIRAAFEVLCCPGRGHTSTQAEGHVERVAVNMFLKVMERVHMKSYCRQAIVKAARRFPDGFISGEDFQRLFNELDKDFVKEHPPK---PEYSSSGLQHIQYVYSHYYISVLGNAVALANVICICTVLVLNAEKSASEKNYFYMEIINCIFILYYLIEMLLKIVAFGWKGYLSYRNNIFDGFLTVLLLAIQIVIFITFKIPYVDVDPVPRHVMALWEMIRLVNMLIVFRFLRIIPEIKLMAVVASTIVDLVKNLRAFAGILLVVYYMFAVLGIWLFQGAISPPSNMSLVSNSSLENITGPYSMECGTFEQLEYWPNNFDDFASSLILLYNIMVVNNWHVFTDAYARYTTDWSLV--YFVVWWLTSSVMWVNLFVALILENFTY----------KWDRSNGLSVEDVERIAYQS---------TVQLMFKEHVKEPTEEELLAQLHQ-------HPHLHLSW 774          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Zebrafish
Match: tpcn1 (two pore segment channel 1 [Source:ZFIN;Acc:ZDB-GENE-060526-199])

HSP 1 Score: 86.2705 bits (212), Expect = 6.343e-17
Identity = 130/598 (21.74%), Postives = 279/598 (46.66%), Query Frame = 3
Query:  327 SLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNV----KLILQSLDEHKESKKGFS-IPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLF---PSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKTQACGTFQQLD-------------YGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVH---IYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPH 2048
            +LE + L+++  +   ++   G     ++   ++  +++F+ +I+  V V ++   + R+ R  RPIF L   +    V ++L +    +   + +L L LF   + ++  F  F   + D  + +  ++  +L VLLTTAN PD M+  Y+  + + IFF ++++I ++  MN+L+A+VFD F G      ++ L  +R A++  ++++    + +    +S  + D   R   +  ++   +    K  +  GA  +   +     ++I       +  +  F  +P   + + K +  +  SK F+    +  ++N + I +E +N   D  +    +  +  IF+ +Y IE + K   +G   YFS     F+F +TV      I+       ++     F+             +V++R   +L LF        +++T+F++  RM S+   L++ +Y +A++GM  F   +  +  + +    +++Q++             Y   NF++  +S VTL+ L +VNNW+  ME     V S+  H   +Y ++++++T++V M  I AF+++ +    ++  K +  L  P 
Sbjct:  133 TLELLALVMVAFELCMKLRWLGFHTFIRHKRTMVKTSVLFIQFIEAIV-VLVRQTSHLRVTRALRPIF-LVDCRYCGAVRRNLRQIFQSLPPFIDILLLLLFFMVIFAILGFCLFSANTADHYFSTLENSIVSLFVLLTTANFPDVMMPAYSKNRWSCIFFIVYLSIELYFIMNLLLAVVFDTFNGVEKMKFKSLLLHKRSAIEHAFQLLVSRQRPD---GVSLKQFDGLMR-FYHPRMTPRDRFLTFKALNHSGAPMLSLQDFYKFYEVIGLKWKARRSGEHWFDDLPRTALLIFKGINLLVKSKAFQYAMYLVVAVNGIWILVE-TNMLNDGISWTRVVPWSYIIFLTIYGIEVLLKITGLGPITYFSSGWNLFDFSVTVFAFLGLIA-------LAFDMEPFY------------FIVVLRPLQLLRLFKIKQRYRNVLDTMFELFPRMASLGLTLIIFYYSFAIVGMEFFADVIYPNCCDNSTVAASYRQINVTTGNRTELQEGYYYLNNFNNILSSFVTLFELTVVNNWYITME----GVTSQTTHWSRLYFMTFYIVTMVV-MTIIVAFILDAFVFRMNYSRKNREPLDDPE 699          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Zebrafish
Match: tpcn3 (two pore segment channel 3 [Source:ZFIN;Acc:ZDB-GENE-141215-16])

HSP 1 Score: 75.0998 bits (183), Expect = 2.108e-13
Identity = 144/640 (22.50%), Postives = 288/640 (45.00%), Query Frame = 3
Query:   60 MTNLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCW--NVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLR--RFFRPIFALQ--KSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFN--GFDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNE-----TSAN------ISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFC-SLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKT----QACG-------TFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAF 1886
            MT  F+  A+ +++DA+  R+I        +K+Y  LY+  +   +  VFII++L  LA  E P+                 + +P   T ++E + L    +  +    +   D   K+P  + +  ++ +S+ID  +  ALK   ++ +R  R  RP+  +   + + +++  +S+   +  I  V  L    + +F+L+++ +F   G    +    +  +    + L VL+TTAN+PD M+  YN      IFF +++ I  + FM+  +A+V++ ++ ++ + ++  +  +R+ M   + ++ EN         T AN      + K +I    R +  S +    K  + K A     +  D L++++I      H         P+    +  +L S F+ +       V+   L +L  A+ I    E+            W F+ LY++E + K +A   + +F++    + +  T+++++      TI  +  +    +    + D+  I  +L LIR    +  F +   IINTL  +   + +   L+L+++Y++A++GM +F GK+     N T    + CG       +F +L+Y   NF+D  +S + L  L +VN WH     F
Sbjct:   34 MTEKFD-LATVYVSDAKYNRNIFFDTSPQAVKLY-LLYNHWFMQTLVYVFIIINL-ALALFEDPAV----------------VPLPIWATSTIETICLSAFTVRIIHYAKVIPKDKFWKDPKNICIIIIVTLSFIDMVIYGALKATGHYGIRWSRVLRPLLLVNVTEGRQLRRAFRSIRNALPQISYVFFLFMFSVLVFSLMALKLFGKRGLLTINGSPYFTDYMDIVFDLYVLVTTANSPDVMMPAYNSSVYFTIFFILYIVINTYTFMSFFLAVVYNNYKKYLKEEVRQLVKAKRIKMCRAFSLLQENRGEGGEPVVTQANWNHLVKLVKPKISTAHRELLWSVLDDQNKGHIGKFA---FVQLADLLSIQVITVKSQAHPIQ---ICFPS----LYNSLPSRFIRQMVHHRVFVYAYDLIILVNAVFIGLDEENPVVSNAE-----WGFLALYMLEILLKLYATEPRAFFARHQF-WNWFDTIIVVSALFG--TIINSALKHSGGYTSRQVLDIVFILRVLRLIRVVDSIKRFRA---IINTLIKIGPTILTFGQLILVVYYIFAMVGMELFKGKIQFFEPNSTSPDREYCGNPLLKSTSFAKLNYCKNNFNDVISSFILLLELTVVNQWHVLTSGF 633          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Zebrafish
Match: tpcn1 (two pore segment channel 1 [Source:ZFIN;Acc:ZDB-GENE-060526-199])

HSP 1 Score: 73.1738 bits (178), Expect = 7.572e-13
Identity = 128/595 (21.51%), Postives = 279/595 (46.89%), Query Frame = 3
Query:  327 SLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGL-VFCSLNVLAIAIEISNKFEDTTTQAMS-LNITTW---IFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLF---PSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKTQACGTFQQLD-------------YGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVH---IYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLT 2039
            +LE + L+++  +   ++   G     ++   ++  +++F+ +I+  V V ++   + R+ R  RPIF L   +    V ++L +    +   + +L L LF   + ++  F  F   + D  + +  ++  +L VLLTTAN PD M+  Y+  + + IFF ++++I ++  MN+L+A+VFD F G      ++ L  +R A++  ++++    + +    +S  + D   R   +  ++   +    K  +  GA  +   +     + +    ++++  S  ++   + +T   IF      + G+ +    N+L     +  K   T    +S   +  W   IF+ +Y IE + K   +G   YFS     F+F +TV      I+       ++     F+             +V++R   +L LF        +++T+F++  RM S+   L++ +Y +A++GM  F   +  +  + +    +++Q++             Y   NF++  +S VTL+ L +VNNW+  ME     V S+  H   +Y ++++++T++V M  I AF+++ +   + +Y+++  ++T
Sbjct:  123 TLELLALVMVAFELCMKLRWLGFHTFIRHKRTMVKTSVLFIQFIEAIV-VLVRQTSHLRVTRALRPIF-LVDCRYCGAVRRNLRQIFQSLPPFIDILLLLLFFMVIFAILGFCLFSANTADHYFSTLENSIVSLFVLLTTANFPDVMMPAYSKNRWSCIFFIVYLSIELYFIMNLLLAVVFDTFNGVEKMKFKSLLLHKRSAIEHAFQLLVSRQRPD---GVSLKQFDGLMR-FYHPRMTPRDRFLTFKALNHSGAPMLSLQDFYKFYEVIGLKWKARR--SGEHWFDDLPRTALLIFKDLVVAVNGIWILVETNMLNGNCFLCVK--PTELDGISWTRVVPWSYIIFLTIYGIEVLLKITGLGPITYFSSGWNLFDFSVTVFAFLGLIA-------LAFDMEPFY------------FIVVLRPLQLLRLFKIKQRYRNVLDTMFELFPRMASLGLTLIIFYYSFAIVGMEFFADVIYPNCCDNSTVAASYRQINVTTGNRTELQEGYYYLNNFNNILSSFVTLFELTVVNNWYITME----GVTSQTTHWSRLYFMTFYIVTMVV-MTIIVAFILDAFV-FRMNYSRKNRDVT 682          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Zebrafish
Match: tpcn1 (two pore segment channel 1 [Source:ZFIN;Acc:ZDB-GENE-060526-199])

HSP 1 Score: 67.781 bits (164), Expect = 3.495e-11
Identity = 125/593 (21.08%), Postives = 273/593 (46.04%), Query Frame = 3
Query:  327 SLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGL-VFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFIC--LYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLF---PSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKTQACGTFQQLD-------------YGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVH---IYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLT 2039
            +LE + L+++  +   ++   G     ++   ++  +++F+ +I+  V V ++   + R+ R  RPIF L   +    V ++L +    +   + +L L LF   + ++  F  F   + D  + +  ++  +L VLLTTAN PD M+  Y+  + + IFF ++++I ++  MN+L+A+VFD F G      ++ L  +R A++  ++++    + +    +S  + D   R   +  ++   +    K  +  GA  +   +     + +    ++++  S  ++   + +T   IF      + G+ +    N+L       N F       + +    ++F    +Y IE + K   +G   YFS     F+F +TV      I+       ++     F+             +V++R   +L LF        +++T+F++  RM S+   L++ +Y +A++GM  F   +  +  + +    +++Q++             Y   NF++  +S VTL+ L +VNNW+  ME     V S+  H   +Y ++++++T++V M  I AF+++ +    ++  K +  +T
Sbjct:  120 TLELLALVMVAFELCMKLRWLGFHTFIRHKRTMVKTSVLFIQFIEAIV-VLVRQTSHLRVTRALRPIF-LVDCRYCGAVRRNLRQIFQSLPPFIDILLLLLFFMVIFAILGFCLFSANTADHYFSTLENSIVSLFVLLTTANFPDVMMPAYSKNRWSCIFFIVYLSIELYFIMNLLLAVVFDTFNGVEKMKFKSLLLHKRSAIEHAFQLLVSRQRPD---GVSLKQFDGLMR-FYHPRMTPRDRFLTFKALNHSGAPMLSLQDFYKFYEVIGLKWKARR--SGEHWFDDLPRTALLIFKDLVVAVNGIWILVETNML-------NGFHSNINFFIIIIYLLFMFRWNEVYGIEVLLKITGLGPITYFSSGWNLFDFSVTVFAFLGLIA-------LAFDMEPFY------------FIVVLRPLQLLRLFKIKQRYRNVLDTMFELFPRMASLGLTLIIFYYSFAIVGMEFFADVIYPNCCDNSTVAASYRQINVTTGNRTELQEGYYYLNNFNNILSSFVTLFELTVVNNWYITME----GVTSQTTHWSRLYFMTFYIVTMVV-MTIIVAFILDAFVFRMNYSRKNREPVT 673          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Xenopus
Match: hook1 (hook microtubule-tethering protein 1 [Source:Xenbase;Acc:XB-GENE-975863])

HSP 1 Score: 282.337 bits (721), Expect = 3.694e-83
Identity = 226/727 (31.09%), Postives = 392/727 (53.92%), Query Frame = 3
Query:   60 MTNLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSK-CWNVFMVFIIVSLHGLAFLEFPSSLSVNS---YLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDA--FKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQA--MSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWR--TMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLD---------VHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDL 2171
            + +L  +QA  F+ DA +YRSI+HRVD T L++Y + YS  C  +    I V+L  LAF+E PSSLS  S   Y G +         P  +T  +E +  L+ + D   + YL G +   K+ WLL    ++ +S +D+ VS+       FR+RR  RP F LQ S LMKK +K + +T+ ++ SV+LLL L LF+FT+  + +F    D   D ++Q ++     +  +LLVLLTTANNPD MI  Y+ ++   +FF +F  IG  + MN+L AI++++FRG+++ S+Q SL RRRL ++A +EV+         +    + +D+  F RV+    +  + K  + + A S     +   N + +   LD+    ++    P Y+   LK LQ I   +Y + +G V   +N++++ + +    E +       +L      FI  Y++E   K FA G K YFS     ++ L+TV++L ++++  +++R      K  +   +++W++ R+ N+ ++ R   I+     +  +  T+ D+   +++  G+LL+++YV+A++G+++F G +              N+   CG+F+QL Y   NFDDF A++VTLW +++VNNW  F++AF     S    +Y ++WW+++ ++++N   A ++E + H    +++      RPH S D     V Y           T Q++F+ DL EPT+E+L
Sbjct:   58 LEDLHVKQAVVFIEDAIQYRSIDHRVDPTSLQLYRWYYSDICQWILNAAIFVNL-ALAFIEKPSSLSATSDVRYRGAS------WQPPCGLTEGIEFLTFLLFVADVSVKSYLVGWNEFVKSKWLLCYILMLGISLVDWTVSLCFMCKEGFRMRRLLRPFFLLQHSSLMKKTLKCIKRTLPEMGSVMLLLALHLFLFTMFGMLLFAHTKDSQVDVEWQQYFRNLPDSLTSLLVLLTTANNPDVMIPAYSIHRAYSLFFILFTIIGSLILMNLLTAIIYNQFRGYLMKSVQASLLRRRLGIRAAFEVLSFQKDVTLQSTEETIFVDSVTFLRVLDKVKMDYYCKTAIREKAKSFHNGRICADNFQKLFDELDK-DTVRQHPPAPTYRSPCLKVLQRIGGHRYLDYMGNVVVIMNLVSVCVVLVIDAEKSGGDRDDFALGAINCFFILYYVLEMGLKMFAHGLKGYFSFPSNIYDGLLTVILLVLEVATFSLYRFPHPGWKPDMQGVLSLWEMVRLVNMFIVFRFLRIIPNIRVMALVAGTVLDLVKNLRAFAGILLVVYYVFAIIGIDLFKGAIPDPNSSNSTNSTTSNEPPPCGSFEQLQYWPNNFDDFAAALVTLWDVMVVNNWQVFLDAFSRYT-SPWSKLYFVAWWLLSSVIWINLFVALILENFIH---KWDRS----CRPHVSPD---QDVEY---------HMTVQLMFREDLEEPTDEEL 756          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Xenopus
Match: hook1 (hook microtubule-tethering protein 1 [Source:Xenbase;Acc:XB-GENE-975863])

