RRM domain-containing protein

Overview
NameRRM domain-containing protein
Smed IDSMED30006888
Length (bp)509
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RRM domain-containing protein (SMED30006888) t-SNE clustered cells

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30006888) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RRM domain-containing protein (SMED30006888) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30006888) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006888

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30006888SMESG000048749.1 SMESG000048745.1 dd_Smed_v4_970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006888SMESG000048749.1 SMESG000048745.1 dd_Smed_v4_970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006888SMESG000048749.1 SMESG000048745.1 dd_Smed_v4_970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: NIFK (nucleolar protein interacting with the FHA domain of MKI67 [Source:HGNC Symbol;Acc:HGNC:17838])

HSP 1 Score: 50.447 bits (119), Expect = 2.739e-7
Identity = 28/77 (36.36%), Postives = 43/77 (55.84%), Query Frame = 1
Query:   58 VLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKE-VCEPFMETLNNRFMFNKVLKCSII 285
            V+ + HLP    E+++ +Y  QFG T  R  + RSK T  SKG+AF+    E V +   ET+NN     ++L+C  +
Sbjct:   46 VVYVRHLPNLLDETQIFSYFSQFG-TVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFM 121          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: CG6937 (gene:FBgn0038989 transcript:FBtr0084266)

HSP 1 Score: 55.8398 bits (133), Expect = 1.808e-9
Identity = 34/85 (40.00%), Postives = 48/85 (56.47%), Query Frame = 1
Query:   58 VLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLP-KEVCEPFMETLNNRFMFNKVLKCSIITNPSKGTF 309
            V+ + HLP  F E +L  Y +QFG   +RV + RS  T  SKG+AF+     EV +   +T++N  MF KV+K + I  P K T 
Sbjct:   52 VVIVKHLPHGFFEQQLRQYFRQFGRV-LRVRLARSLRTGNSKGYAFVEFEYPEVAKVAADTMDNYLMFQKVVKATYIP-PEKQTL 134          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:NCBI gene;Acc:317644])

HSP 1 Score: 61.6178 bits (148), Expect = 1.897e-11
Identity = 46/145 (31.72%), Postives = 70/145 (48.28%), Query Frame = 1
Query:   49 SNKVLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLP-KEVCEPFMETLNNRFMFNKVLKCSIITNPSKGTFRKKNLKPFSGFLNEKVKQNVHLEMRKTNDNLKKASKS--RKTYNFNKKLKALEGFDF 474
            S  VL + HLP    E +L +Y +QFG   +R+ + RSK+T  SKG+ F+     EV +   ET+NN  M  +++KC +I  P +    K  +   +GF   K           T D++KK       K     K+L A +G D+
Sbjct:   43 SPGVLYVGHLPRGLFEPQLKSYFEQFG-KVLRLRVSRSKKTGGSKGYGFVEFECDEVAKIVAETMNNYLMGERIIKCHVI--PPEKVHEKLFVGSIAGFKKPKYPAVTRYNKTHTEDDVKKVGTKLLSKESKLRKRL-AAKGIDY 183          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:NCBI gene;Acc:448106])

HSP 1 Score: 51.9878 bits (123), Expect = 3.735e-8
Identity = 29/80 (36.25%), Postives = 44/80 (55.00%), Query Frame = 1
Query:   49 SNKVLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLP-KEVCEPFMETLNNRFMFNKVLKCSII 285
            S  V+ I H+P    E +L  Y  QFG T  R+ + RSK+T  SKG+A++     EV +   +T+NN     ++LKC  +
Sbjct:   39 SPGVIYIGHIPRALYEPQLREYFSQFG-TVTRLRLSRSKKTGNSKGYAYVEFECDEVAKIVADTMNNYLFCERLLKCEFV 117          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:MGI Symbol;Acc:MGI:1915199])

HSP 1 Score: 53.5286 bits (127), Expect = 1.369e-9
Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = 1
Query:   58 VLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKE-VCEPFMETLNNRFMFNKVLKCSII 285
            V+ + HLP   +ES + NY  QFG  S R  + RSK T  SKG+AF+    E V +   ET++N     ++L C  +
Sbjct:   21 VVYLGHLPSTLSESHIYNYCAQFGDIS-RFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMDNYLFGERLLSCKFM 96          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:MGI Symbol;Acc:MGI:1915199])

