Protein dpy-30-like

Overview
NameProtein dpy-30-like
Smed IDSMED30006884
Length (bp)423
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein dpy-30-like (SMED30006884) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein dpy-30-like (SMED30006884) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein dpy-30-like (SMED30006884) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein dpy-30-like (SMED30006884) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006884

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006884SMESG000008786.1 SmedASXL_006566SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30006884SMESG000008786.1 dd_Smed_v4_9103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30006884SMESG000008786.1 dd_Smed_v4_9103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30006884SMESG000008786.1 dd_Smed_v4_9103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30006884SMESG000008786.1 dd_Smed_v4_9103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30006884SMESG000008786.1 dd_Smed_v4_9103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30006884SMESG000008786.1 dd_Smed_v6_9103_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30006884SMESG000008786.1 dd_Smed_v4_9103_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30006884SMESG000008786.1 KC262338smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30006884SMESG000008786.1 KC262338smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30006884SMESG000008786.1 KC262338smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein dpy-30-like vs. Ensembl Human
Match: DPY30 (dpy-30 histone methyltransferase complex regulatory subunit [Source:HGNC Symbol;Acc:HGNC:24590])

HSP 1 Score: 81.2629 bits (199), Expect = 2.068e-20
Identity = 36/72 (50.00%), Postives = 54/72 (75.00%), Query Frame = 1
Query:  157 NIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYES 372
            N+E+I+  E     K     +++QSLP+R YL++TV+PIL+QG+  L KERPPNPIE++A++LLKNK+ +E 
Sbjct:   26 NVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFED 97          
BLAST of Protein dpy-30-like vs. Ensembl Human
Match: DPY30 (dpy-30 histone methyltransferase complex regulatory subunit [Source:HGNC Symbol;Acc:HGNC:24590])

HSP 1 Score: 81.2629 bits (199), Expect = 2.068e-20
Identity = 36/72 (50.00%), Postives = 54/72 (75.00%), Query Frame = 1
Query:  157 NIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYES 372
            N+E+I+  E     K     +++QSLP+R YL++TV+PIL+QG+  L KERPPNPIE++A++LLKNK+ +E 
Sbjct:   26 NVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFED 97          
BLAST of Protein dpy-30-like vs. Ensembl Human
Match: AK7 (adenylate kinase 7 [Source:HGNC Symbol;Acc:HGNC:20091])

HSP 1 Score: 50.0618 bits (118), Expect = 2.661e-7
Identity = 22/46 (47.83%), Postives = 31/46 (67.39%), Query Frame = 1
Query:  217 LEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKN 354
            LE QS+P R YL   V+P LIQG+N     RP +P++++A +L KN
Sbjct:  673 LEAQSIPLRNYLMTYVMPTLIQGLNECCNVRPEDPVDFLAEYLFKN 718          
BLAST of Protein dpy-30-like vs. Ensembl Celegans
Match: dpy-30 (Dosage compensation protein dpy-30 [Source:UniProtKB/Swiss-Prot;Acc:Q10661])

HSP 1 Score: 63.1586 bits (152), Expect = 1.454e-13
Identity = 25/48 (52.08%), Postives = 37/48 (77.08%), Query Frame = 1
Query:  229 SLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYES 372
            ++P+R YL+ TV+PIL+QG+  L K+RP NPIE++A FLL+ K  Y +
Sbjct:   67 TVPTRQYLDSTVVPILLQGLGALAKDRPENPIEFLANFLLREKDRYNA 114          
BLAST of Protein dpy-30-like vs. Ensembl Celegans
Match: dpy-30 (Dosage compensation protein dpy-30 [Source:UniProtKB/Swiss-Prot;Acc:Q10661])

HSP 1 Score: 63.1586 bits (152), Expect = 1.454e-13
Identity = 25/48 (52.08%), Postives = 37/48 (77.08%), Query Frame = 1
Query:  229 SLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYES 372
            ++P+R YL+ TV+PIL+QG+  L K+RP NPIE++A FLL+ K  Y +
Sbjct:   67 TVPTRQYLDSTVVPILLQGLGALAKDRPENPIEFLANFLLREKDRYNA 114          
BLAST of Protein dpy-30-like vs. Ensembl Fly
Match: Dpy-30L2 (gene:FBgn0035491 transcript:FBtr0073281)