HSP 1 Score: 273.863 bits (699), Expect = 2.742e-80
Identity = 219/727 (30.12%), Postives = 381/727 (52.41%), Query Frame = 3
Query:   60 MTNLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSK-CWNVFMVFIIVSLHGLAFLEFPSSLSVNS---YLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDA--FKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQA--MSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWR--TMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLD---------VHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDL 2171
            + +L  +QA  F+ DA +YRSI+HRVD T L++Y + YS  C  +    I V+L  LAF+E PSSLS  S   Y G +         P  +T  +E +  L+ + D   + YL G +   K+ WLL    ++ +S +D+ VS+       FR+RR  RP F LQ S LMKK +K + +T+ ++ SV+LLL L LF+FT+  + +F    D   D ++Q ++     +  +LLVLLTTANNPD  +I+                      MN+L AI++++FRG+++ S+Q SL RRRL ++A +EV+         +    + +D+  F RV+    +  + K  + + A S     +   N + +   LD+    ++    P Y+   LK LQ I   +Y + +G V   +N++++ + +    E +       +L      FI  Y++E   K FA G K YFS     ++ L+TV++L ++++  +++R      K  +   +++W++ R+ N+ ++ R   I+     +  +  T+ D+   +++  G+LL+++YV+A++G+++F G +              N+   CG+F+QL Y   NFDDF A++VTLW +++VNNW  F++AF     S    +Y ++WW+++ ++++N   A ++E + H    +++      RPH S D     V Y           T Q++F+ DL EPT+E+L
Sbjct:   58 LEDLHVKQAVVFIEDAIQYRSIDHRVDPTSLQLYRWYYSDICQWILNAAIFVNL-ALAFIEKPSSLSATSDVRYRGAS------WQPPCGLTEGIEFLTFLLFVADVSVKSYLVGWNEFVKSKWLLCYILMLGISLVDWTVSLCFMCKEGFRMRRLLRPFFLLQHSSLMKKTLKCIKRTLPEMGSVMLLLALHLFLFTMFGMLLFAHTKDSQVDVEWQQYFRNLPDSLTSLLVLLTTANNPDGSLIL----------------------MNLLTAIIYNQFRGYLMKSVQASLLRRRLGIRAAFEVLSFQKDVTLQSTEETIFVDSVTFLRVLDKVKMDYYCKTAIREKAKSFHNGRICADNFQKLFDELDK-DTVRQHPPAPTYRSPCLKVLQRIGGHRYLDYMGNVVVIMNLVSVCVVLVIDAEKSGGDRDDFALGAINCFFILYYVLEMGLKMFAHGLKGYFSFPSNIYDGLLTVILLVLEVATFSLYRFPHPGWKPDMQGVLSLWEMVRLVNMFIVFRFLRIIPNIRVMALVAGTVLDLVKNLRAFAGILLVVYYVFAIIGIDLFKGAIPDPNSSNSTNSTTSNEPPPCGSFEQLQYWPNNFDDFAAALVTLWDVMVVNNWQVFLDAFSRYT-SPWSKLYFVAWWLLSSVIWINLFVALILENFIH---KWDRS----CRPHVSPD---QDVEY---------HMTVQLMFREDLEEPTDEEL 734          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Xenopus
Match: hook1 (hook microtubule-tethering protein 1 [Source:Xenbase;Acc:XB-GENE-975863])

HSP 1 Score: 265.774 bits (678), Expect = 2.413e-77
Identity = 209/670 (31.19%), Postives = 367/670 (54.78%), Query Frame = 3
Query:   60 MTNLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSK-CWNVFMVFIIVSLHGLAFLEFPSSLSVNS---YLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDA--FKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQA--MSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWR--TMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLD---------VHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTH 2000
            + +L  +QA  F+ DA +YRSI+HRVD T L++Y + YS  C  +    I V+L  LAF+E PSSLS  S   Y G +         P  +T  +E +  L+ + D   + YL G +   K+ WLL    ++ +S +D+ VS+       FR+RR  RP F LQ S LMKK +K + +T+ ++ SV+LLL L LF+FT+  + +F    D   D ++Q ++     +  +LLVLLTTANNPD MI  Y+ ++   +FF +F  IG  + MN+L AI++++FRG+++ S+Q SL RRRL ++A +EV+         +    + +D+  F RV+    +  + K  + + A S     +   N + +   LD+    ++    P Y+   LK LQ I   +Y + +G V   +N++++ + +    E +       +L      FI  Y++E   K FA G K YFS     ++ L+TV++L ++++  +++R      K  +   +++W++ R+ N+ ++ R   I+     +  +  T+ D+   +++  G+LL+++YV+A++G+++F G +              N+   CG+F+QL Y   NFDDF A++VTLW +++VNNW  F++AF     S    +Y ++WW+++ ++++N   A ++E + H
Sbjct:   58 LEDLHVKQAVVFIEDAIQYRSIDHRVDPTSLQLYRWYYSDICQWILNAAIFVNL-ALAFIEKPSSLSATSDVRYRGAS------WQPPCGLTEGIEFLTFLLFVADVSVKSYLVGWNEFVKSKWLLCYILMLGISLVDWTVSLCFMCKEGFRMRRLLRPFFLLQHSSLMKKTLKCIKRTLPEMGSVMLLLALHLFLFTMFGMLLFAHTKDSQVDVEWQQYFRNLPDSLTSLLVLLTTANNPDVMIPAYSIHRAYSLFFILFTIIGSLILMNLLTAIIYNQFRGYLMKSVQASLLRRRLGIRAAFEVLSFQKDVTLQSTEETIFVDSVTFLRVLDKVKMDYYCKTAIREKAKSFHNGRICADNFQKLFDELDK-DTVRQHPPAPTYRSPCLKVLQRIGGHRYLDYMGNVVVIMNLVSVCVVLVIDAEKSGGDRDDFALGAINCFFILYYVLEMGLKMFAHGLKGYFSFPSNIYDGLLTVILLVLEVATFSLYRFPHPGWKPDMQGVLSLWEMVRLVNMFIVFRFLRIIPNIRVMALVAGTVLDLVKNLRAFAGILLVVYYVFAIIGIDLFKGAIPDPNSSNSTNSTTSNEPPPCGSFEQLQYWPNNFDDFAAALVTLWDVMVVNNWQVFLDAFSRYT-SPWSKLYFVAWWLLSSVIWINLFVALILENFIH 718          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Xenopus
Match: hook1 (hook microtubule-tethering protein 1 [Source:Xenbase;Acc:XB-GENE-975863])

HSP 1 Score: 256.144 bits (653), Expect = 4.141e-74
Identity = 206/698 (29.51%), Postives = 358/698 (51.29%), Query Frame = 3
Query:   60 MTNLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSK-CWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANIS---------KVEIDAFKRVI---KNSSISKWRKC--EMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQA--MSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWR------ITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLD----VHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPHGSTD 2060
            + +L  +QA  F+ DA +YRSI+HRVD T L++Y + YS  C  +    I V+L  LAF+E PSSLS  S +            P  +T  +E +  L+ + D   + YL G +   K+ WLL    ++ +S +D+ VS+       FR+RR  RP F LQ S LMKK +K + +T+ ++                    I+    D   D ++Q ++     +  +LLVLLTTANNPD MI  Y+ ++   +FF +F  IG  + MN+L AI++++FRG+++ S+Q SL RRRL ++A +EV+  +++ + S  +           + +D F   I   K  S    R C     K  D L  +TV             +H  +      P Y+   LK LQ I   +Y + +G V   +N++++ + +    E +       +L      FI  Y++E   K FA G K YFS     ++ L+TV++L ++++  +++R         W+      +++W++ R+ N+ ++ R   I+     +  +  T+ D+   +++  G+LL+++YV+A++G+++F G +         N+   CG+F+QL Y   NFDDF A++VTLW +++VNNW  F++AF     S    +Y ++WW+++ ++++N   A ++E + H    +++      RPH S D
Sbjct:   39 LEDLHVKQAVVFIEDAIQYRSIDHRVDPTSLQLYRWYYSDICQWILNAAIFVNL-ALAFIEKPSSLSATSDVRYRGA---SWQPPCGLTEGIEFLTFLLFVADVSVKSYLVGWNEFVKSKWLLCYILMLGISLVDWTVSLCFMCKEGFRMRRLLRPFFLLQHSSLMKKTLKCIKRTLPEM-------------------DIYPCVQDSQVDVEWQQYFRNLPDSLTSLLVLLTTANNPDVMIPAYSIHRAYSLFFILFTIIGSLILMNLLTAIIYNQFRGYLMKSVQASLLRRRLGIRAAFEVL--SFQKDASVLLGALYKFLPPPPIMVDLFFFPIHPQKAKSFHNGRICADNFQKLFDELDKDTV------------RQHPPA------PTYRSPCLKVLQRIGGHRYLDYMGNVVVIMNLVSVCVVLVIDAEKSGGDRDDFALGAINCFFILYYVLEMGLKMFAHGLKGYFSFPSNIYDGLLTVILLVLEVATFSLYRFPHPG----WKPDMQGVLSLWEMVRLVNMFIVFRFLRIIPNIRVMALVAGTVLDLVKNLRAFAGILLVVYYVFAIIGIDLFKGAIPDPNSSTTSNEPPPCGSFEQLQYWPNNFDDFAAALVTLWDVMVVNNWQVFLDAFSRYT-SPWSKLYFVAWWLLSSVIWINLFVALILENFIH---KWDRS----CRPHVSPD 681          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Xenopus
Match: hook1 (hook microtubule-tethering protein 1 [Source:Xenbase;Acc:XB-GENE-975863])

HSP 1 Score: 229.18 bits (583), Expect = 1.242e-64
Identity = 193/638 (30.25%), Postives = 329/638 (51.57%), Query Frame = 3
Query:   60 MTNLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSK-CWNVFMVFIIVSLHGLAFLEFPSSLSVNS---YLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANIS---------KVEIDAFKRVI---KNSSISKWRKC--EMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQA--MSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWR--TMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLD----VHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEA 1883
            + +L  +QA  F+ DA +YRSI+HRVD T L++Y + YS  C  +    I V+L  LAF+E PSSLS  S   Y G +         P  +T  +E +  L+ + D   + YL G +   K+ WLL    ++ +S +D+ VS+       FR+RR  RP F LQ S LMKK +K + +T+ ++                    I+    D   D ++Q ++     +  +LLVLLTTANNPD MI  Y+ ++   +FF +F  IG  + MN+L AI++++FRG+++ S+Q SL RRRL ++A +EV+  +++ + S  +           + +D F   I   K  S    R C     K  D L  +TV             +H  +      P Y+   LK LQ I   +Y + +G V   +N++++ + +    E +       +L      FI  Y++E   K FA G K YFS     ++ L+TV++L ++++  +++R      K  +   +++W++ R+ N+ ++ R   I+     +  +  T+ D+   +++  G+LL+++YV+A++G+++F G +         N+   CG+F+QL Y   NFDDF A++VTLW +++VNNW  F++ 
Sbjct:   39 LEDLHVKQAVVFIEDAIQYRSIDHRVDPTSLQLYRWYYSDICQWILNAAIFVNL-ALAFIEKPSSLSATSDVRYRGAS------WQPPCGLTEGIEFLTFLLFVADVSVKSYLVGWNEFVKSKWLLCYILMLGISLVDWTVSLCFMCKEGFRMRRLLRPFFLLQHSSLMKKTLKCIKRTLPEM-------------------DIYPCVQDSQVDVEWQQYFRNLPDSLTSLLVLLTTANNPDVMIPAYSIHRAYSLFFILFTIIGSLILMNLLTAIIYNQFRGYLMKSVQASLLRRRLGIRAAFEVL--SFQKDASVLLGALYKFLPPPPIMVDLFFFPIHPQKAKSFHNGRICADNFQKLFDELDKDTV------------RQHPPA------PTYRSPCLKVLQRIGGHRYLDYMGNVVVIMNLVSVCVVLVIDAEKSGGDRDDFALGAINCFFILYYVLEMGLKMFAHGLKGYFSFPSNIYDGLLTVILLVLEVATFSLYRFPHPGWKPDMQGVLSLWEMVRLVNMFIVFRFLRIIPNIRVMALVAGTVLDLVKNLRAFAGILLVVYYVFAIIGIDLFKGAIPDPNSSTTSNEPPPCGSFEQLQYWPNNFDDFAAALVTLWDVMVVNNWQVFLDC 630          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Mouse
Match: Tpcn2 (two pore segment channel 2 [Source:MGI Symbol;Acc:MGI:2385297])

HSP 1 Score: 272.322 bits (695), Expect = 5.789e-80
Identity = 206/659 (31.26%), Postives = 359/659 (54.48%), Query Frame = 3
Query:   81 QASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFN-GFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNE-TSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAI--EISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSR--KQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTP---IINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKL------DVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTH 2000
            QA  F+ DA +YRSI HR+D   L +Y + YS      + FII  +  LAF+E PSS +  + +   +        P  +T ++EA  LL  L+D   + YL G    ++N WLL  F ++ VS +D+ VS++L      R+RR  RP F LQ S +MKK +K +  ++ ++ SV LLL + L +FT+I + +F  G  D++ D +  +++     A  +LLVLLTT+NNPD MI  Y   +   +FF +F  IG    MN+L AI++++FRG+++ S+QTSL RRRL  +A YEV+        T+  +  V  + F  V++ + ++K  K  +++   S     +     + +   +D+    ++    P Y+   L+T Q IF   YF+ +G +    N+L+I +   + +           L I  +IFI  YL+E + K FA+G   Y S     F+ L+T+++L  +I  + ++R      K   +  +++WD+ R+ N L++ R    L + P++ P   + NT+  +   +++  G+L++ +YV+A++G+N+F G +       +   N +  CG+F+QL Y   NFDDF A+++TLW +++VNNW   +EA++         +Y + WW+++ ++++N   A ++E + H
Sbjct:   32 QAVVFIEDAIKYRSIYHRMDAGSLWLYRWYYSNVCQRVLGFIIFLILILAFVEVPSSFTKTADVRYRS---QPWQPPCGLTETIEAFCLLAFLVDLSVKGYLVGQAQLQQNLWLLAYFMVLVVSVVDWIVSLSLACEEPLRMRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTIIGMLLFTIGEKDEAQDQERLAYFRNLPEALTSLLVLLTTSNNPDVMIPAYTQNRAFALFFIVFTLIGSLFLMNLLTAIIYNQFRGYLMKSLQTSLFRRRLGARAAYEVLASRAGPAGTTPELVGVNPETFLPVLQKTQLNKTHKQAIMQKVQSYEGRPMLADEFQKLFDEVDKGLAKERPLK-PQYQSPFLQTAQFIFSHHYFDYLGNLVALGNLLSICVFLVLDSDLLPGERDDFVLGILDYIFILYYLLELLFKVFALGLPGYLSYHSNVFDGLLTIILLVSEICTLAVYRLPHSGWKPEQYGPLSLWDMTRLMNTLIVFR---FLRIIPNIKPMAEVANTILGLIPNLRAFGGILVVAYYVFAMIGINLFRGVIVPPGNSSLVPDNNSAVCGSFEQLGYWPNNFDDFAAALITLWNVMVVNNWQVILEAYKRYA-GPWSMVYFVLWWLVSSVIWINLFLALLLENFLH 682          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Mouse
Match: Tpcn2 (two pore segment channel 2 [Source:MGI Symbol;Acc:MGI:2385297])

HSP 1 Score: 195.282 bits (495), Expect = 7.896e-54
Identity = 156/481 (32.43%), Postives = 257/481 (53.43%), Query Frame = 3
Query:   81 QASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFN-GFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNE-TSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAI--EISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWR 1499
            QA  F+ DA +YRSI HR+D   L +Y + YS      + FII  +  LAF+E PSS +  + +   +        P  +T ++EA  LL  L+D   + YL G    ++N WLL  F ++ VS +D+ VS++L      R+RR  RP F LQ S +MKK +K +  ++ ++ SV LLL + L +FT+I + +F  G  D++ D +  +++     A  +LLVLLTT+NNPD MI  Y   +   +FF +F  IG    MN+L AI++++FRG+++ S+QTSL RRRL  +A YEV+        T+  +  V  + F  V++ + ++K  K  +++   S     +     + +   +D+    ++    P Y+   L+T Q IF   YF+ +G +    N+L+I +   + +           L I  +IFI  YL+E + K FA+G   Y S     F+ L+T+++L  +I  + ++R
Sbjct:    8 QAVVFIEDAIKYRSIYHRMDAGSLWLYRWYYSNVCQRVLGFIIFLILILAFVEVPSSFTKTADVRYRS---QPWQPPCGLTETIEAFCLLAFLVDLSVKGYLVGQAQLQQNLWLLAYFMVLVVSVVDWIVSLSLACEEPLRMRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTIIGMLLFTIGEKDEAQDQERLAYFRNLPEALTSLLVLLTTSNNPDVMIPAYTQNRAFALFFIVFTLIGSLFLMNLLTAIIYNQFRGYLMKSLQTSLFRRRLGARAAYEVLASRAGPAGTTPELVGVNPETFLPVLQKTQLNKTHKQAIMQKVQSYEGRPMLADEFQKLFDEVDKGLAKERPLK-PQYQSPFLQTAQFIFSHHYFDYLGNLVALGNLLSICVFLVLDSDLLPGERDDFVLGILDYIFILYYLLELLFKVFALGLPGYLSYHSNVFDGLLTIILLVSEICTLAVYR 484          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Mouse
Match: Tpcn2 (two pore segment channel 2 [Source:MGI Symbol;Acc:MGI:2385297])