HSP 1 Score: 51.9878 bits (123), Expect = 4.902e-8
Identity = 29/74 (39.19%), Postives = 41/74 (55.41%), Query Frame = 1
Query:   58 VLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKE-VCEPFMETLNNRFMFNKVLKC 276
            V+ + HLP   +ES + NY  QFG  S R  + RSK T  SKG+AF+    E V +   ET++N     ++L C
Sbjct:   48 VVYLGHLPSTLSESHIYNYCAQFGDIS-RFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMDNYLFGERLLSC 120          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8JIY8|MK67I_DANRE (MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Danio rerio OX=7955 GN=nifk PE=2 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 1.432e-10
Identity = 46/145 (31.72%), Postives = 70/145 (48.28%), Query Frame = 1
Query:   49 SNKVLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLP-KEVCEPFMETLNNRFMFNKVLKCSIITNPSKGTFRKKNLKPFSGFLNEKVKQNVHLEMRKTNDNLKKASKS--RKTYNFNKKLKALEGFDF 474
            S  VL + HLP    E +L +Y +QFG   +R+ + RSK+T  SKG+ F+     EV +   ET+NN  M  +++KC +I  P +    K  +   +GF   K           T D++KK       K     K+L A +G D+
Sbjct:   43 SPGVLYVGHLPRGLFEPQLKSYFEQFG-KVLRLRVSRSKKTGGSKGYGFVEFECDEVAKIVAETMNNYLMGERIIKCHVI--PPEKVHEKLFVGSIAGFKKPKYPAVTRYNKTHTEDDVKKVGTKLLSKESKLRKRL-AAKGIDY 183          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7SYS2|MK67I_XENLA (MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus laevis OX=8355 GN=nifk PE=2 SV=2)