HSP 1 Score: 59.3066 bits (142), Expect = 3.190e-12
Identity = 27/67 (40.30%), Postives = 43/67 (64.18%), Query Frame = 1
Query:  160 IEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKS 360
            ++ I A    +K +P     +  S+P R YL++TV PIL+ G+  L ++RP +PI Y+A +LLKNK+
Sbjct:   27 VDGIDAFAACQKPRP-----DTSSMPVRQYLDQTVAPILLHGLQALARDRPSDPISYLATYLLKNKN 88          
BLAST of Protein dpy-30-like vs. Ensembl Fly
Match: Dpy-30L2 (gene:FBgn0035491 transcript:FBtr0332981)

HSP 1 Score: 59.3066 bits (142), Expect = 3.190e-12
Identity = 27/67 (40.30%), Postives = 43/67 (64.18%), Query Frame = 1
Query:  160 IEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKS 360
            ++ I A    +K +P     +  S+P R YL++TV PIL+ G+  L ++RP +PI Y+A +LLKNK+
Sbjct:   27 VDGIDAFAACQKPRP-----DTSSMPVRQYLDQTVAPILLHGLQALARDRPSDPISYLATYLLKNKN 88          
BLAST of Protein dpy-30-like vs. Ensembl Fly
Match: Dpy-30L1 (gene:FBgn0032293 transcript:FBtr0080112)

HSP 1 Score: 58.5362 bits (140), Expect = 1.543e-11
Identity = 22/55 (40.00%), Postives = 40/55 (72.73%), Query Frame = 1
Query:  205 KLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYE 369
            K  + E  ++P+R YL++TV P+L+ GM  L +ERP +PI+++A++LLK+ +  +
Sbjct:   67 KKPSSETNNMPTRQYLDQTVAPVLLHGMQALARERPTDPIQFLASYLLKHSNGCD 121          
BLAST of Protein dpy-30-like vs. Ensembl Fly
Match: CG33060 (gene:FBgn0053060 transcript:FBtr0305307)

HSP 1 Score: 43.1282 bits (100), Expect = 7.590e-6
Identity = 18/43 (41.86%), Postives = 29/43 (67.44%), Query Frame = 1
Query:  241 RLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYE 369
            R++LE+ V+PIL++GM  L +E P +PI Y+  F L +K   +
Sbjct:   71 RIFLEQEVVPILMEGMLGLAREMPRDPIGYLQKFWLDDKHKCD 113          
BLAST of Protein dpy-30-like vs. Ensembl Zebrafish
Match: dpy30 (dpy-30 histone methyltransferase complex regulatory subunit [Source:ZFIN;Acc:ZDB-GENE-040718-136])

HSP 1 Score: 80.8777 bits (198), Expect = 2.583e-20
Identity = 39/73 (53.42%), Postives = 56/73 (76.71%), Query Frame = 1
Query:  157 NIEKIIAIEN--QRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYE 369
            NI++I   E   ++  K K+    +Q+LP+R YL++TV+PIL+QG++ L KERPPNPIE++AAFLLKNKS +E
Sbjct:   31 NIQRIAENEKTAEKVGKQKVDPQTLQTLPTRAYLDQTVVPILLQGLSVLAKERPPNPIEFLAAFLLKNKSQFE 103          
BLAST of Protein dpy-30-like vs. Ensembl Zebrafish
Match: ak7b (adenylate kinase 7b [Source:ZFIN;Acc:ZDB-GENE-050309-170])

HSP 1 Score: 46.595 bits (109), Expect = 2.232e-6
Identity = 22/52 (42.31%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  199 KPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKN 354
            + +L  LE QS P R YL + V+P L QG+    + RP +PI+++A +LL+N
Sbjct:  644 RQELDLLESQSEPLRDYLMQDVMPTLTQGLIECCRLRPDDPIDFLAEYLLQN 695          
BLAST of Protein dpy-30-like vs. Ensembl Zebrafish
Match: dpy30 (dpy-30 histone methyltransferase complex regulatory subunit [Source:ZFIN;Acc:ZDB-GENE-040718-136])

HSP 1 Score: 43.1282 bits (100), Expect = 5.750e-6
Identity = 23/54 (42.59%), Postives = 37/54 (68.52%), Query Frame = 1
Query:  157 NIEKIIAIENQRKL----KPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKE 306
            NI++I   EN++      K K+    +Q+LP+R YL++TV+PIL+QG++ L KE
Sbjct:   31 NIQRIA--ENEKTAEKVGKQKVDPQTLQTLPTRAYLDQTVVPILLQGLSVLAKE 82          
BLAST of Protein dpy-30-like vs. Ensembl Xenopus
Match: gtf3c6 (general transcription factor IIIC subunit 6 [Source:Xenbase;Acc:XB-GENE-5805128])