HSP 1 Score: 191.815 bits (486), Expect = 2.049e-52
Identity = 156/484 (32.23%), Postives = 257/484 (53.10%), Query Frame = 3
Query:   81 QASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFN-GFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNE-TSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAI--EISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMS 1508
            QA  F+ DA +YRSI HR+D   L +Y + YS      + FII  +  LAF+E PSS +  + +   +        P  +T ++EA  LL  L+D   + YL G    ++N WLL  F ++ VS +D+ VS++L      R+RR  RP F LQ S +MKK +K +  ++ ++ SV LLL + L +FT+I + +F  G  D++ D +  +++     A  +LLVLLTT+NNPD MI  Y   +   +FF +F  IG    MN+L AI++++FRG+++ S+QTSL RRRL  +A YEV+        T+  +  V  + F  V++ + ++K  K  +++   S     +     + +   +D+    ++    P Y+   L+T Q IF   YF+ +G +    N+L+I +   + +           L I  +IFI  YL+E + K FA+G   Y S     F+ L+T+++L  +     +W T++
Sbjct:   32 QAVVFIEDAIKYRSIYHRMDAGSLWLYRWYYSNVCQRVLGFIIFLILILAFVEVPSSFTKTADVRYRS---QPWQPPCGLTETIEAFCLLAFLVDLSVKGYLVGQAQLQQNLWLLAYFMVLVVSVVDWIVSLSLACEEPLRMRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTIIGMLLFTIGEKDEAQDQERLAYFRNLPEALTSLLVLLTTSNNPDVMIPAYTQNRAFALFFIVFTLIGSLFLMNLLTAIIYNQFRGYLMKSLQTSLFRRRLGARAAYEVLASRAGPAGTTPELVGVNPETFLPVLQKTQLNKTHKQAIMQKVQSYEGRPMLADEFQKLFDEVDKGLAKERPLK-PQYQSPFLQTAQFIFSHHYFDYLGNLVALGNLLSICVFLVLDSDLLPGERDDFVLGILDYIFILYYLLELLFKVFALGLPGYLSYHSNVFDGLLTIILLEAR----AVWPTVA 507          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Mouse
Match: Tpcn2 (two pore segment channel 2 [Source:MGI Symbol;Acc:MGI:2385297])

HSP 1 Score: 169.088 bits (427), Expect = 8.684e-45
Identity = 136/408 (33.33%), Postives = 222/408 (54.41%), Query Frame = 3
Query:   81 QASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFN-GFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNE-TSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAI 1286
            QA  F+ DA +YRSI HR+D   L +Y + YS      + FII  +  LAF+E PSS +  + +   +        P  +T ++EA  LL  L+D   + YL G    ++N WLL  F ++ VS +D+ VS++L      R+RR  RP F LQ S +MKK +K +  ++ ++ SV LLL + L +FT+I + +F  G  D++ D +  +++     A  +LLVLLTT+NNPD MI  Y   +   +FF +F  IG    MN+L AI++++FRG+++ S+QTSL RRRL  +A YEV+        T+  +  V  + F  V++ + ++K  K  +++   S     +     + +   +D+    ++    P Y+   L+T Q IF   YF+ +G +    N+L+I +
Sbjct:   32 QAVVFIEDAIKYRSIYHRMDAGSLWLYRWYYSNVCQRVLGFIIFLILILAFVEVPSSFTKTADVRYRS---QPWQPPCGLTETIEAFCLLAFLVDLSVKGYLVGQAQLQQNLWLLAYFMVLVVSVVDWIVSLSLACEEPLRMRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTIIGMLLFTIGEKDEAQDQERLAYFRNLPEALTSLLVLLTTSNNPDVMIPAYTQNRAFALFFIVFTLIGSLFLMNLLTAIIYNQFRGYLMKSLQTSLFRRRLGARAAYEVLASRAGPAGTTPELVGVNPETFLPVLQKTQLNKTHKQAIMQKVQSYEGRPMLADEFQKLFDEVDKGLAKERPLK-PQYQSPFLQTAQFIFSHHYFDYLGNLVALGNLLSICV 435          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Mouse
Match: Tpcn2 (two pore segment channel 2 [Source:MGI Symbol;Acc:MGI:2385297])

HSP 1 Score: 168.703 bits (426), Expect = 1.289e-44
Identity = 136/408 (33.33%), Postives = 222/408 (54.41%), Query Frame = 3
Query:   81 QASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFN-GFDDKSFDSK----YQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNE-TSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAI 1286
            QA  F+ DA +YRSI HR+D   L +Y + YS      + FII  +  LAF+E PSS +  + +   +        P  +T ++EA  LL  L+D   + YL G    ++N WLL  F ++ VS +D+ VS++L      R+RR  RP F LQ S +MKK +K +  ++ ++ SV LLL + L +FT+I + +F  G  D++ D +    +++   A  +LLVLLTT+NNPD MI  Y   +   +FF +F  IG    MN+L AI++++FRG+++ S+QTSL RRRL  +A YEV+        T+  +  V  + F  V++ + ++K  K  +++   S     +     + +   +D+    ++    P Y+   L+T Q IF   YF+ +G +    N+L+I +
Sbjct:   32 QAVVFIEDAIKYRSIYHRMDAGSLWLYRWYYSNVCQRVLGFIIFLILILAFVEVPSSFTKTADVRYRS---QPWQPPCGLTETIEAFCLLAFLVDLSVKGYLVGQAQLQQNLWLLAYFMVLVVSVVDWIVSLSLACEEPLRMRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTIIGMLLFTIGEKDEAQDQERLAYFRNLPEALTSLLVLLTTSNNPDVMIPAYTQNRAFALFFIVFTLIGSLFLMNLLTAIIYNQFRGYLMKSLQTSLFRRRLGARAAYEVLASRAGPAGTTPELVGVNPETFLPVLQKTQLNKTHKQAIMQKVQSYEGRPMLADEFQKLFDEVDKGLAKERPLK-PQYQSPFLQTAQFIFSHHYFDYLGNLVALGNLLSICV 435          
BLAST of Two pore calcium channel protein 2 vs. UniProt/SwissProt
Match: sp|A0JMD4|TPC2_DANRE (Two pore calcium channel protein 2 OS=Danio rerio OX=7955 GN=tpcn2 PE=2 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 8.400e-81
Identity = 226/753 (30.01%), Postives = 395/753 (52.46%), Query Frame = 3
Query:   63 TNLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETS----ANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEH--KESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQA--MSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRT--MSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKL----------DVHFFNKTQA----CGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAF-EMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDLQSPLRKCSFLCEHYPHFGRSY 2234
             +L+ +QA  F+ DA +YRSINHRVD   L++Y + YS      +   I  +  LAF+E PSSL+  S + +          P  +T  +E V L + ++D   + YL G +  + N WLL    ++  S ID+ +S+++      R+RR  RP F LQ S LMKK +K + +T+ +I SV+LLL L + +FT+I + IF   DD   + ++Q+++     A  +LLVLLTTANNPD MI  Y+  +   IFF +F   G ++ MN++ AI++++FRG++L S+QTS+ RRRL ++A +EV+C   +  TS     ++ +V +  F +V++   +  + +  ++K A       +   + + +   LD+   KE       P Y    L+ +Q ++   Y  ++G      NV+ I   +    E + ++     + I   IFI  YLIE + K  A G+K Y S +   F+  +TVL+L I+I     ++   +    +    + +W++ R+ N+L++ R   I+     +  + +T+ D+   +++  G+LL+++Y++A+LG+ +F G +          +    N T      CGTF+QL+Y   NFDDF +S++ L+ +++VNNWH F +A+     D  LV  Y + WW+ + ++++N   A ++E +T+             R +G +    + + Y           T Q++FK  + EPTEE+L + L +       +PH   S+
Sbjct:   56 ADLYVQQAVVFIEDAIKYRSINHRVDSGSLRLYRWYYSNLCQWGLGLTIAVVLALAFIERPSSLTYTSDIRVKP---KPWEPPCGMTEGIEIVCLCIFILDVTAKGYLIGWEEFRMNKWLLAYLIVITASVIDWMLSISMLCDENLRVRRLIRPFFLLQNSSLMKKTLKCIKRTLPEIASVILLLALHICLFTMIGMLIFAKSDDPKQNGEWQTYFRNLPKALSSLLVLLTTANNPDVMIPAYSLNRGYSIFFILFSVFGTYLLMNLMTAIIYNQFRGYLLMSVQTSIIRRRLGIRAAFEVLCCPGRGHTSTQAEGHVERVAVSMFLKVMERVHMKSYCRQAIVKAARRFPDGFISGEDFQRLFNELDKDFVKEHPPK---PEYSSSGLQHIQYVYSHYYISVLGNAVALANVICICTVLVLNAEKSASEKNYFYMEIINCIFILYYLIEMLLKIVAFGWKGYLSYRNNIFDGFLTVLLLAIQIVIFITFKIPYVDVDPVPRHVMALWEMIRLVNMLIVFRFLRIIPEIKLMAVVASTIVDLVKNLRAFAGILLVVYYMFAVLGIWLFQGAISPPSNMSLVSNSSLENITGPYSMECGTFEQLEYWPNNFDDFASSLILLYNIMVVNNWHVFTDAYARYTTDWSLV--YFVVWWLTSSVMWVNLFVALILENFTY----------KWDRSNGLSVEDVERIAYQS---------TVQLMFKEHVKEPTEEELLAQLHQ-------HPHLHLSW 774          
BLAST of Two pore calcium channel protein 2 vs. UniProt/SwissProt
Match: sp|Q8BWC0|TPC2_MOUSE (Two pore calcium channel protein 2 OS=Mus musculus OX=10090 GN=Tpcn2 PE=1 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 4.049e-79
Identity = 206/659 (31.26%), Postives = 359/659 (54.48%), Query Frame = 3
Query:   81 QASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFN-GFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNE-TSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAI--EISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSR--KQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTP---IINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKL------DVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTH 2000
            QA  F+ DA +YRSI HR+D   L +Y + YS      + FII  +  LAF+E PSS +  + +   +        P  +T ++EA  LL  L+D   + YL G    ++N WLL  F ++ VS +D+ VS++L      R+RR  RP F LQ S +MKK +K +  ++ ++ SV LLL + L +FT+I + +F  G  D++ D +  +++     A  +LLVLLTT+NNPD MI  Y   +   +FF +F  IG    MN+L AI++++FRG+++ S+QTSL RRRL  +A YEV+        T+  +  V  + F  V++ + ++K  K  +++   S     +     + +   +D+    ++    P Y+   L+T Q IF   YF+ +G +    N+L+I +   + +           L I  +IFI  YL+E + K FA+G   Y S     F+ L+T+++L  +I  + ++R      K   +  +++WD+ R+ N L++ R    L + P++ P   + NT+  +   +++  G+L++ +YV+A++G+N+F G +       +   N +  CG+F+QL Y   NFDDF A+++TLW +++VNNW   +EA++         +Y + WW+++ ++++N   A ++E + H
Sbjct:   32 QAVVFIEDAIKYRSIYHRMDAGSLWLYRWYYSNVCQRVLGFIIFLILILAFVEVPSSFTKTADVRYRS---QPWQPPCGLTETIEAFCLLAFLVDLSVKGYLVGQAQLQQNLWLLAYFMVLVVSVVDWIVSLSLACEEPLRMRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTIIGMLLFTIGEKDEAQDQERLAYFRNLPEALTSLLVLLTTSNNPDVMIPAYTQNRAFALFFIVFTLIGSLFLMNLLTAIIYNQFRGYLMKSLQTSLFRRRLGARAAYEVLASRAGPAGTTPELVGVNPETFLPVLQKTQLNKTHKQAIMQKVQSYEGRPMLADEFQKLFDEVDKGLAKERPLK-PQYQSPFLQTAQFIFSHHYFDYLGNLVALGNLLSICVFLVLDSDLLPGERDDFVLGILDYIFILYYLLELLFKVFALGLPGYLSYHSNVFDGLLTIILLVSEICTLAVYRLPHSGWKPEQYGPLSLWDMTRLMNTLIVFR---FLRIIPNIKPMAEVANTILGLIPNLRAFGGILVVAYYVFAMIGINLFRGVIVPPGNSSLVPDNNSAVCGSFEQLGYWPNNFDDFAAALITLWNVMVVNNWQVILEAYKRYA-GPWSMVYFVLWWLVSSVIWINLFLALLLENFLH 682          
BLAST of Two pore calcium channel protein 2 vs. UniProt/SwissProt
Match: sp|Q8NHX9|TPC2_HUMAN (Two pore calcium channel protein 2 OS=Homo sapiens OX=9606 GN=TPCN2 PE=1 SV=2)