HSP 1 Score: 53.5286 bits (127), Expect = 9.329e-8
Identity = 29/78 (37.18%), Postives = 45/78 (57.69%), Query Frame = 1
Query:   58 VLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLP-KEVCEPFMETLNNRFMFNKVLKCSIIT 288
            V+ I H+P+   E +L  Y  QFG T  R+ + RSK+T  SKG+A++     EV +   +T+NN     ++LKC  +T
Sbjct:   42 VIYIGHIPKSLIEPQLQEYFNQFG-TVTRLRLSRSKKTGNSKGYAYVEYECDEVAKIVADTMNNYLFCERLLKCEFVT 118          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91VE6|MK67I_MOUSE (MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Mus musculus OX=10090 GN=Nifk PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 3.429e-7
Identity = 29/74 (39.19%), Postives = 41/74 (55.41%), Query Frame = 1
Query:   58 VLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKE-VCEPFMETLNNRFMFNKVLKC 276
            V+ + HLP   +ES + NY  QFG  S R  + RSK T  SKG+AF+    E V +   ET++N     ++L C
Sbjct:   48 VVYLGHLPSTLSESHIYNYCAQFGDIS-RFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMDNYLFGERLLSC 120          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6GL69|MK67I_XENTR (MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus tropicalis OX=8364 GN=nifk PE=2 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 4.492e-7
Identity = 29/80 (36.25%), Postives = 44/80 (55.00%), Query Frame = 1
Query:   49 SNKVLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLP-KEVCEPFMETLNNRFMFNKVLKCSII 285
            S  V+ I H+P    E +L  Y  QFG T  R+ + RSK+T  SKG+A++     EV +   +T+NN     ++LKC  +
Sbjct:   39 SPGVIYIGHIPRALYEPQLREYFSQFG-TVTRLRLSRSKKTGNSKGYAYVEFECDEVAKIVADTMNNYLFCERLLKCEFV 117          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3SZM1|MK67I_BOVIN (MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Bos taurus OX=9913 GN=NIFK PE=2 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 7.669e-7
Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = 1
Query:   58 VLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKE-VCEPFMETLNNRFMFNKVLKCSII 285
            V+ + HLP    E+++  Y  QFG T  R  + RSK+T  SKG+ F+    E V +   ET+NN     ++LKC  I
Sbjct:   46 VIYVGHLPPTLYETQIRAYFSQFG-TVTRFRLSRSKKTGNSKGYGFVEFESEDVAKIAAETMNNYLFGERLLKCHFI 121          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A504YVK0 (RRM domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_08555 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 3.467e-16
Identity = 51/159 (32.08%), Postives = 85/159 (53.46%), Query Frame = 1
Query:   58 VLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKEVCEPFMETLNNRFMFNKVLKCSIITNPSKGTFRKKNLKPFSGFLNEKVKQNVHL--------------EMRKTNDNLKKASKSRKTYNFNKKLKALEG----FDFKS 480
            VL +S LP+ FTE ++  Y KQFG     +++P+S++T+K KG+AFI +PK   +    TLN    FNK++KC I+++  + TFR++     +  ++ K ++N  L              E   TN  L+     R+T +  K++ AL+     F FK+
Sbjct:    9 VLHVSRLPKYFTEGEIARYLKQFGDIGS-IHMPKSRKTMKCKGYAFIEVPKVTADIISSTLNGVLNFNKIMKCVILSDAKRSTFRRRLPVKSTRIVSAKRQKNAALRRIKRAIPSQSAESERPATNGALR-----RRTRSIAKRISALQKSHPEFQFKA 161          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A4E0S0R2 (RRM domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_003466 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.887e-15
Identity = 36/87 (41.38%), Postives = 58/87 (66.67%), Query Frame = 1
Query:   58 VLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKEVCEPFMETLNNRFMFNKVLKCSIITNPSKGTFRKK 318
            VL +S LP+ FTE ++  Y KQFG     +++P+S++T+K KG+AFI +PK   +    TLN    FNK++KC I+++  + TFR++
Sbjct:    9 VLHLSRLPKYFTEGEIARYLKQFGDIGS-IHMPKSRKTMKCKGYAFIEVPKVTADIISSTLNGVLNFNKIMKCVILSDAKRSTFRRR 94          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A5K3F2J2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.579e-14
Identity = 50/149 (33.56%), Postives = 82/149 (55.03%), Query Frame = 1
Query:   58 VLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKEVCEPFMETLNNRFMFNKVLKCSIITNPSKGTFRKKNLKPFSGFLNEKVKQNVHLEMRKTNDNLKKASKS--RKTYNFNKKLKALE----GFDFKSSL 486
             LK+SHLP+ F ES+L  Y +QFG     +++PRS++TLK K  AFI + KE      +T++N   FN+++KC +I +     F   N  P +    E  K       R+ N  +K +S++  R+T N   ++ AL+    GF F++++
Sbjct:   30 ALKVSHLPKHFEESQLKKYFQQFGLVHS-IFLPRSRKTLKPKDLAFILVEKEAAPIIAKTVHNVLNFNRIMKCEVIEDYDARMF---NQTPRTVSTTELEKN------RRANSAIKASSRASRRRTKNVQGRIAALKRLTPGFRFQTTI 168          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A4V6RH82 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000994 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 5.487e-14
Identity = 39/106 (36.79%), Postives = 65/106 (61.32%), Query Frame = 1
Query:   58 VLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKEVCEPFMETLNNRFMFNKVLKCSIITNPSKGTFRKKNLKPFSGFLNEKVKQNVHL 375
            VL++S LP+ F E +++ Y +QFG     VY+P+SK+TL  +G AF+ + KE+    + TL++   FNK++KC ++++P    FR+K L   S  +  K + N  L
Sbjct:    8 VLRLSRLPQYFGEKEVLEYLRQFGKVDA-VYMPKSKKTLMHQGCAFVKISKELAPIVVSTLDSVLNFNKLMKCEVLSDPKWSVFRRKFLPKSSREVERKRQMNSAL 112          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A0R3WHK6 (RRM domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS27 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.008e-11
Identity = 49/135 (36.30%), Postives = 73/135 (54.07%), Query Frame = 1
Query:   58 VLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKEVCEPFMETLNNRFMFNKVLKCSIITNPSKGTFRKKNLKPFSGFLNEKVKQNVHLEMRKTNDNLKKASKSRKTYNFNKKLKALE 462
             LKISHLP+ F E +L  Y  QFG T   V++PRS++TL +K  AFI + KE+      T++N   FNK++KC I+       FR +   P S    EK ++     ++ T    + ASK R+  N   ++ AL+
Sbjct:   27 ALKISHLPKHFEEKQLREYFAQFG-TVYGVHLPRSRKTLNAKDQAFILVDKEIASIIASTVHNVLNFNKIMKCQILDTYYPRWFR-RTPPPVSTVELEKRRR-----LKSTVKQTRDASK-RRMKNLRNRVAALK 153          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:NCBI gene;Acc:103042255])