HSP 1 Score: 83.5741 bits (205), Expect = 2.439e-21
Identity = 37/71 (52.11%), Postives = 54/71 (76.06%), Query Frame = 1
Query:  157 NIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYE 369
            N+E+I+  E     K     +++Q LP+R YL++TV+PIL+QG++ L KERPPNPIEY+AA+LLKNK+ +E
Sbjct:   26 NVERIVENEKTSTEKISKQKVDLQGLPTRAYLDQTVVPILLQGLSVLAKERPPNPIEYLAAYLLKNKTQFE 96          
BLAST of Protein dpy-30-like vs. Ensembl Xenopus
Match: sesn1 (sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636])

HSP 1 Score: 50.0618 bits (118), Expect = 2.272e-7
Identity = 20/46 (43.48%), Postives = 33/46 (71.74%), Query Frame = 1
Query:  217 LEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKN 354
            LE QS+P R YL + V+P L+QG+N   K RP +P++++A ++ +N
Sbjct:  660 LEAQSVPLRNYLMKNVMPTLMQGLNECCKIRPHDPVDFLAEYIFRN 705          
BLAST of Protein dpy-30-like vs. Ensembl Xenopus
Match: sesn1 (sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636])

HSP 1 Score: 50.0618 bits (118), Expect = 2.316e-7
Identity = 20/46 (43.48%), Postives = 33/46 (71.74%), Query Frame = 1
Query:  217 LEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKN 354
            LE QS+P R YL + V+P L+QG+N   K RP +P++++A ++ +N
Sbjct:  660 LEAQSVPLRNYLMKNVMPTLMQGLNECCKIRPHDPVDFLAEYIFRN 705          
BLAST of Protein dpy-30-like vs. Ensembl Xenopus
Match: sesn1 (sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636])

HSP 1 Score: 50.0618 bits (118), Expect = 2.339e-7
Identity = 20/46 (43.48%), Postives = 33/46 (71.74%), Query Frame = 1
Query:  217 LEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKN 354
            LE QS+P R YL + V+P L+QG+N   K RP +P++++A ++ +N
Sbjct:  660 LEAQSVPLRNYLMKNVMPTLMQGLNECCKIRPHDPVDFLAEYIFRN 705          
BLAST of Protein dpy-30-like vs. Ensembl Xenopus
Match: sesn1 (sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636])

HSP 1 Score: 49.6766 bits (117), Expect = 2.644e-7
Identity = 20/46 (43.48%), Postives = 33/46 (71.74%), Query Frame = 1
Query:  217 LEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKN 354
            LE QS+P R YL + V+P L+QG+N   K RP +P++++A ++ +N
Sbjct:  647 LEAQSVPLRNYLMKNVMPTLMQGLNECCKIRPHDPVDFLAEYIFRN 692          
BLAST of Protein dpy-30-like vs. Ensembl Mouse
Match: Dpy30 (dpy-30, histone methyltransferase complex regulatory subunit [Source:MGI Symbol;Acc:MGI:1913560])

HSP 1 Score: 79.337 bits (194), Expect = 7.138e-20
Identity = 35/72 (48.61%), Postives = 54/72 (75.00%), Query Frame = 1
Query:  157 NIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYES 372
            ++E+I+  E     K     +++QSLP+R YL++TV+PIL+QG+  L KERPPNPIE++A++LLKNK+ +E 
Sbjct:   26 SVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFED 97          
BLAST of Protein dpy-30-like vs. Ensembl Mouse
Match: Dpy30 (dpy-30, histone methyltransferase complex regulatory subunit [Source:MGI Symbol;Acc:MGI:1913560])

HSP 1 Score: 79.337 bits (194), Expect = 7.138e-20
Identity = 35/72 (48.61%), Postives = 54/72 (75.00%), Query Frame = 1
Query:  157 NIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYES 372
            ++E+I+  E     K     +++QSLP+R YL++TV+PIL+QG+  L KERPPNPIE++A++LLKNK+ +E 
Sbjct:   26 SVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFED 97          
BLAST of Protein dpy-30-like vs. Ensembl Mouse
Match: Dpy30 (dpy-30, histone methyltransferase complex regulatory subunit [Source:MGI Symbol;Acc:MGI:1913560])