HSP 1 Score: 247.284 bits (630), Expect = 8.570e-70
Identity = 226/736 (30.71%), Postives = 383/736 (52.04%), Query Frame = 3
Query:   81 QASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNG-----FDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDA--FKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAI--EISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMS---RKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKL-------DVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTH---VKSHYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDLQSPLRKCSFLCEHYPHF 2222
            QA  F+ DA +YRSINHRVD + + +Y   YS      + F I  +  LAF+E PSSL+  + +            P  +T S+E + LLV   D   + YLFG    +KN WLL    ++ VS +D+ VS++L      R+RR  RP F LQ S +MKK +K +  ++ ++ SV LLL + L +FT+  + +F G       D+   + +Q+   +  +LLVLLTTANNPD MI  Y+  +   IFF +F  IG    MN+L AI++ +FRG+++ S+QTSL RRRL  +A +EV+  +   E  A    V +      +V++   +    K  M++   S G+  +     + +   LD     K+    P Y+   L++ Q +F   YF+ +G +    N+++I +   +             L I   +FI  YL+E + K FA+G + Y S     F+ L+TV++L ++IS + ++R      R ++V   +++WD+ R+ N+L++ R   I+     +  + +T+  +   M++  G+L++++YV+A++G+N+F G +        +   N +  CG+F+QL+Y   NFDDF A++VTLW L++VNNW  F++A+          IY + WW+++ ++++N   A ++E + H    +SH       L    G+ +A                  T ++LF++ L EP E++L   L +       +PH 
Sbjct:   48 QAVVFIEDAIQYRSINHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAA---PWEPPCGLTESVEVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVCHEPLRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAGGKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGSLFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVL-SSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELD-RSVVKEHPPRPEYQSPFLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYYLLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVG-LLSLWDMTRMLNMLIVFRFLRIIPSMKLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIVALPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVNNWQVFLDAYR-RYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPRSH-------LQPLAGTPEATYQ--------------MTVELLFRDILEEPGEDELTERLSQ-------HPHL 748          
BLAST of Two pore calcium channel protein 2 vs. UniProt/SwissProt
Match: sp|Q94KI8|TPC1_ARATH (Two pore calcium channel protein 1 OS=Arabidopsis thaliana OX=3702 GN=TPC1 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 8.933e-21
Identity = 114/483 (23.60%), Postives = 217/483 (44.93%), Query Frame = 3
Query:  696 YQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDW---------LNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWD----LPRITNLLVLI------RA--AGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETY---------THVKSHYNKEKVNLTRPHGS 2054
            + S+ +  Y + +L TT+NNPD  I  Y   + + +FF +++ IG++   N+++A+V+D F+  +   +      +R  ++  + ++  +   E   N     I  F+++    ++ K  K E     D L  +T D+         L   + L+   E   S        Y   + + L++   S  F         +N +A+ +E +   E+++ Q     +  ++F  +Y++E   K +  G++ Y+ +   RF+FL+T +I+   I E   + T       F+    W     L R+  L+ L+      RA  A  + L PSL P + T+F V     S+              G+ +FGG ++    NK        + DY   NF+D+   +VTL+ LL++ NW  +ME+++    +     Y +S++VIT+++ +N + AFV+E +            +   ++EK N  R  GS
Sbjct:  248 FTSYGATLYQMFILFTTSNNPDVWIPAYKSSRWSSVFFVLYVLIGVYFVTNLILAVVYDSFKEQLAKQVSGMDQMKRRMLEKAFGLIDSDKNGEIDKNQC---IKLFEQLTNYRTLPKISKEEFGLIFDELD-DTRDFKINKDEFADLCQAIALRFQKEEVPSLFEHFPQIYHSALSQQLRAFVRSPNFGYAISFILIINFIAVVVETTLDIEESSAQK-PWQVAEFVFGWIYVLEMALKIYTYGFENYWREGANRFDFLVTWVIV---IGETATFITPDEN--TFFSNGEWIRYLLLARMLRLIRLLMNVQRYRAFIATFITLIPSLMPYLGTIFCVLCIYCSI--------------GVQVFGGLVNAG--NKKLFETELAEDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMESYKDLTGTWWSITYFVSFYVITILLLLNLVVAFVLEAFFTELDLEEEEKCQGQDSQEKRNRRRSAGS 704          
BLAST of Two pore calcium channel protein 2 vs. UniProt/SwissProt
Match: sp|Q75VR0|TPC1B_TOBAC (Two pore calcium channel protein 1B OS=Nicotiana tabacum OX=4097 GN=TPC1B PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.590e-20
Identity = 108/461 (23.43%), Postives = 207/461 (44.90%), Query Frame = 3
Query:  672 DDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCE---NYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSI----PN-YKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIW-DLPRITNLLVLIR-----------AAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETY 1994
            D +   + + S+ +  Y + VL TT+NNPD  I  Y   +   +FF +++ +G++   N+++A+V+D F+  ++  +      R   +K  + ++ E      NE    +   E++ ++ + K   IS      +    D  G   ++      +  ++    + +    I    PN Y     + L+       FE I +    +N++A+ IE +   ++ + Q     +  + F  LY+IE   K +  G++ Y+     RF+F++T +I+   I E T +  ++   L F     W     I  +L LIR            A  L L PSL P + T+F +     S+              G+ IFGG ++    N   A       DY   NF+D+   +VTL+ +L++ NW  +M++++    +   + Y +S+++I+V+  +N I AFV+E +
Sbjct:  243 DTRQGKTTFTSYGTTLYQMFVLFTTSNNPDVWIPAYKDSRWYCLFFVLYVLLGVYFVTNLILAVVYDSFKSELVKQVADKDRLRLRTLKKAFSLIDEANNGLLNEKQCTLLFEELNKYRTLPK---ISGDDFKSIFNELDDTGDFKINLEEFADLCSAIGLRFQKEDSLPIFEACPNFYHSPASEKLRGFIRGATFEYIIVFVLLVNLVAVIIETTLDIQNNSGQTFWQKVE-FTFGWLYVIEMALKVYTYGFENYWRDGQNRFDFIVTWVIV---IGETTTF--VAPDDLTFLSNGEWIRYLLIARMLRLIRLLMHVERYRAFVATFLTLIPSLMPYLGTIFCILCFYCSL--------------GLQIFGGIVNTG--NPNLAQTDLAGNDYLLFNFNDYPNGMVTLFNILVMGNWQVWMQSYKELTGTSWTYAYFVSFYLISVLWLLNLIVAFVLEAF 678          
BLAST of Two pore calcium channel protein 2 vs. TrEMBL
Match: A0A4E0RU99 (Two pore calcium channel protein 2 OS=Fasciola hepatica OX=6192 GN=D915_004687 PE=4 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 1.211e-106
Identity = 243/716 (33.94%), Postives = 399/716 (55.73%), Query Frame = 3
Query:   66 NLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSK--CWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGF---------DDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAET-VDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKTQ-ACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRP-HGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDL 2171
            +L  RQA   + DAE +RSI H++D   L +Y   YS+  CW   +   I+ L  L F E+PSSL+++S + + +    R  +P  VT ++EAV + ++++DS     +FG  +   NPWLL  F L  +   D+ VS+ +    ++R+RRF RP F +  SQ+MKK++KSL +T+  +FS L LL  WL   TL+++ +F+           D       +  FY++ Y LLVLLTTAN+PD ++ IY   +   +F  +F+ IG++VFMN+L AIV+ EFRG+++ S+QT L+RRR+A +A +E++   + N +S + ++   D    VI  + +S W++  + +   SL AE+ +       + ++LD+     +   +        +  Q+   S  F  + +    LNV ++A+++S +   +    + + I  W F+  Y++EQ C  +A G +++FS+ G  F      L+L +KI E+       R    F   T+WD+ R+TN+L+L RA  I+ LF     ++  L D+P  +  V+G+L   +YVYALLGM++F G +  H  +  +  CGT+QQL+Y  +NFDDF +S++ LW L++VNNW   + A+  AV S  VH+YMISWW++  +  ++ +TAFVIET+ + +  Y K K  L RP    T  +   V + +    S    T   + + D  + TE DL
Sbjct:   17 SLLGRQARVLIEDAENHRSIFHKLDAQNLSLYELYYSRFACWTRRIALAILFL--LPFFEWPSSLTLSSDVRLQS---QRPRLPCGVTETVEAVCIGILIVDSTILATVFGRSSLLHNPWLLGRFILFPIYTTDWAVSLCMGCDEFYRVRRFLRPYFLISGSQMMKKLLKSLKRTLPKLFSTLFLLLFWLVCATLVALCLFSKPHESDPSLTEDMTQLPDSFPDFYTSMYNLLVLLTTANHPDVVLDIYTRNRACGLFSVVFLGIGLYVFMNILTAIVYSEFRGYLMSSVQTRLTRRRVATRAAFEIL--RHMNASSGS-NQASSDDILAVIFAAKVSTWKRDAVHERYVSLFAESDLSAAQFMDLFRALDQSGPPFEESRLRTVPSGCARWFQAWITSSSFSKLSIAVSFLNVASLAVDLSERATTSVNVGVEMRIINWCFVTFYVVEQACLIWAYGPRIFFSRLGNIFGLTTVCLLLVVKIVELGFLVAEIRGHHTFLNFTLWDVVRLTNILLLTRAVRIVQLFTWTQLVVGVLQDLPRNLTPVLGVLATAYYVYALLGMDLFKGVIRYHANDTARFECGTYQQLEYWSVNFDDFASSLILLWDLMVVNNWFVIVNAYREAV-SLWVHVYMISWWLLVPVGLLSLVTAFVIETFLYRRDLYFKAKALLDRPLEVVTQQVCVNVPFAQPPVTSTPIVT---VVREDDTQSTEADL 720          
BLAST of Two pore calcium channel protein 2 vs. TrEMBL
Match: C7TXY9 (Two-pore calcium channel protein 2 (Voltage-dependent calcium channel protein TPC2) OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 1.809e-96
Identity = 234/686 (34.11%), Postives = 383/686 (55.83%), Query Frame = 3
Query:   78 RQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDD--------KSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKL---ILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIW---RTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKTQA-------CGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHV------KSHYNKEKVNLTRPHGS 2054
            RQA   + DAE YRSINH++D+  L +Y+  +S    +     +V +  L F E+PSSL+V+S + +    +   ++P  VT  +E + LL I + S+     FGL   + NPWL+  +  + +  +D  VS++ +   ++R+RR  RP F +  SQLMKKVIK   +T+  +F++L LL  WL   TL+++ +F+  +          +  + +  FY   + LLVLLTT N+PD +I  YN  +   IF  +++ +G++V MN+L A V+ EF G+++ S+QT L RRR+A +A +EV+   Y++     I  V  D    +I    I  W+K  M +    L   +   LN K    + Q LD    S +       + ++ +  +++ +SK FE++      LNV+ + ++IS          + + I +W F+  Y+ EQI   +A G + YFSKK   F   I  +IL +K+ E+T+    R M+R  + ++R+TIWD+ R++N+L+L R   +++LFP    ++N L D+P  +  V+G+L+  FY YALLGMN+F     + + N T +       CGT+Q+L Y  INF+DF AS+V LW L++VNNW   + A+  AV+ + VH+YMISWW+  V+  ++  TAF+IE++ H       KS Y  + + +TR + S
Sbjct:   17 RQARILIEDAENYRSINHKLDKHSLIMYDVSHSFYLTLLHRASLVIMFLLPFFEWPSSLTVSSDIRLK---LEPPNLPCGVTEGVELLCLLFISVQSILLSGAFGLSWVRVNPWLIGKYIFLIIYLLDLIVSLSFRCSEFYRIRRLIRPYFLISSSQLMKKVIKCYRRTLPTLFNLLFLLLFWLISATLVAMCVFSKPNRDLTNYNVVNNTSTTFTDFYDTLFNLLVLLTTTNHPDILIPPYNKNRGTAIFSIVYIGVGLYVLMNILTAAVYSEFSGYLMSSVQTRLMRRRVATRAAFEVL--KYEHN---GIELVSGDDVVYLINTIRIETWKKDTMRQVY--LMKYSRANLNAKQFMKLFQLLDLLGPSNQSIPEQVPRHRLARIFKTLIMSKGFELVRFFISVLNVIYLCVDISYSLSTGKYPGVIMRIISWCFVIFYVFEQISFLWAYGQRAYFSKKSNIFGIFIVAVILIVKLVELTLLLTSRQMTR--ISYFRMTIWDIVRLSNILLLTRTTRLIVLFPWTRLVVNVLTDLPTNLAPVLGILVSAFYFYALLGMNLFSDV--IKYRNSTNSSKPEIYECGTYQELQYWSINFNDFAASLVLLWDLMVVNNWQIIVIAYTQAVN-RWVHVYMISWWLFVVVGILSLTTAFIIESFLHRHDLQPKKSVYENKSLKITRNNTS 687          
BLAST of Two pore calcium channel protein 2 vs. TrEMBL
Match: A0A3Q0KRQ5 (Two-pore calcium channel, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 1.775e-95
Identity = 227/666 (34.08%), Postives = 374/666 (56.16%), Query Frame = 3
Query:   66 NLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFD-DKSFDS-------KYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAE-TVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVF---WRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKTQA-------CGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVK 2006
            NL  +QA  F+ DAE YRSINH++D+  L +Y   +     +     +V L  L F E+PSSL+++S + +    +   + P  VT  +E + LL+I I S+     FGL   ++NPWL+  +  + +  +D  VS++L+   Y+R+RR  RP F +  SQLMKKV+K   +T+  +F++L LL  WL   TL+++ +FN  + D + DS        +  FY   ++LLVLLTT N+PD +I  YN  +   IF  +++ +G++V +N+L A V+ +F G+++ S+QT L RRR+A +A +EV+   Y       +  V  D    +IK   I  W+K  + +      A   ++      + Q LD    S +        +++ +  Q+  +SK FE++ ++    NV+ + ++IS          + + I +W F   Y+ EQI   +A G K +FSKK   F   I  +I  +K+ E+T+   +   Q+V    +R+TIW++ R++N+L+L R   +++LFP    +++ L D+P  +  V+G+L+  FY YALLGMN+F   +  H  N T +       CGT+Q+L Y  I+F+DF AS+V LW L++VNNW   + A++ AV+ + VHIYMISWW+  V+  +N  TAF+IE++ H +
Sbjct:   14 NLALKQARVFIEDAENYRSINHKLDKHSLIMYELSHGFYLTILHRTSLVILFLLPFFEWPSSLTMSSDIRLK---LKPPNPPCGVTEGIEFLCLLIISIQSILLSGAFGLPWVRENPWLIGKYIFLVIYLLDLIVSLSLRCSEYYRIRRLIRPYFLISSSQLMKKVLKCYRRTLPTLFNLLFLLGFWLVSATLVAMCVFNKPNRDLTKDSVVNTTTTAFTDFYDTLFSLLVLLTTTNHPDILIPPYNGNRGTAIFSIVYLGVGLYVLLNILTAAVYSQFSGYLMSSVQTRLMRRRVATRAAFEVLKYEYN-----GMELVSSDDIVGLIKTVHIDTWKKDTLRQAYFMRHAHGNINAKQFMQLFQILDLSGPSNQSVHEQVPSLRVARIFQTWIMSKGFELVRIIISVFNVIFLCVDISYSLSTGKYPGVIMRIISWGFTIFYVFEQISFLWAYGQKAFFSKKSNIFGLFIVAIIFVVKLIELTL--LLVSHQMVHISQFRMTIWNIVRLSNILLLTRTTRLIVLFPWTRLVVSVLADLPSNLTPVLGILISAFYFYALLGMNLFHDVIKYH--NSTNSSNPQIYQCGTYQELQYWSIHFNDFAASLVLLWDLMVVNNWQIIVFAYQQAVN-RWVHIYMISWWLFVVVGILNLTTAFIIESFLHRR 666          
BLAST of Two pore calcium channel protein 2 vs. TrEMBL
Match: C3ZNK2 (Uncharacterized protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_247958 PE=4 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 2.319e-94
Identity = 220/670 (32.84%), Postives = 381/670 (56.87%), Query Frame = 3
Query:   81 QASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYL--------GINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVA----------LKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFN-GFDDKSF----DSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKN-ETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAE---TVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRT----MSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKTQ-ACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETY 1994
            QA  F+ DA  YRSI+HRVD   L++Y   YS      M   I  L  LAF E PSSLS  S          G N T  ++   P  VT S+E V LL+ L D V + YL G +   K+PWL+    ++ VS +D+ V++           L+     R+RRF RP F LQ S LMKK +  + +T+ +IF+VL+L FL ++ FT++ + +F+    D++     D  + S ++AF TLLVLLTTANNPD  +  Y+H +L  ++F +F+AIG+++  N++ A+++++FRG++  S+Q S  RRR+A++  +EV+ +  K   T+++   V +     VI+  S+ K  +    +  D LG +   T +    + +   LD   E      +P ++   L+ LQ +   +YFE +  V    N+L ++I ++ +++        L +  ++F+  YL+EQ  K+  +G++ Y  +K   F+ L+T  ++ ++I  +  + +    + RK  V   I +WDL RITN+L++ R   ++ LF +++ +++TL D+   M++  G+L++++Y++A+LG+ IF G  D   F      CG++QQL+Y   NF+DF +++V LW +++VNNW  F+ A++ A+ +    ++ I WW+++V+V++NC  A V+E +
Sbjct:    1 QAVVFVEDAIHYRSIHHRVDPWSLRLYRLYYSNWVQWGMYAAISVLLILAFFERPSSLSYTSDTQMLFRDRNGTNQT--SQWEPPCGVTESIELVCLLIFLADFVVKTYLVGKEKFLKSPWLIAYVLILIVSLLDWMVTLGVLCVVQVPGTLRYRPVLRIRRFLRPFFLLQNSSLMKKTVNCIKRTLPEIFAVLVLQFLHVYFFTIVGMLLFSEPVVDRATTGISDPNFHSLWNAFITLLVLLTTANNPDVTMTAYSHNRLYAVYFILFLAIGLYLLFNMMTAVIYNQFRGYLQSSLQGSFFRRRVAVRTAFEVLSQQNKELSTNSDNDSVRVSTIYHVIEKVSLPKGAER---RITDKLGRDMFGTYNAAQFQAVFDLLDLDYEVHHRPPLPAFRHSWLQFLQKMIAHRYFEYLCCVVALSNILTVSILLTIEYDQLNATNSDLELLNFVFVVYYLVEQCLKFVLLGWRYYRIRKTYIFDALVTFGLVIVEIMTLVEYGSPFSELDRKDKVETVIELWDLIRITNILIMFRLLRVISLFKTMSLVLSTLLDLIKNMRAFAGILVVIYYIFAILGIEIFSGVTDYETFRTPNLTCGSYQQLNYWANNFNDFASALVVLWDVMVVNNWMVFLFAYKDALSTGWAQLFFIVWWLVSVVVYVNCFIALVLENF 665          
BLAST of Two pore calcium channel protein 2 vs. TrEMBL
Match: A0A2T7P5T0 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11372 PE=4 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 1.972e-90
Identity = 232/672 (34.52%), Postives = 387/672 (57.59%), Query Frame = 3
Query:   81 QASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNG-----------------------FDDKSFDSKY-QSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIKNSS----ISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMS-LNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKI-SEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDV----HFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETY 1994
            QA  FL DA +YRSINH+VDE  L++Y   +S    VF V +I +LH LAF E+PSSLS++S + +      R+ VP  +T ++E + LL++L D+V + +L G     K  W +    ++ +S ID+ VSV +      R RR  RP F LQ S LMKK++  L  T+ ++FSVL++L + L++FTL+ + +F                          D+++   KY  +   +F +LLVLLTTANNPD  +  Y+H +L+ +FF +F+ IG++ FMN+L A+++++FRG+ L+SMQ+SL+RRRL ++A +EV+     N    N  +V  +  K+V+K       +  + +  +++  D     +    + + +   LD  K+  +   +  +   +L  LQ IF+ + F   G+    LNV+ I++E++ +++ +   + S L    + F   YL+EQ+ K +AMG++ Y   KG  F+ +IT+ ++  ++ S IT       K  V    T+W++ RI N+L+++R   I+    S+  I + L D+   MKS  G+L++++Y +A+LGM IF  K+ V    +  N T ACGT++QL Y   NFDDF A+IV LW +++VNNW+ F+EAF  A  S   +++ ++WW+I+VI+ +N  TA ++E +
Sbjct:  113 QAVVFLEDAFKYRSINHKVDEICLRLYRQYHSTAVQVFRVAVIFTLHILAFFEYPSSLSLSSDVRLRQ---ERVDVPCWLTSTIELLCLLLLLADNVTRFFLLGRRNFFKLKWDMASIIIVVISIIDWMVSVGMGCAEPVRFRRILRPFFILQNSSLMKKIVNCLRMTMPEVFSVLIMLAMHLYIFTLLGMLLFPTPPQRPQSANSTNTVPDNATMGVISDNRNEGRKYFGTLLDSFMSLLVLLTTANNPDVTMPAYSHNRLSSLFFIVFLIIGLYCFMNMLTAVIYNQFRGYFLNSMQSSLNRRRLGVRAAFEVLRRKRGNLHPDNRIEVRTEVGKQVVKAVVEKIFVPVYIRHALLEELDKYPESSFCAKDFQQLFTLLDMEKKPAREVEVRWFVNPLLWRLQRIFVHRMFAYFGIFVAFLNVIVISVELATQYDQSFYDSHSDLRAFNFSFAIYYLVEQVLKIWAMGWRRYVFDKGNVFDGVITLALVGGEMFSAITFGVPFFEKHEVSSINTLWNVLRIINILIMVRLLRIIPHLKSMRIISSVLLDLVRNMKSFAGVLIVIYYAFAILGMEIFSDKITVDKITNTSNVTYACGTYRQLMYWANNFDDFAAAIVVLWHIMVVNNWNVFLEAFGEAT-SPWSYLFFVAWWLISVIIVLNLFTALIMENF 780          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Cavefish
Match: tpcn2 (two pore segment channel 2 [Source:NCBI gene;Acc:103032998])