HSP 1 Score: 54.299 bits (129), Expect = 5.160e-9
Identity = 28/77 (36.36%), Postives = 47/77 (61.04%), Query Frame = 1
Query:   58 VLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLP-KEVCEPFMETLNNRFMFNKVLKCSII 285
            V+ + H+P+   E +L  Y  QFG  + R+ + RSK+T +SKG+AF+     EV +   ET+NN  +  +++KC +I
Sbjct:   44 VVYVGHIPQALAEPQLRPYFSQFGKVT-RLRLSRSKKTGRSKGYAFVEFDCDEVAKIVAETMNNYLIGERLIKCHLI 119          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:NCBI gene;Acc:317644])

HSP 1 Score: 51.2174 bits (121), Expect = 8.250e-9
Identity = 26/87 (29.89%), Postives = 45/87 (51.72%), Query Frame = 1
Query:   28 PTMSFYQSNKVLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLP-KEVCEPFMETLNNRFMFNKVLKCSII 285
            PT        V+ + H+P  F E ++  +  QFG  + R+ + RSK T + KG+ ++    +EV +    T+NN   + ++LKC  I
Sbjct:   39 PTTGAIAKRGVVYLGHMPHGFAEIQVKKFFNQFGKVT-RIRLSRSKRTGRPKGYGYVEFEYEEVAKIVANTMNNYLFYERLLKCEYI 124          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO45906 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRY1])

HSP 1 Score: 59.3066 bits (142), Expect = 2.079e-11
Identity = 27/79 (34.18%), Postives = 51/79 (64.56%), Query Frame = 1
Query:   58 VLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLP-KEVCEPFMETLNNRFMFNKVLKCSIITN 291
            V+ + H+P  F E+++  + +QFG  + R+ + RSK++ +SKG+AF+     EV +   +T++N  MF ++LKC ++ N
Sbjct:   47 VIYLGHIPHGFFENEIKKFFEQFGTVN-RIRLSRSKKSARSKGYAFVEFACDEVAKIAADTMHNYMMFGRLLKCKVVPN 124          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000048749.1 (SMESG000048749.1)

HSP 1 Score: 303.523 bits (776), Expect = 2.176e-107
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 1
Query:   34 MSFYQSNKVLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKEVCEPFMETLNNRFMFNKVLKCSIITNPSKGTFRKKNLKPFSGFLNEKVKQNVHLEMRKTNDNLKKASKSRKTYNFNKKLKALEGFDFKSSL 486
            MSFYQSNKVLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKEVCEPFMETLNNRFMFNKVLKCSIITNPSKGTFRKKNLKPFSGFLNEKVKQNVHLEMRKTNDNLKKASKSRKTYNFNKKLKALEGFDFKSSL
Sbjct:    1 MSFYQSNKVLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKEVCEPFMETLNNRFMFNKVLKCSIITNPSKGTFRKKNLKPFSGFLNEKVKQNVHLEMRKTNDNLKKASKSRKTYNFNKKLKALEGFDFKSSL 151          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000048745.1 (SMESG000048745.1)