HSP 1 Score: 79.337 bits (194), Expect = 7.138e-20
Identity = 35/72 (48.61%), Postives = 54/72 (75.00%), Query Frame = 1
Query:  157 NIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYES 372
            ++E+I+  E     K     +++QSLP+R YL++TV+PIL+QG+  L KERPPNPIE++A++LLKNK+ +E 
Sbjct:   26 SVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFED 97          
BLAST of Protein dpy-30-like vs. Ensembl Mouse
Match: Dpy30 (dpy-30, histone methyltransferase complex regulatory subunit [Source:MGI Symbol;Acc:MGI:1913560])

HSP 1 Score: 79.337 bits (194), Expect = 7.138e-20
Identity = 35/72 (48.61%), Postives = 54/72 (75.00%), Query Frame = 1
Query:  157 NIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYES 372
            ++E+I+  E     K     +++QSLP+R YL++TV+PIL+QG+  L KERPPNPIE++A++LLKNK+ +E 
Sbjct:   26 SVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFED 97          
BLAST of Protein dpy-30-like vs. Ensembl Mouse
Match: Ak7 (adenylate kinase 7 [Source:MGI Symbol;Acc:MGI:1926051])

HSP 1 Score: 51.9878 bits (123), Expect = 3.236e-8
Identity = 22/46 (47.83%), Postives = 33/46 (71.74%), Query Frame = 1
Query:  217 LEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKN 354
            LE+QS+P R YL   V+P L+QG+N   K RP +P++++A +L KN
Sbjct:  673 LEVQSVPLRNYLMTYVMPTLMQGLNECCKVRPEDPVDFLAEYLFKN 718          
BLAST of Protein dpy-30-like vs. UniProt/SwissProt
Match: sp|Q9C005|DPY30_HUMAN (Protein dpy-30 homolog OS=Homo sapiens OX=9606 GN=DPY30 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 9.930e-20
Identity = 36/72 (50.00%), Postives = 54/72 (75.00%), Query Frame = 1
Query:  157 NIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYES 372
            N+E+I+  E     K     +++QSLP+R YL++TV+PIL+QG+  L KERPPNPIE++A++LLKNK+ +E 
Sbjct:   26 NVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFED 97          
BLAST of Protein dpy-30-like vs. UniProt/SwissProt
Match: sp|Q2NKU6|DPY30_BOVIN (Protein dpy-30 homolog OS=Bos taurus OX=9913 GN=DPY30 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 9.930e-20
Identity = 36/72 (50.00%), Postives = 54/72 (75.00%), Query Frame = 1
Query:  157 NIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYES 372
            N+E+I+  E     K     +++QSLP+R YL++TV+PIL+QG+  L KERPPNPIE++A++LLKNK+ +E 
Sbjct:   26 NVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFED 97          
BLAST of Protein dpy-30-like vs. UniProt/SwissProt
Match: sp|Q99LT0|DPY30_MOUSE (Protein dpy-30 homolog OS=Mus musculus OX=10090 GN=Dpy30 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 4.993e-19
Identity = 35/72 (48.61%), Postives = 54/72 (75.00%), Query Frame = 1
Query:  157 NIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYES 372
            ++E+I+  E     K     +++QSLP+R YL++TV+PIL+QG+  L KERPPNPIE++A++LLKNK+ +E 
Sbjct:   26 SVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFED 97          
BLAST of Protein dpy-30-like vs. UniProt/SwissProt
Match: sp|Q8K3E7|DPY30_RAT (Protein dpy-30 homolog OS=Rattus norvegicus OX=10116 GN=Dpy30 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.325e-18
Identity = 34/72 (47.22%), Postives = 53/72 (73.61%), Query Frame = 1
Query:  157 NIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYES 372
            ++E+I+  E     K     +++QSLP+R YL++TV+PIL+QG+  L KERPPNP E++A++LLKNK+ +E 
Sbjct:   26 SVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKERPPNPTEFLASYLLKNKAQFED 97          
BLAST of Protein dpy-30-like vs. UniProt/SwissProt
Match: sp|Q10661|DPY30_CAEEL (Dosage compensation protein dpy-30 OS=Caenorhabditis elegans OX=6239 GN=dpy-30 PE=1 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.849e-12
Identity = 25/48 (52.08%), Postives = 37/48 (77.08%), Query Frame = 1
Query:  229 SLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYES 372
            ++P+R YL+ TV+PIL+QG+  L K+RP NPIE++A FLL+ K  Y +
Sbjct:   67 TVPTRQYLDSTVVPILLQGLGALAKDRPENPIEFLANFLLREKDRYNA 114          
BLAST of Protein dpy-30-like vs. TrEMBL
Match: L0H755 (Dpy30-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.305e-48
Identity = 83/84 (98.81%), Postives = 83/84 (98.81%), Query Frame = 1
Query:  124 LPTSVLESKILNIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYESM 375
            LPTS LESKILNIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYESM
Sbjct:    4 LPTSELESKILNIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYESM 87          
BLAST of Protein dpy-30-like vs. TrEMBL
Match: L0H9N7 (Dpy30-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 4.658e-36
Identity = 66/70 (94.29%), Postives = 68/70 (97.14%), Query Frame = 1
Query:  124 LPTSVLESKILNIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYM 333
            LPTSVLE KI +IEKII+IENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYM
Sbjct:    4 LPTSVLEFKIFDIEKIISIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYM 73          
BLAST of Protein dpy-30-like vs. TrEMBL
Match: C3XZ39 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_202721 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.861e-21
Identity = 41/71 (57.75%), Postives = 57/71 (80.28%), Query Frame = 1
Query:  157 NIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYE 369
            N++K+I  E +   KP    +E+QSLP+R YL++TV+PIL+QG++ L KERPPNPIEY+AA+LLKNKS +E
Sbjct:   29 NVQKMITAEKEAAEKPIKQKVELQSLPTRAYLDQTVVPILLQGLSTLAKERPPNPIEYLAAYLLKNKSKFE 99          
BLAST of Protein dpy-30-like vs. TrEMBL
Match: R7VAY8 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_155367 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.618e-20
Identity = 44/74 (59.46%), Postives = 58/74 (78.38%), Query Frame = 1
Query:  157 NIEKIIAIENQRKLKP---KLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYE 369
            NI+K+IA E +    P   K   +E+QSLP+R YL++TV+PIL+QGM+ L KERPPNPIEY+AA+LLKNKS +E
Sbjct:   31 NIQKVIAHEKESLEAPSSAKRPKVELQSLPTRAYLDQTVVPILLQGMSVLSKERPPNPIEYLAAYLLKNKSQFE 104          
BLAST of Protein dpy-30-like vs. TrEMBL
Match: A7RP67 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g239717 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 4.700e-20
Identity = 40/71 (56.34%), Postives = 55/71 (77.46%), Query Frame = 1
Query:  157 NIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYE 369
            N++KII  E +   KP    +++QSLP+R YL++TV+PIL+QG+  L KERPPN I+Y+AA+LLKNKS YE
Sbjct:   41 NLQKIIEKEKEEADKPTKAKVDLQSLPTRAYLDQTVVPILLQGLATLAKERPPNAIDYLAAYLLKNKSQYE 111          
BLAST of Protein dpy-30-like vs. Ensembl Cavefish
Match: dpy30 (dpy-30 histone methyltransferase complex regulatory subunit [Source:NCBI gene;Acc:103036540])