HSP 1 Score: 275.404 bits (703), Expect = 4.797e-81
Identity = 214/745 (28.72%), Postives = 397/745 (53.29%), Query Frame = 3
Query:   66 NLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRI-SVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMC---ENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMS--LNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWR--ITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKL--------------DVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDLQSPLRKCSFLCEHYPHF 2222
            +L+ +QA  F+ DA +YRSINH+VD   L++Y + YS+     +   I  +  LAF+E PSS++  S    +  F       P  +T ++E V LL+ + D   + +L G +    N WL+    ++  S +D+ ++V++      R+RR  RP F LQ S LMKK +K + +T+ +I SV+LLL L L +FT++ + IF   ++   + ++Q+++     A  +LLVLLTTANNPD M+  Y+  +   +FF +F   G ++ MN+L AI++++FRG++L S++TS+ RRRL ++A +EV+C   + +  ++  ++ KV +D    V+    +  + +  ++  A    A  +D    + +   LD+ +  K+    P Y    L+ +Q+     Y  ++G V    NV+ I   +    E T +Q     + +    FI  YL+E + K  A G++ Y S K   F+ + TVL+L ++I+ +  ++   +      R  +++W++ R+ N+L++ R   I+     +  + +TL D+   +++  G+L++++YVYA++G+ +F G +              +    N T  CG+++QL+Y   NFDDF +S+V L+ +++VNNW  FM+A+     ++   +Y +SWW+ + ++++N   A ++E +T+             + H  + +  + +RY           T Q +F+  + EPT+E+L   L       +H+PH 
Sbjct:   28 DLYIQQAVVFIEDAIQYRSINHKVDSGSLRLYRWYYSRICQWGLGLTIAVILALAFVEKPSSITHTS----DPRFRPAAWEPPCGLTEAIELVCLLIFITDVAVKSHLIGWEEFCTNKWLIGYVLVIAASVVDWTITVSMLCNETIRVRRLLRPFFLLQNSSLMKKTLKCIKRTLPEIASVILLLALHLCLFTMVGMLIFPKSEEPEKNGEWQAYFRNLPQALSSLLVLLTTANNPDVMVPAYSLNRGYALFFILFSVCGTYILMNLLTAIIYNQFRGYLLMSVKTSVIRRRLGIRAAFEVLCCQVQGHSIDSEGHVGKVRVDTVLEVMSRVQMKSYYRQAVVTAARQFSAGFMDGEAFQRLFDELDKDR-IKEHPPNPQYSSPFLQWIQNTCSHYYLTVVGNVVALANVICICTVLVLDSEKTVSQRDDYYMEVINCAFILYYLLEMVLKLIAFGWRGYLSYKNNIFDGVFTVLLLVLQIAIVATYKIPYQASSPAQRGVMSLWEMVRLANMLIVFRFLRIIPEIKLMALVASTLVDLVKNLRAFAGILVVVYYVYAVIGIWLFHGAIRPPGSPSTVSNSSTENRTSNYTMECGSYEQLEYWPNNFDDFASSLVLLYDVMVVNNWQVFMDAYSRYT-TEWSKVYFVSWWLTSSVMWVNLFVALILENFTY----------KWDKSHALSVSDVERMRYET---------TVQRMFREHIQEPTQEELLVQL-------QHHPHL 740          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Cavefish
Match: tpcn2 (two pore segment channel 2 [Source:NCBI gene;Acc:103032998])

HSP 1 Score: 275.404 bits (703), Expect = 5.856e-81
Identity = 217/746 (29.09%), Postives = 398/746 (53.35%), Query Frame = 3
Query:   66 NLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMC---ENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMS--LNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWR--ITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKL--------------DVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHV--KSHYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDLQSPLRKCSFLCEHYPHF 2222
            +L+ +QA  F+ DA +YRSINH+VD   L++Y + YS+     +   I  +  LAF+E PSS++  S              P  +T ++E V LL+ + D   + +L G +    N WL+    ++  S +D+ ++V++      R+RR  RP F LQ S LMKK +K + +T+ +I SV+LLL L L +FT++ + IF   ++   + ++Q+++     A  +LLVLLTTANNPD M+  Y+  +   +FF +F   G ++ MN+L AI++++FRG++L S++TS+ RRRL ++A +EV+C   + +  ++  ++ KV +D    V+    +  + +  ++  A    A  +D    + +   LD+ +  K+    P Y    L+ +Q+     Y  ++G V    NV+ I   +    E T +Q     + +    FI  YL+E + K  A G++ Y S K   F+ + TVL+L ++I+ +  ++   +      R  +++W++ R+ N+L++ R   I+     +  + +TL D+   +++  G+L++++YVYA++G+ +F G +              +    N T  CG+++QL+Y   NFDDF +S+V L+ +++VNNW  FM+A+     ++   +Y +SWW+ + ++++N   A ++E +T+   KSH                +++D V  M+  T      T Q +F+  + EPT+E+L   L       +H+PH 
Sbjct:   44 DLYIQQAVVFIEDAIQYRSINHKVDSGSLRLYRWYYSRICQWGLGLTIAVILALAFVEKPSSITHTSDPRFRPA---AWEPPCGLTEAIELVCLLIFITDVAVKSHLIGWEEFCTNKWLIGYVLVIAASVVDWTITVSMLCNETIRVRRLLRPFFLLQNSSLMKKTLKCIKRTLPEIASVILLLALHLCLFTMVGMLIFPKSEEPEKNGEWQAYFRNLPQALSSLLVLLTTANNPDVMVPAYSLNRGYALFFILFSVCGTYILMNLLTAIIYNQFRGYLLMSVKTSVIRRRLGIRAAFEVLCCQVQGHSIDSEGHVGKVRVDTVLEVMSRVQMKSYYRQAVVTAARQFSAGFMDGEAFQRLFDELDKDR-IKEHPPNPQYSSPFLQWIQNTCSHYYLTVVGNVVALANVICICTVLVLDSEKTVSQRDDYYMEVINCAFILYYLLEMVLKLIAFGWRGYLSYKNNIFDGVFTVLLLVLQIAIVATYKIPYQASSPAQRGVMSLWEMVRLANMLIVFRFLRIIPEIKLMALVASTLVDLVKNLRAFAGILVVVYYVYAVIGIWLFHGAIRPPGSPSTVSNSSTENRTSNYTMECGSYEQLEYWPNNFDDFASSLVLLYDVMVVNNWQVFMDAYS-RYTTEWSKVYFVSWWLTSSVMWVNLFVALILENFTYKWDKSH--------------ALSVSD-VERMRYET------TVQRMFREHIQEPTQEELLVQL-------QHHPHL 756          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Cavefish
Match: tpcn2 (two pore segment channel 2 [Source:NCBI gene;Acc:103032998])

HSP 1 Score: 275.018 bits (702), Expect = 7.997e-81
Identity = 218/747 (29.18%), Postives = 400/747 (53.55%), Query Frame = 3
Query:   66 NLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRI-SVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMC---ENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMS--LNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWR--ITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKL--------------DVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHV--KSHYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDLQSPLRKCSFLCEHYPHF 2222
            +L+ +QA  F+ DA +YRSINH+VD   L++Y + YS+     +   I  +  LAF+E PSS++  S    +  F       P  +T ++E V LL+ + D   + +L G +    N WL+    ++  S +D+ ++V++      R+RR  RP F LQ S LMKK +K + +T+ +I SV+LLL L L +FT++ + IF   ++   + ++Q+++     A  +LLVLLTTANNPD M+  Y+  +   +FF +F   G ++ MN+L AI++++FRG++L S++TS+ RRRL ++A +EV+C   + +  ++  ++ KV +D    V+    +  + +  ++  A    A  +D    + +   LD+ +  K+    P Y    L+ +Q+     Y  ++G V    NV+ I   +    E T +Q     + +    FI  YL+E + K  A G++ Y S K   F+ + TVL+L ++I+ +  ++   +      R  +++W++ R+ N+L++ R   I+     +  + +TL D+   +++  G+L++++YVYA++G+ +F G +              +    N T  CG+++QL+Y   NFDDF +S+V L+ +++VNNW  FM+A+     ++   +Y +SWW+ + ++++N   A ++E +T+   KSH                +++D V  M+  T      T Q +F+  + EPT+E+L   L       +H+PH 
Sbjct:   48 DLYIQQAVVFIEDAIQYRSINHKVDSGSLRLYRWYYSRICQWGLGLTIAVILALAFVEKPSSITHTS----DPRFRPAAWEPPCGLTEAIELVCLLIFITDVAVKSHLIGWEEFCTNKWLIGYVLVIAASVVDWTITVSMLCNETIRVRRLLRPFFLLQNSSLMKKTLKCIKRTLPEIASVILLLALHLCLFTMVGMLIFPKSEEPEKNGEWQAYFRNLPQALSSLLVLLTTANNPDVMVPAYSLNRGYALFFILFSVCGTYILMNLLTAIIYNQFRGYLLMSVKTSVIRRRLGIRAAFEVLCCQVQGHSIDSEGHVGKVRVDTVLEVMSRVQMKSYYRQAVVTAARQFSAGFMDGEAFQRLFDELDKDR-IKEHPPNPQYSSPFLQWIQNTCSHYYLTVVGNVVALANVICICTVLVLDSEKTVSQRDDYYMEVINCAFILYYLLEMVLKLIAFGWRGYLSYKNNIFDGVFTVLLLVLQIAIVATYKIPYQASSPAQRGVMSLWEMVRLANMLIVFRFLRIIPEIKLMALVASTLVDLVKNLRAFAGILVVVYYVYAVIGIWLFHGAIRPPGSPSTVSNSSTENRTSNYTMECGSYEQLEYWPNNFDDFASSLVLLYDVMVVNNWQVFMDAYSRYT-TEWSKVYFVSWWLTSSVMWVNLFVALILENFTYKWDKSH--------------ALSVSD-VERMRYET------TVQRMFREHIQEPTQEELLVQL-------QHHPHL 760          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Cavefish
Match: tpcn2 (two pore segment channel 2 [Source:NCBI gene;Acc:103032998])

HSP 1 Score: 267.314 bits (682), Expect = 5.966e-78
Identity = 215/735 (29.25%), Postives = 393/735 (53.47%), Query Frame = 3
Query:   66 NLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRI-SVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFY----SAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMC---ENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMS--LNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWR--ITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKL--------------DVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHV--KSHYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDLQSPLR 2186
            +L+ +QA  F+ DA +YRSINH+VD   L++Y + YS+     +   I  +  LAF+E PSS++  S    +  F       P  +T ++E V LL+ + D   + +L G +    N WL+    ++  S +D+ ++V++      R+RR  RP F LQ S LMKK +K + +T+ +I SV+LLL L L +FT++ + IF   ++   + ++Q+++     A  +LLVLLTTANNPD M+  Y+  +   +FF +F   G ++ MN+L AI++++FRG++L S++TS+ RRRL ++A +EV+C   + +  ++  ++ KV +D    V+    +  + +  ++  A    A  +D    + +   LD+ +  K+    P Y    L+ +Q+     Y  ++G V    NV+ I   +    E T +Q     + +    FI  YL+E + K  A G++ Y S K   F+ + TVL+L ++I+ +  ++   +      R  +++W++ R+ N+L++ R   I+     +  + +TL D+   +++  G+L++++YVYA++G+ +F G +              +    N T  CG+++QL+Y   NFDDF +S+V L+ +++VNNW  FM+A+     ++   +Y +SWW+ + ++++N   A ++E +T+   KSH                +++D V  M+  T     F  + LFK D    TE D +  L+
Sbjct:   48 DLYIQQAVVFIEDAIQYRSINHKVDSGSLRLYRWYYSRICQWGLGLTIAVILALAFVEKPSSITHTS----DPRFRPAAWEPPCGLTEAIELVCLLIFITDVAVKSHLIGWEEFCTNKWLIGYVLVIAASVVDWTITVSMLCNETIRVRRLLRPFFLLQNSSLMKKTLKCIKRTLPEIASVILLLALHLCLFTMVGMLIFPKSEEPEKNGEWQAYFRNLPQALSSLLVLLTTANNPDVMVPAYSLNRGYALFFILFSVCGTYILMNLLTAIIYNQFRGYLLMSVKTSVIRRRLGIRAAFEVLCCQVQGHSIDSEGHVGKVRVDTVLEVMSRVQMKSYYRQAVVTAARQFSAGFMDGEAFQRLFDELDKDR-IKEHPPNPQYSSPFLQWIQNTCSHYYLTVVGNVVALANVICICTVLVLDSEKTVSQRDDYYMEVINCAFILYYLLEMVLKLIAFGWRGYLSYKNNIFDGVFTVLLLVLQIAIVATYKIPYQASSPAQRGVMSLWEMVRLANMLIVFRFLRIIPEIKLMALVASTLVDLVKNLRAFAGILVVVYYVYAVIGIWLFHGAIRPPGSPSTVSNSSTENRTSNYTMECGSYEQLEYWPNNFDDFASSLVLLYDVMVVNNWQVFMDAYSRYT-TEWSKVYFVSWWLTSSVMWVNLFVALILENFTYKWDKSH--------------ALSVSD-VERMRYETTVQRMFRHRRLFKQD----TEVDGKGDLK 757          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Cavefish
Match: tpcn1 (two pore segment channel 1 [Source:NCBI gene;Acc:103033570])