HSP 1 Score: 303.523 bits (776), Expect = 2.176e-107
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 1
Query:   34 MSFYQSNKVLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKEVCEPFMETLNNRFMFNKVLKCSIITNPSKGTFRKKNLKPFSGFLNEKVKQNVHLEMRKTNDNLKKASKSRKTYNFNKKLKALEGFDFKSSL 486
            MSFYQSNKVLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKEVCEPFMETLNNRFMFNKVLKCSIITNPSKGTFRKKNLKPFSGFLNEKVKQNVHLEMRKTNDNLKKASKSRKTYNFNKKLKALEGFDFKSSL
Sbjct:    1 MSFYQSNKVLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSKGFAFISLPKEVCEPFMETLNNRFMFNKVLKCSIITNPSKGTFRKKNLKPFSGFLNEKVKQNVHLEMRKTNDNLKKASKSRKTYNFNKKLKALEGFDFKSSL 151          
The following BLAST results are available for this feature:
BLAST of RRM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NIFK2.739e-736.36nucleolar protein interacting with the FHA domain ... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG69371.808e-940.00gene:FBgn0038989 transcript:FBtr0084266[more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nifk1.897e-1131.72nucleolar protein interacting with the FHA domain ... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nifk3.735e-836.25nucleolar protein interacting with the FHA domain ... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Nifk1.369e-937.66nucleolar protein interacting with the FHA domain ... [more]
Nifk4.902e-839.19nucleolar protein interacting with the FHA domain ... [more]
back to top
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8JIY8|MK67I_DANRE1.432e-1031.72MKI67 FHA domain-interacting nucleolar phosphoprot... [more]
sp|Q7SYS2|MK67I_XENLA9.329e-837.18MKI67 FHA domain-interacting nucleolar phosphoprot... [more]
sp|Q91VE6|MK67I_MOUSE3.429e-739.19MKI67 FHA domain-interacting nucleolar phosphoprot... [more]
sp|Q6GL69|MK67I_XENTR4.492e-736.25MKI67 FHA domain-interacting nucleolar phosphoprot... [more]
sp|Q3SZM1|MK67I_BOVIN7.669e-737.66MKI67 FHA domain-interacting nucleolar phosphoprot... [more]
back to top
BLAST of RRM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YVK03.467e-1632.08RRM domain-containing protein OS=Fasciola gigantic... [more]
A0A4E0S0R21.887e-1541.38RRM domain-containing protein OS=Fasciola hepatica... [more]
A0A5K3F2J21.579e-1433.56Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4V6RH825.487e-1436.79RRM domain-containing protein OS=Opisthorchis feli... [more]
A0A0R3WHK61.008e-1136.30RRM domain-containing protein OS=Hydatigena taenia... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nifk5.160e-936.36nucleolar protein interacting with the FHA domain ... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nifk8.250e-929.89nucleolar protein interacting with the FHA domain ... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO459062.079e-1134.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000048749.12.176e-107100.00SMESG000048749.1[more]
SMESG000048745.12.176e-107100.00SMESG000048745.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006888 ID=SMED30006888|Name=RRM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=509bp
TTGTTTTAATAATCACTTTATTTATCGCCAACAATGAGTTTTTACCAATC
AAACAAAGTTTTAAAAATAAGTCATTTACCAGAAGACTTTACAGAATCAA
AGTTAATAAACTATGCTAAGCAATTTGGATGTACTTCAGTTAGAGTTTAT
ATTCCAAGATCAAAAGAAACTCTTAAATCTAAAGGATTTGCTTTCATTTC
ATTACCGAAAGAAGTGTGCGAACCATTCATGGAAACTCTAAACAACAGAT
TCATGTTTAACAAAGTCTTAAAATGTTCTATTATTACAAATCCTTCGAAA
GGCACATTTAGAAAGAAAAACTTGAAACCATTTAGTGGGTTTTTAAATGA
GAAAGTCAAGCAAAATGTCCATTTGGAAATGAGAAAAACAAATGATAATC
TTAAAAAAGCCTCCAAATCAAGAAAGACCTACAACTTCAATAAGAAACTC
AAGGCTTTAGAAGGATTTGATTTCAAGTCTAGTTTGTAATAAATAAATGT
TTCAATAGT
back to top

protein sequence of SMED30006888-orf-1

>SMED30006888-orf-1 ID=SMED30006888-orf-1|Name=SMED30006888-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=152bp
MSFYQSNKVLKISHLPEDFTESKLINYAKQFGCTSVRVYIPRSKETLKSK
GFAFISLPKEVCEPFMETLNNRFMFNKVLKCSIITNPSKGTFRKKNLKPF
SGFLNEKVKQNVHLEMRKTNDNLKKASKSRKTYNFNKKLKALEGFDFKSS
L*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 9..82
e-value: 9.0E-6
score: 35.2
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 12..79
e-value: 3.4E-6
score: 26.8
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 2..98
e-value: 1.9E-11
score: 45.9
NoneNo IPR availablePANTHERPTHR46754FAMILY NOT NAMEDcoord: 6..148
NoneNo IPR availablePANTHERPTHR46754:SF1MKI67 FHA DOMAIN-INTERACTING NUCLEOLAR PHOSPHOPROTEINcoord: 6..148
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 5..96