HSP 1 Score: 85.5001 bits (210), Expect = 1.108e-16
Identity = 127/598 (21.24%), Postives = 274/598 (45.82%), Query Frame = 3
Query:  327 SLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFS-----IPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLF---PSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKTQACGTFQQLD-------------YGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVH---IYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPH 2048
            +LE + L+++  +   ++   G     ++   ++   ++F+ +I+  V V ++   + R+ R  RPIF L   +    V ++L +    +   + +L L LF   + ++  F  F     D  + +  ++  +L VLLTTAN PD M+  Y+  + + +FF ++++I ++  MN+L+A+VFD F G      ++ L  +R A++  ++++    + +    +S  + D   R  +   +S   +    K  +  G   +   +   I + +    ++++        +P+    + K +  +  SK F+    +  ++N + I +E +N      + +  +     +F+ +Y +E + K   +G   YFS     F+F +TV      I+            L F     +        +V++R   +L LF        +++T+F++  RM S+   L++ +Y +A++GM  F   +  +  N +     ++Q++             Y   NF++  +S VTL+ L +VNNW+  ME     V S+  H   +Y ++++++T++V M  I AF+++ +    ++  K +  L  P 
Sbjct:  134 TLELLALVMVAFELCMKLRWLGFHTFIRHKRTMVKTCVLFIQFIEAIV-VLVRQTSHLRVTRALRPIF-LVDCRYCGAVRRNLRQIFQSLPPFIDILLLLLFFMIIFAILGFCLFSTNPADHYFNTLENSIVSLFVLLTTANFPDVMMPAYSRNRWSCVFFIVYLSIELYFIMNLLLAVVFDTFNGVERVKFKSLLLHKRSAIEHAFQLLVSRQRPD---GVSLKQFDGLLRFYR-PRMSARDRFLTFKALNQSGTTMLSLQDFYKIYEVMGLKWKARRSGEHWFDDLPHTAFLIFKGINLVVKSKAFQYAIYIVVAVNGVWILVE-TNMLNSDFSWSQQVPWNYMVFLTIYGVEVLLKITGLGPVAYFSSGWNLFDFSVTVFAFLGLIA------------LAFHMEPFY-------FIVVLRPLQLLRLFKIKQRYRNVLDTMFELFPRMASLGLTLIIFYYSFAIVGMEFFADVIYPNCCNTSTVADAYRQINVTIGNRTVLEEGYYYLNNFNNILSSFVTLFELTVVNNWYITME----GVTSQTTHWSRLYFMTFYIVTMVV-MTIIVAFILDAFVFRMNYSRKNREPLDDPE 700          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Sea Lamprey
Match: tpcn3 (two pore segment channel 3 [Source:ZFIN;Acc:ZDB-GENE-141215-16])

HSP 1 Score: 97.4413 bits (241), Expect = 3.484e-21
Identity = 142/628 (22.61%), Postives = 293/628 (46.66%), Query Frame = 3
Query:  408 KNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLR--RFFRPIFALQ--KSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSK--YQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSL-SRRRLAMKA---IYEVMCENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAET----VDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEII--GLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEF----LITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKTQA-----CGT-------FQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPHGSTD-AINDGVRYMKIGTFSNNAFTFQMLFKNDL----IEPTEEDLQSP 2180
            K+P  + +   + ++ ID  + VAL    Y+ +R  R  RP+F +   +S+ +++  +++ +T+ +I  VL+L    + +F+L++  +F      + + K  +Q++++ F+ L VL+TT+N+PD M+  YN      IFF I++ +  ++FM++ +A+V++ +R H+ + ++ S+ S+RR   KA   + E + E +     + +  V + A   + +   +  W+  +   T   +G +      D LN+++I     +H        +  Y     + L+ +   ++F     G++  +   +A               ++++    W+F+ LY++E + K +    + +FS+      F    +I+ L+ TI +  I   R  +  Q++              +L ++R   I+  F     +I+T+ ++   M +  GL+++ +Y +A+LGM +F GK  + FF    A     CG        F    Y   NF+D  +S V L  L +VN WH  +  F +AV +    +Y I + +I VI+ +N   AF++E +           +  T   G T+ AI   ++ + +G    +     M+  +++     EP + +   P
Sbjct:  100 KDPKNICVLVTIILTVIDMVIYVALTHSGYYIVRWSRALRPLFVINFSESRQLRRSFRNIRRTLPEILGVLVLFLFSIAIFSLMAFKLFGKRHLITGEGKPYFQNYFNIFFELYVLVTTSNSPDVMMPAYNSSSWYAIFFIIYIVVNTYLFMSIFLAVVYNNYRKHLKNEVRNSVFSKRRTMAKAFGILRERLGEGWAVSQQSWMQLVGM-AVPSMSQAQRLLLWQVSDEEHTGH-IGKQAFVRLTDLLNIEVIETRGRQHPLQSCAPRV--YSSAASQALRHVVHHRFFRYFFDGVILLNAGFIA-----------GDEASLAIRQAEWLFLGLYVLEILLKLYTYEPQTFFSRSNFWNWFDVMIVISALLATIIVHSIQDARPTTSTQIL----------DFLLILRVLRLLRIVESFERFRVVIHTMINIGPTMVTYAGLIMVFYYTFAILGMELFQGK--IRFFPAGSADAQPFCGNPLLNGSKFYNEKYCKNNFNDLSSSFVLLVELTVVNQWHDILPGF-VAVTNVGARVYFILFHMIVVILVINIFIAFILEAFI----------LEYTLDKGETESAIEKKIQELGLGIAEEDVAGNGMVLVDNMETQDQEPRDAEASKP 689          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Nematostella
Match: EDO34712 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNJ0])

HSP 1 Score: 209.149 bits (531), Expect = 5.378e-58
Identity = 189/695 (27.19%), Postives = 355/695 (51.08%), Query Frame = 3
Query:  225 LAFLEFPSSLSVNS---YLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIK-SLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFD-----SKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANIS--KVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRT-------MSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGG-----KLDVHFFNKTQACGT--FQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNL---TRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDLQSPLRKCSFLCEHYPHFG 2225
            LAFLE PSSL+V+S   Y+        R  VP  +  ++E + L   + D V + ++ G     KN WLL    ++ +S+ D FVS++       R+RR  RP F LQ S LMKK++       +  I  +    +L L +   + +S     + +S         + +  ++  +L VLLTTANNPD M+  Y   +   I+F ++  IG++ F+N+L A+++++FRG+++ S+Q+SL RRRLA++A +EV+  N  +E+  N+S   V  ++  RV++   + +  +  + +  D L +  V     +   +++++ +   +  ++      +L+ LQ +    +F+  G    ++NV+ +++  S        QA +L      F+  Y  EQ  K +A+G++ Y S KG  +   +TVL++ I+I  ++++ +       M       +  ++ ++ RI N+L++ R   ++    +L+ +  TL ++   +   IG++  ++Y++A+ GM +F G     K   H    +  C    F +  Y   NFDDF A++V LW ++IVNNWH F++A+E  V+     +Y ++W++++VI+ +N   A ++E +    S + +++  L   T P GS  + +  +R             F  LF++ L+EP E +L + L    +L  H P +G
Sbjct:   13 LAFLETPSSLTVSSDPRYMS------PRPEVPCGILETIELLCLSCFVFDVVIKTHVIGKRQFFKNRWLLSYMLVLVISFADVFVSLSYNCGEVVRIRRILRPFFLLQNSSLMKKLVSLCFDDYLFTILYLKANPYLILCLQMSLQLSECRESNTESGSICEGAKFFPNLQTSMRSLFVLLTTANNPDVMMPAYMKNRFYAIYFIVYSGIGLYCFLNMLTAVIYNQFRGYLMTSLQSSLFRRRLAVRAAFEVL--NRLSESKENVSADSVSSNSLYRVLEKVHVKRRNQQLLREGLDDLPSGHVTVEEFQSWFEAIEKPRRRNRP-AMSYVTNPLLRKLQVVAAHHWFDYFGDFISAVNVVFVSVSTSTYKLLFPPQAANL-----FFVIYYCAEQSIKLWALGWQRYVSFKGNLYCGGVTVLLVVIEIIHLSLFGSPFNYAAKMPTTTDADYIFSLPNMVRIINMLIIFRLLRVVPNISALSLVAETLLNLVRNLIPFIGIIAAIYYIFAIFGMMLFEGVTNPLKRCAHTNATSDPCTELDFDKFQYFANNFDDFAAALVNLWDIMIVNNWHVFLKAYEKLVN-PWAQLYFLAWYLVSVIMIINLFVALILEAFV---SQWEQQQARLHKHTLP-GSLQSESQDLR-------------FHQLFRSSLVEPHEAELIAELNSHEYLRFH-PSYG 674          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Nematostella
Match: EDO47517 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM05])

HSP 1 Score: 62.003 bits (149), Expect = 7.640e-10
Identity = 73/296 (24.66%), Postives = 140/296 (47.30%), Query Frame = 3
Query:   78 RQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCEN 965
            + A+ +LN+  +    ++   +  +  YN  +S  +N+  +     L  L   E P     N  L  +N     +S+ + V   LE   L ++   +  ++   GL +   +   L  F ++ V +I+  V V ++   + R+ R  RP+F L  S  ++ V ++L + +  +  +L +L L LF   + ++  F  F     D  + +F  +F +L VLLTTAN PD M+  Y   + + IFF  ++++ ++  MN+L+A+V+D F     D  +     +R A +  Y ++C  
Sbjct:   11 KDAAIYLNEGLDNDRFDNHPTQHTITWYNIAHSTWYNILDLMASTLLLALGLAEHP----FNGALPTSNV----LSLGAPVHGILEVTALSMLACGAFVKMKWQGLKSFFTHKRSLAKFLVLCVMYIEAIV-VVIRSKNHVRVTRALRPLF-LIDSFYLRGVRRTLRQVMLSLPPILDMLVLLLFFIFIFAMLGFYLFSSNQDDEYFTTFERSFISLFVLLTTANYPDVMMPSYAKSRWSVIFFIAYISVALYFLMNLLLAVVYDTFTSIEKDKFRKLFLHKRHAARRAYTLLCSK 296          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Nematostella
Match: EDO33014 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STF7])

HSP 1 Score: 56.6102 bits (135), Expect = 2.573e-8
Identity = 67/248 (27.02%), Postives = 118/248 (47.58%), Query Frame = 3
Query: 1302 FEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLI---TVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKL-------DVHFFNKTQACGT-------FQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETY 1994
            F +    A+  N    +F+ L+ IE + K++ +G+K +F      F+FL+     L L I+ S I++  + S          + D   +  +L L +  G +  F     II TL  +   + +   ++ +++Y+YA++G+ +FGG +       D    N T  CG        F Q  Y   NFDD   ++  L+ L +VN WH   + F + V +K   +Y +S+ +I VIV +N   AF++E +
Sbjct:  274 FANAIFIALDANDYEILFLVLFNIEILLKFYTIGFKDFFRGFWNWFDFLVIGAATLALVIEASFISLQSSQS----------VLDFLMVLRVLRLAKIIGQVRRFQV---IIGTLMQIGPAITTYGAIMFILYYIYAIVGIELFGGLILKEAPTNDNSTVNST-FCGNIKLKGSDFYQDRYCSNNFDDILKAMKLLFDLTVVNQWHVITQGFVL-VTNKWARLYFLSFHMICVIVVLNIFVAFILEAF 506          

HSP 2 Score: 51.6026 bits (122), Expect = 1.086e-6
Identity = 63/234 (26.92%), Postives = 114/234 (48.72%), Query Frame = 3
Query:  114 YRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLH-GLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDAT----KKNPWLLLLFTLMFVSWIDFFV-SVALKDVYYFRLRRFFRPIFALQKSQ--LMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSK--YQSFYSAFYTLLVLLTTANNPDAMIIIYNH 785
            Y    HR     L++Y  LY+K    F++++ V ++  LA  E P+              V  +++P      +E  F L +    +F V+ F         KKN  LL++  L F+  I + +   A  D +  R  R FRP++ +  S+   +++ ++++ +T+ +I +VL+LL L + +F  I V +F G + K    K  +  +   +++L VL TTANNPD  +  Y++
Sbjct:   22 YFQTTHR----ELELYK-LYNKPILQFIIYVFVWVNLSLALFEEPA--------------VKGLAIPYWGCLIIE-YFCLFVFCVRLFHVWSFAAGVKFWRDKKNAILLVVIVLTFLDMIMYVIFKEAEVDAHTIRWTRIFRPLYLINISEGRQIRRAVRNIRRTLPEIANVLILLLLMIALFAQICVKLFGGKNLKDVHGKPYFTDYLYVYFSLYVLTTTANNPDIGMPAYDY 235          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Nematostella
Match: EDO46991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU9])

HSP 1 Score: 52.7582 bits (125), Expect = 5.978e-7
Identity = 70/293 (23.89%), Postives = 132/293 (45.05%), Query Frame = 3
Query: 1011 AFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITV-LILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXX---XXXGMNIFGGKLDVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFM 1877
            +F+R  +N  ISK ++ +    A   G     W++ K  +     H+              + ++ +    +++F    +VF  LN L +A+E  N+ E  T     L+    +F+ L+ +E + K + +G+  YF+    RF+ L+ +  +L + ++E    R +    L   R              L+R   +   + SL+ ++ +L +    M+S++GLLLL+       +LLGM IFGGK ++               D    NFD F+ ++VT++ +L   +W+A M
Sbjct:  405 SFRRRKENDDISKNKENQEDSAASDQG-----WIDRKKKILKRFHHR--------------LRRSCRKAVKTQWFYWTVIVFVFLNSLTLALEHYNQPEFLT---QFLDKANKLFLALFTLEMVVKMYCLGFHGYFASLFNRFDCLVVISSLLELGLTEAMDQRPIGISMLRCVR--------------LLRIFKVTRYWSSLSNLVASLLN---SMRSIMGLLLLLSLFMVIFSLLGMQIFGGKFNLG------------DEDVPRSNFDSFWRALVTVFQILTGEDWNAVM 646          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Medaka
Match: tpcn2 (two pore segment channel 2 [Source:NCBI gene;Acc:101161121])

HSP 1 Score: 276.174 bits (705), Expect = 1.888e-81
Identity = 228/740 (30.81%), Postives = 389/740 (52.57%), Query Frame = 3
Query:   69 LFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSK----YQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVM-CENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAET--VDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQA--MSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDV-------------HFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDLQSPLRKCSFLCEHYPHF 2222
            L+ +QA  F+ DA  YRSINHRVD   L++Y   YS+     +   I  +  LAF+E PSSLS  S L   +   N    P  +T S+E V LL+  +D   + YL G +  KK  WL+    ++ +S ID+ +S+++      R+RR FRP F LQ S LMKK +K + +T+ +I SV+LLL L L +FT+I + +F    D+  + +    ++    +  +LLVLLTTANNPD MI  Y+  +   IFF  F  IG +  MN+L AI++++FRG++L S+QTS+ RRR+ ++A ++V+ C+  + + SA +  V + A  +V+    +  + +   I  A    A+   +D    + +   LD+ + ++    +P Y   +L+ LQ +F   Y  ++G      NV+ I   +    E TT +    +L I    FI  YL+E   K FA G + Y S +   F+    VL + + + ++TI+   +    V    ++W+L R+ N+L++ R   I+     +  + +TL D+   +++  G+L++++YV+A+LG+ +F G +               +  N +  CGT++QL Y   NFDDF A+I+ L+ ++IVNNW AFM+A+     S+   +Y + WW+ + ++++N   A ++E + +             R H  +    + ++Y           + Q++F+  + EPTEE+L   L +       +PH 
Sbjct:   29 LYLQQAVVFIEDAIHYRSINHRVDSGSLRMYRCYYSRLCQWVLAATITVVLLLAFVERPSSLSKTSDLRHRSEPWNP---PCGLTESIEMVCLLIFCLDLGMKSYLIGWEEFKKCKWLISYMVVLSISIIDWVLSISMLCHETLRVRRLFRPFFLLQNSSLMKKTLKCIKRTLPEIASVILLLALHLCLFTMIGMLLFAKTADQQENEEWLLHFRDLPRSITSLLVLLTTANNPDVMIPAYSQNRAYSIFFISFSVIGTYCLMNLLTAIIYNQFRGYLLMSLQTSIIRRRVGIRAAFQVLSCQ--RTQASAQV-LVRVHAVLKVMSRVKMKSYYRAA-INAAVQAHADVGFMDREQFQKVFDELDKDRITEHP-PLPQYSSVLLQKLQQLFSHYYLTVLGNAVALTNVMCICTVLVLNSEKTTVERNNSNLEIINLCFILYYLLEMCVKIFAFGGRGYLSYRNNIFD---GVLTVLLLVLQVTIFIKYTPPSPVESNSSLWELVRLVNMLIVFRFLRIIPDIKLMALVASTLMDLVKNLRAFAGILVVVYYVFAVLGIWLFEGAIKPPPGISGLSNTALQNVSNASMECGTYEQLGYWPNNFDDFAAAIILLYNVMIVNNWQAFMDAYS-RYTSEWSKVYFVCWWLTSSVMWVNLFVALILENFIY----------KWDRSHSCSITEVEKIQYET---------SIQLMFREQIQEPTEEELLCQLHR-------HPHL 730          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Medaka
Match: tpcn2 (two pore segment channel 2 [Source:NCBI gene;Acc:101161121])

HSP 1 Score: 250.366 bits (638), Expect = 1.365e-71
Identity = 207/628 (32.96%), Postives = 343/628 (54.62%), Query Frame = 3
Query:   69 LFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSK----YQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVM-CENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAET--VDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQA--MSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDV-------------HFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAF 1886
            L+ +QA  F+ DA  YRSINHRVD   L++Y   YS+     +   I  +  LAF+E PSSLS  S L   +   N    P  +T S+E V LL+  +D   + YL G +  KK  WL+    ++ +S ID+ +S+++      R+RR FRP F LQ S LMKK +K + +T+ +I SV+LLL L L +FT+I + +F    D+  + +    ++    +  +LLVLLTTANNPD MI  Y+  +   IFF  F  IG +  MN+L AI++++FRG++L S+QTS+ RRR+ ++A ++V+ C+  + + SA +  V + A  +V+    +  + +   I  A    A+   +D    + +   LD+ + ++    +P Y   +L+ LQ +F   Y  ++G      NV+ I   +    E TT +    +L I    FI  YL+E   K FA G + Y S +   F+    VL + + + ++TI+   +    V    ++W+L R+ N+L++ R   I+     +  + +TL D+   +++  G+L++++YV+A+LG+ +F G +               +  N +  CGT++QL Y   NFDDF A+I+ L+ ++IVNNW AFM+A+
Sbjct:   29 LYLQQAVVFIEDAIHYRSINHRVDSGSLRMYRCYYSRLCQWVLAATITVVLLLAFVERPSSLSKTSDLRHRSEPWN---PPCGLTESIEMVCLLIFCLDLGMKSYLIGWEEFKKCKWLISYMVVLSISIIDWVLSISMLCHETLRVRRLFRPFFLLQNSSLMKKTLKCIKRTLPEIASVILLLALHLCLFTMIGMLLFAKTADQQENEEWLLHFRDLPRSITSLLVLLTTANNPDVMIPAYSQNRAYSIFFISFSVIGTYCLMNLLTAIIYNQFRGYLLMSLQTSIIRRRVGIRAAFQVLSCQ--RTQASAQV-LVRVHAVLKVMSRVKMKSYYRAA-INAAVQAHADVGFMDREQFQKVFDELDKDRITEHP-PLPQYSSVLLQKLQQLFSHYYLTVLGNAVALTNVMCICTVLVLNSEKTTVERNNSNLEIINLCFILYYLLEMCVKIFAFGGRGYLSYRNNIFD---GVLTVLLLVLQVTIFIKYTPPSPVESNSSLWELVRLVNMLIVFRFLRIIPDIKLMALVASTLMDLVKNLRAFAGILVVVYYVFAVLGIWLFEGAIKPPPGISGLSNTALQNVSNASMECGTYEQLGYWPNNFDDFAAAIILLYNVMIVNNWQAFMDAY 645          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Medaka
Match: tpcn2 (two pore segment channel 2 [Source:NCBI gene;Acc:101161121])

HSP 1 Score: 115.161 bits (287), Expect = 9.319e-28
Identity = 92/343 (26.82%), Postives = 167/343 (48.69%), Query Frame = 3
Query: 1212 SIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLD-------VHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDLQSPLRKCSFLCEHYPH 2219
             +F   Y  ++G      NV+ I +        T   A S  I    FI  YL+E   K FA G + Y S +   F+ ++TVL+L        +W       L     ++W+L R+ N+L++ R   I+     +  + +TL D+   +++  G+L++++YV+A+LG+ +F G ++        +  N +  CGT++QL Y   NFDDF A+I+ L+ ++IVNNW AFM+A+     S+   +Y + WW+ + ++++N   A ++E + +             R H  +    + ++Y           + Q++F+  + EPTEE+L   L +       +PH
Sbjct:    1 QLFSHYYLTVLGNAVALTNVMCICV-------STAPAAASAAIINLCFILYYLLEMCVKIFAFGGRGYLSYRNNIFDGVLTVLLLVF-----ALWFPGCHGDLECGNSSLWELVRLVNMLIVFRFLRIIPDIKLMALVASTLMDLVKNLRAFAGILVVVYYVFAVLGIWLFEGAINGLSNTALQNVSNASMECGTYEQLGYWPNNFDDFAAAIILLYNVMIVNNWQAFMDAYS-RYTSEWSKVYFVCWWLTSSVMWVNLFVALILENFIY----------KWDRSHSCSITEVEKIQYET---------SIQLMFREQIQEPTEEELLCQLHR-------HPH 304          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Medaka
Match: tpcn1 (two pore segment channel 1 [Source:NCBI gene;Acc:101159752])

HSP 1 Score: 81.2629 bits (199), Expect = 2.336e-15
Identity = 124/584 (21.23%), Postives = 266/584 (45.55%), Query Frame = 3
Query:  468 VSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIKN--SSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGF--SIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFP---SLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKTQACGTFQQLD--YGGI-----------NFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPT 2159
            + V ++   + R+ R  RPIF L   +    V ++L +    + S + +L L LF   + S+  F  F   + D  + +  ++  +L VLLTTAN PD M+  Y+    + +FF ++++I ++  MN+L+A+VFD F        ++ L  +R A+   ++++      +    +S  + D   R  +   S+  ++   + + T+ S      D+     ++    + + S + +   +P+    + K +  +  SK F+    V  ++N + I +E +       + +  +  +  +F+ +Y +E + K   +G   YFS     F+F +T+      I+            L F R   +        +V++R   +L LF        +++T+F++  RM S+   L++ +Y +A++GM  F G +  +  N +    +++Q++  +G             NF++   S VTL+ L +VNNW+  ME    ++ S    +Y ++++++T++V M  I AF+++ +    ++  K +  +  P      +       ++    + A T   L++   + P+
Sbjct:  183 IVVLIRQTSHMRITRALRPIF-LVDCRYCGAVRRNLRQIFQSLPSFIDILLLLLFFMVIFSILGFCLFSTNTADPYFNTLENSLVSLFVLLTTANFPDVMMPAYSKNSWSCVFFIVYLSIELYFIMNLLLAVVFDTFNDVEKMKFKSLLLHKRSAIDHAFQLLV---SRQRPMGVSLKQFDGLMRYYRPRMSARDRFLTYKALNTSGSRMLSLQDFYKFYEVIGLKWKARRSGEHWFDDLPHTAFLIFKGINLLVKSKAFQYAMYVVVAINGVWILVE-TYTLNSGYSWSKFVPWSYIVFLTIYGVEVLLKIAGLGPINYFSSGWNLFDFSVTLFAFLGLIA------------LAFNREPFY-------FIVVLRPLQLLRLFKIKQRYRNVLDTMFELFPRMASLGLTLIIFYYSFAIVGMEFFAGVVYPNCCNTSTVADSYRQINVTHGNTTVLEEGYYYLNNFNNILRSFVTLFELTVVNNWYITMEGV-TSMTSHWSRLYFMTFYIVTMVV-MTIIVAFILDAFVFRMNYSRKNREPVENPEDENGIV------FEVEVSRDEAMTTLELYRQTCLTPS 734          
BLAST of Two pore calcium channel protein 2 vs. Ensembl Medaka
Match: ENSORLT00000016743.2 (pep primary_assembly:ASM223467v1:15:29420882:29424861:-1 gene:ENSORLG00000013354.2 transcript:ENSORLT00000016743.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 7.605e-11
Identity = 140/632 (22.15%), Postives = 277/632 (43.83%), Query Frame = 3
Query:   84 ASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALK--DVYYFRLRRFFRPIFALQ--KSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSK--YQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIKNSSISK-----WRKCEMIKTA--DSLG-AETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFC-----SLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKT-----QACG-------TFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAF 1886
            A+ +++DA+  R+I        +++Y   +     + + F IV    LA  E P+ L +                P+  T  +E   LL   +       +   D   K+P  L +   + ++  D  +  ALK  D Y  R  R  RP+  +   + + +++  +S+   +  IF V LL    + +F+L+++ +    D K+ D K  + ++    + L VL+TTAN+PD M+  YN      IFF +++ I  ++FM+V +A+V++ ++ ++ + ++  +  +R  M   + V+ E  +      +++   +    +++ +  S      W  C+       D +   +  D LN+++I      H         PN+     ++  S F+ K  +  G V        +N + I ++  N           ++ + W+F+ LYL+E + K +    + +FS+    + +  T+++++  I+        S  +              T+LL L+R    +  F +   IINTL  +   + +   L+++++Y++A+LGM IF  K  V F++ +     Q CG        F  L+Y   NF++  +S V L  L +VN WH     F
Sbjct:   38 AAIYVSDAQYNRNIYFDTSPQAVRLYLLYHHWILKMLLYFFIVLNLSLAIFEEPAVLPL----------------PTWATMLVELFCLLAFTLRMGHYAKVIPRDKFWKDPKNLCVIATLVLTLTDMVIYGALKAADCYGVRWSRVLRPLLLINVTEGRQLRRAFRSIRNALPQIFYVFLLFMFSILLFSLMALKLLGKRDLKTIDGKPYFTNYMDIVFDLYVLVTTANSPDVMMPAYNANVGFAIFFILYILINTYIFMSVFLAVVYNNYKKYLKEEVRQLVRAKRHKMVRAFAVLQEQREEGGQPVVTRNNWNQLIPLVQPNLCSARRQLIWSVCDDKNQGFLDKVAFIQLADLLNIEVIALKPRSHPFLNL---FPNF----YQSAPSRFVCKVVQHRGFVIAFDLIVLVNTVFIGLDEKNPL---------ISNSEWVFLTLYLLEILLKLYVFEPRAFFSRHNF-WNWFDTIIVVSALIATSVNSALGSSGEY-------------TSLLRLVRVVDNIQRFRT---IINTLIRIGPAIFTFGQLIVVVYYIFAMLGMEIFKNK--VKFYDDSSDPDKQYCGNPLLKGTAFANLNYCKNNFNNVVSSFVLLVELTVVNQWHVLSSGF 618          
BLAST of Two pore calcium channel protein 2 vs. Planmine SMEST
Match: SMESG000058852.1 (SMESG000058852.1)

HSP 1 Score: 1384.78 bits (3583), Expect = 0.000e+0
Identity = 721/725 (99.45%), Postives = 722/725 (99.59%), Query Frame = 3
Query:   60 MTNLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDLQSPLRKCSFLCEHYPHFGRSY 2234
            MTNLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWN+FMVFIIVSLHGLAF EFPSSLSVNSYL INNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVLLLLFLWLFMFTLISVSIFNGFDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAFIFFFIFMAIGIFVFMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGLLLLMFYVYALLGMNIFGGKLDVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPHGSTD INDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDLQSPLRKCSFLCEHYPHFGRSY
Sbjct:    1 MTNLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNIFMVFIIVSLHGLAFFEFPSSLSVNSYLSINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVLLLLFLWLFMFTLISVSIFNGFDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAFIFFFIFMAIGIFVFMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGLLLLMFYVYALLGMNIFGGKLDVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPHGSTDVINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDLQSPLRKCSFLCEHYPHFGRSY 725          
BLAST of Two pore calcium channel protein 2 vs. Planmine SMEST
Match: SMESG000058838.1 (SMESG000058838.1)

HSP 1 Score: 790.03 bits (2039), Expect = 0.000e+0
Identity = 433/727 (59.56%), Postives = 549/727 (75.52%), Query Frame = 3
Query:   57 IMTNLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFIIVSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVILIDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLRRFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFDD-KSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKSHYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPTEEDLQSPLRKCSFLCEHYPHFGRSY 2234
            I   L E+QASCFL DAEEYRSI+H++DE  LK+Y  L+S  W + +VF IVSLH LAFLEFPSSLSV +   +N T V    VP ++T SLE +F++ IL D++FQVYLFG  A+ KNPWL+ LF LMFV WID FVS+ L+ VY+FRLRRFFRP FA+QKSQLMKKV+KSLSKT+ DIFS  +LL LWL  F+LI+VSIFNGF+D +++D KY+SFY AF+TLLVLLTTANNPDAMI +YN  +LAF FF  FMA+GIFVFMNVLIAI+FD+FRGHVL+SMQ SL RRR+A +A++EV+             +V+I+  K VI ++SI  WRK EMIK  + +G E VDW + K IL  LDEHKESK  F +P Y+ + +  LQ   LSK+FEIIGL  C  NV+ IA+++S KF D    ++ L++  W FI +Y+ EQI KYFAMG + YFS++GCRF+F IT  IL +KI E  + +TMSRK  +F +I+ WDLPRITNLL+L RAA I+L FPSLTPIINTLFD+PFRMKSVIG++LL+FY YALLGMNIF GK++  F      CG++QQL Y GINF+DFY+SIV LWCLLIVNNW  FM AFE AV+SK+VHIYMISWW+++VI+ +NC+TAFVIE Y+  K++Y +E+   +RP   +  I D ++Y++     NN+ TFQMLFKNDL+EPTEEDL + L++C FLCE+YPH   S+
Sbjct:   19 ITPTLVEQQASCFLEDAEEYRSIHHKIDENSLKIYKLLHSNYWTIALVFSIVSLHFLAFLEFPSSLSVKTNFTVNETIVLGTPVPFALTISLEIIFIIFILSDAIFQVYLFGYKASLKNPWLICLFVLMFVYWIDLFVSMGLQQVYFFRLRRFFRPFFAMQKSQLMKKVLKSLSKTIADIFSAFILLALWLVAFSLIAVSIFNGFEDMQAYDEKYKSFYDAFFTLLVLLTTANNPDAMIKVYNDNRLAFFFFVFFMAVGIFVFMNVLIAIIFDQFRGHVLESMQASLFRRRVATRAMFEVLRNYLAKLDGIYQDEVDIETLKSVINSASICSWRKTEMIKLINLIGFEVVDWNHFKHILGPLDEHKESKMKFPVPKYQDRRVLKLQRFLLSKWFEIIGLGICFSNVIVIAVDVSYKFPDEEVASIILDVFNWFFIFIYIFEQIGKYFAMGCRTYFSRQGCRFDFFITTSILAMKILETVLMKTMSRKDYIFGQISAWDLPRITNLLILARAARIVLFFPSLTPIINTLFDIPFRMKSVIGIMLLLFYFYALLGMNIFYGKINYEFIKNATECGSYQQLGYYGINFNDFYSSIVVLWCLLIVNNWSVFMVAFEQAVNSKMVHIYMISWWIVSVIIVLNCVTAFVIEAYSQRKAYYEEERRKRSRPQSVSMLIEDSLQYLRSSVIVNNSLTFQMLFKNDLVEPTEEDLMTSLKECDFLCEYYPHIAHSH 745          
BLAST of Two pore calcium channel protein 2 vs. Planmine SMEST
Match: SMESG000024145.1 (SMESG000024145.1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.161e-9
Identity = 118/565 (20.88%), Postives = 245/565 (43.36%), Query Frame = 3
Query:  408 KNPWLLLLFTLMFVSWIDFFVSVALKDVY----YFRLRRFFRPIFA--LQKSQLMKKVIKSLSKTVTDIFSVXXXXXXXXXXXXXISVSIFNGFD--DKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAXXXXXXXXXXXXXXXMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMCENYKNETSANISKVEIDAFKRVIK--NSSISKWRKCEMIKTADSLGAETVDWLNVKLILQSLD---EHKESKKGF---SIPN----YKVKMLKTLQSIFLSKYFEIIGLVFCSLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYKLYFSKKGCRFEFLITVL-ILTIKISEITIWRTMSRKQLVFWRITIWDLPRITNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGXXXXXXXXXXXXGMNIFGGKLDVHFFN--------KTQACG-------TFQQLDYGGINFDDFYASIVTLWCLLIVNNWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETY 1994
            KN + +   T++ +  ID  + + +K +      F+  RF RP+      ++  ++  + +L  T+ DI  +  L    L  F+L+++      D    +    ++++    + L VL+TT+N+PD +I  Y       I + +   +  ++FM + IA V++ ++ H+   +  ++ +++  +K  + ++        S++  +VE+ +F  V+K  + S S+ +   + K  D   + ++       + + +    E  E   GF    IP     Y     + ++ I  SKY  +       LN + + I     F DT  +        W+F  ++  E + + FA G  LYF +    F+F++ +L ++++ I +I  +  M         +    + R+  +L +IR+  I         II ++F +   + +   + L ++Y+Y  +GM +FG +    + N         T  CG        F +  Y  + F+        +  L + NNWH  +    +    K   ++ +S  +I VI+ MN + AF+I+ Y
Sbjct:  123 KNNYNIATITIIVLMVIDLLIFIMMKSLIPKSSRFQWSRFLRPVLCATFPENHKIRSALNNLKGTLHDILIIFGLFSFMLGFFSLVALQFLASADLYYPNGIPYFRNYLDVIFDLYVLVTTSNSPDVIIPAYEKSTSYSILYLLVTIVCNWIFMGITIASVYNAYKVHLGRGVINNVKQKKHRLKEAFYLL-------KSSDTGEVEMSSFCAVMKKVDPSYSESKNILLFKLLDINKSNSLTVGQFTKLTEYMHLNFEEIEMNYGFFNKKIPKLYWCYMSSFNQKIKPIIRSKYTRLFFEGVVLLNAILMII-----FNDTEWELT----FEWVFTLIFSGELLIRMFASGVNLYFDEMWNVFDFVVILLALISLFIQQIISYFNMHISNHYLRFLLALRVLRLLKILTVIRSFRI---------IIQSIFILLPSLLAYTAVQLCIYYIYVCVGMEVFGNRYFPPYGNIYEMKNSTDTVDCGDPRLKNSDFTKSHYCILGFNSASDGFFLMTILTVSNNWHILLLG-PVLTTHKAAKLFFVSIHLICVILVMNIVLAFIIDAY 661          
The following BLAST results are available for this feature:
BLAST of Two pore calcium channel protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPCN21.785e-7030.71two pore segment channel 2 [Source:HGNC Symbol;Acc... [more]
TPCN21.138e-6232.48two pore segment channel 2 [Source:HGNC Symbol;Acc... [more]
TPCN28.002e-4232.91two pore segment channel 2 [Source:HGNC Symbol;Acc... [more]
TPCN29.360e-4232.39two pore segment channel 2 [Source:HGNC Symbol;Acc... [more]
TPCN29.360e-4232.39two pore segment channel 2 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Two pore calcium channel protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Two pore calcium channel protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Two pore calcium channel protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpcn27.173e-7729.61two pore segment channel 2 [Source:NCBI gene;Acc:7... [more]
tpcn16.343e-1721.74two pore segment channel 1 [Source:ZFIN;Acc:ZDB-GE... [more]
tpcn32.108e-1322.50two pore segment channel 3 [Source:ZFIN;Acc:ZDB-GE... [more]
tpcn17.572e-1321.51two pore segment channel 1 [Source:ZFIN;Acc:ZDB-GE... [more]
tpcn13.495e-1121.08two pore segment channel 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Two pore calcium channel protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hook13.694e-8331.09hook microtubule-tethering protein 1 [Source:Xenba... [more]
hook12.742e-8030.12hook microtubule-tethering protein 1 [Source:Xenba... [more]
hook12.413e-7731.19hook microtubule-tethering protein 1 [Source:Xenba... [more]
hook14.141e-7429.51hook microtubule-tethering protein 1 [Source:Xenba... [more]
hook11.242e-6430.25hook microtubule-tethering protein 1 [Source:Xenba... [more]
back to top
BLAST of Two pore calcium channel protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tpcn25.789e-8031.26two pore segment channel 2 [Source:MGI Symbol;Acc:... [more]
Tpcn27.896e-5432.43two pore segment channel 2 [Source:MGI Symbol;Acc:... [more]
Tpcn22.049e-5232.23two pore segment channel 2 [Source:MGI Symbol;Acc:... [more]
Tpcn28.684e-4533.33two pore segment channel 2 [Source:MGI Symbol;Acc:... [more]
Tpcn21.289e-4433.33two pore segment channel 2 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Two pore calcium channel protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0JMD4|TPC2_DANRE8.400e-8130.01Two pore calcium channel protein 2 OS=Danio rerio ... [more]
sp|Q8BWC0|TPC2_MOUSE4.049e-7931.26Two pore calcium channel protein 2 OS=Mus musculus... [more]
sp|Q8NHX9|TPC2_HUMAN8.570e-7030.71Two pore calcium channel protein 2 OS=Homo sapiens... [more]
sp|Q94KI8|TPC1_ARATH8.933e-2123.60Two pore calcium channel protein 1 OS=Arabidopsis ... [more]
sp|Q75VR0|TPC1B_TOBAC1.590e-2023.43Two pore calcium channel protein 1B OS=Nicotiana t... [more]
back to top
BLAST of Two pore calcium channel protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RU991.211e-10633.94Two pore calcium channel protein 2 OS=Fasciola hep... [more]
C7TXY91.809e-9634.11Two-pore calcium channel protein 2 (Voltage-depend... [more]
A0A3Q0KRQ51.775e-9534.08Two-pore calcium channel, putative OS=Schistosoma ... [more]
C3ZNK22.319e-9432.84Uncharacterized protein (Fragment) OS=Branchiostom... [more]
A0A2T7P5T01.972e-9034.52Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Two pore calcium channel protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpcn24.797e-8128.72two pore segment channel 2 [Source:NCBI gene;Acc:1... [more]
tpcn25.856e-8129.09two pore segment channel 2 [Source:NCBI gene;Acc:1... [more]
tpcn27.997e-8129.18two pore segment channel 2 [Source:NCBI gene;Acc:1... [more]
tpcn25.966e-7829.25two pore segment channel 2 [Source:NCBI gene;Acc:1... [more]
tpcn11.108e-1621.24two pore segment channel 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Two pore calcium channel protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tpcn33.484e-2122.61two pore segment channel 3 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Two pore calcium channel protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Two pore calcium channel protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO347125.378e-5827.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475177.640e-1024.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330142.573e-827.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469915.978e-723.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Two pore calcium channel protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpcn21.888e-8130.81two pore segment channel 2 [Source:NCBI gene;Acc:1... [more]
tpcn21.365e-7132.96two pore segment channel 2 [Source:NCBI gene;Acc:1... [more]
tpcn29.319e-2826.82two pore segment channel 2 [Source:NCBI gene;Acc:1... [more]
tpcn12.336e-1521.23two pore segment channel 1 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000016743.27.605e-1122.15pep primary_assembly:ASM223467v1:15:29420882:29424... [more]
back to top
BLAST of Two pore calcium channel protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000058852.10.000e+099.45SMESG000058852.1[more]
SMESG000058838.10.000e+059.56SMESG000058838.1[more]
SMESG000024145.11.161e-920.88SMESG000024145.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006904 ID=SMED30006904|Name=Two pore calcium channel protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2304bp
CTTGTATAAATGGCTTAACAGTTTCCGTTACGACATTTTGCAATCCGTTG
ATATAGATAATGACAAATTTATTCGAGAGGCAAGCTTCATGCTTCCTAAA
CGATGCTGAGGAATATCGTTCGATCAACCACCGCGTTGACGAGACCGGGC
TGAAAGTATACAACTTTCTTTATTCAAAATGCTGGAATGTTTTTATGGTT
TTTATTATTGTCAGTCTTCATGGTCTGGCGTTCCTTGAATTCCCTTCCTC
GCTCAGCGTTAACTCTTATTTGGGTATAAATAACACGTTTGTTAATCGTA
TTTCAGTTCCGTCATCGGTTACGTTTTCTCTCGAAGCAGTTTTTCTCCTT
GTTATTCTAATCGATTCGGTTTTTCAAGTCTATCTTTTTGGATTGGATGC
CACAAAGAAAAACCCTTGGTTATTGTTATTATTTACCCTAATGTTCGTTT
CGTGGATTGATTTCTTTGTCAGTGTTGCTTTAAAGGATGTTTACTATTTT
CGATTGCGTAGATTTTTCAGACCAATTTTTGCACTTCAAAAATCTCAACT
AATGAAAAAAGTGATAAAATCACTCAGCAAAACTGTGACTGATATTTTCA
GTGTTTTGCTTTTGCTTTTCTTGTGGTTATTCATGTTTACTTTGATTTCA
GTATCAATTTTCAATGGGTTTGATGACAAGTCTTTTGATTCAAAATATCA
ATCATTTTATAGCGCGTTTTACACCTTGCTTGTCCTATTGACGACAGCCA
ACAATCCCGACGCTATGATCATCATTTATAACCACTACAAGCTGGCATTC
ATATTTTTCTTCATTTTTATGGCAATTGGAATATTTGTTTTTATGAATGT
ATTAATTGCTATCGTGTTTGATGAGTTCCGGGGACATGTGCTGGATTCAA
TGCAAACCTCACTCTCAAGAAGGAGGCTTGCTATGAAAGCGATTTATGAG
GTGATGTGTGAAAACTATAAAAACGAAACGTCGGCGAACATTAGTAAGGT
GGAGATTGATGCCTTTAAACGGGTCATAAAGAATTCCTCTATATCAAAAT
GGAGAAAATGTGAAATGATAAAGACAGCTGATTCTTTGGGTGCAGAAACG
GTAGACTGGCTAAATGTAAAACTGATCCTTCAATCTTTGGATGAACACAA
AGAGTCAAAAAAAGGATTTTCAATTCCAAATTACAAAGTAAAAATGTTGA
AAACACTACAGTCAATTTTTTTATCTAAATATTTTGAAATAATTGGTCTT
GTGTTCTGCTCGCTGAATGTGTTAGCCATTGCTATTGAGATTTCGAATAA
ATTTGAAGATACAACAACCCAGGCAATGAGTCTAAATATAACAACTTGGA
TTTTCATTTGTTTGTATTTAATCGAACAAATTTGCAAATATTTTGCCATG
GGGTACAAGTTATATTTCAGTAAGAAAGGATGCCGATTCGAATTCTTGAT
CACGGTGTTAATTTTGACGATAAAAATCAGCGAAATTACTATCTGGAGAA
CGATGAGTCGTAAGCAACTCGTTTTCTGGAGAATTACGATATGGGACCTT
CCCAGAATAACTAATTTGTTAGTCCTGATTCGTGCAGCGGGAATATTATT
GCTGTTTCCATCTTTGACACCAATAATTAACACATTGTTCGACGTACCCT
TCAGGATGAAATCAGTTATTGGCTTGTTACTGCTCATGTTTTATGTTTAC
GCTTTATTGGGAATGAATATATTTGGCGGGAAACTCGATGTTCACTTTTT
TAATAAGACGCAGGCATGTGGCACATTTCAGCAACTTGATTATGGGGGTA
TCAACTTCGATGATTTTTACGCGTCAATTGTGACTCTCTGGTGTCTTTTA
ATCGTAAATAACTGGCACGCATTTATGGAGGCCTTTGAGATGGCTGTTGA
TAGCAAACTGGTGCACATTTATATGATTTCTTGGTGGGTCATCACAGTAA
TCGTATTTATGAATTGTATAACGGCTTTTGTAATTGAGACGTATACTCAT
GTAAAGTCTCACTATAATAAAGAAAAAGTTAATTTAACCAGACCGCATGG
CTCCACCGATGCCATAAATGATGGAGTCAGATATATGAAAATCGGGACCT
TTAGCAACAATGCGTTCACGTTTCAAATGTTATTCAAGAATGATCTTATT
GAACCAACTGAAGAAGATTTACAATCACCATTAAGGAAATGCTCCTTTCT
TTGCGAACATTATCCACACTTTGGACGTTCATATTAAAATCCCTCTTTAA
ATAACTTTTTTCTAAAATTAATTATTTTCACAATCGAATTTCCAGCAGAT
CGGA
back to top

protein sequence of SMED30006904-orf-1

>SMED30006904-orf-1 ID=SMED30006904-orf-1|Name=SMED30006904-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=726bp
MTNLFERQASCFLNDAEEYRSINHRVDETGLKVYNFLYSKCWNVFMVFII
VSLHGLAFLEFPSSLSVNSYLGINNTFVNRISVPSSVTFSLEAVFLLVIL
IDSVFQVYLFGLDATKKNPWLLLLFTLMFVSWIDFFVSVALKDVYYFRLR
RFFRPIFALQKSQLMKKVIKSLSKTVTDIFSVLLLLFLWLFMFTLISVSI
FNGFDDKSFDSKYQSFYSAFYTLLVLLTTANNPDAMIIIYNHYKLAFIFF
FIFMAIGIFVFMNVLIAIVFDEFRGHVLDSMQTSLSRRRLAMKAIYEVMC
ENYKNETSANISKVEIDAFKRVIKNSSISKWRKCEMIKTADSLGAETVDW
LNVKLILQSLDEHKESKKGFSIPNYKVKMLKTLQSIFLSKYFEIIGLVFC
SLNVLAIAIEISNKFEDTTTQAMSLNITTWIFICLYLIEQICKYFAMGYK
LYFSKKGCRFEFLITVLILTIKISEITIWRTMSRKQLVFWRITIWDLPRI
TNLLVLIRAAGILLLFPSLTPIINTLFDVPFRMKSVIGLLLLMFYVYALL
GMNIFGGKLDVHFFNKTQACGTFQQLDYGGINFDDFYASIVTLWCLLIVN
NWHAFMEAFEMAVDSKLVHIYMISWWVITVIVFMNCITAFVIETYTHVKS
HYNKEKVNLTRPHGSTDAINDGVRYMKIGTFSNNAFTFQMLFKNDLIEPT
EEDLQSPLRKCSFLCEHYPHFGRSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0003116parenchymal cell
Vocabulary: biological process
TermDefinition
GO:0034220ion transmembrane transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0006810transport
GO:0006816calcium ion transport
GO:0006939smooth muscle contraction
GO:0034765regulation of ion transmembrane transport
GO:0051209release of sequestered calcium ion into cytosol
GO:0070588calcium ion transmembrane transport
GO:0086010membrane depolarization during action potential
Vocabulary: INTERPRO
TermDefinition
IPR005821Ion_trans_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005764lysosome
GO:0005765lysosomal membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005245voltage-gated calcium channel activity
GO:0005262calcium channel activity
GO:0072345NAADP-sensitive calcium-release channel activity