HSP 1 Score: 82.8037 bits (203), Expect = 3.622e-21
Identity = 38/75 (50.67%), Postives = 55/75 (73.33%), Query Frame = 1
Query:  157 NIEKIIAIEN---QRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYES 372
            NI++I+  E     +  K K+    +Q+LP+R YL++TV+PIL+QG++ L KERPPNPIE++A FLLKNKS +E 
Sbjct:   30 NIQRIVDSEKTNADKSTKQKVDLQTLQTLPTRAYLDQTVVPILLQGLSVLAKERPPNPIEFLATFLLKNKSQFED 104          
BLAST of Protein dpy-30-like vs. Ensembl Cavefish
Match: ak7b (adenylate kinase 7 [Source:NCBI gene;Acc:103041221])

HSP 1 Score: 46.2098 bits (108), Expect = 3.059e-6
Identity = 20/46 (43.48%), Postives = 31/46 (67.39%), Query Frame = 1
Query:  217 LEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKN 354
            LE +S+P R YL   V+P L QG+    + RP +P++++A +LLKN
Sbjct:  656 LEAESVPLRQYLMRDVMPTLTQGLIECCRIRPEDPVDFLAEYLLKN 701          
BLAST of Protein dpy-30-like vs. Ensembl Nematostella
Match: EDO46806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP67])

HSP 1 Score: 88.9669 bits (219), Expect = 6.500e-24
Identity = 40/71 (56.34%), Postives = 55/71 (77.46%), Query Frame = 1
Query:  157 NIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYE 369
            N++KII  E +   KP    +++QSLP+R YL++TV+PIL+QG+  L KERPPN I+Y+AA+LLKNKS YE
Sbjct:   41 NLQKIIEKEKEEADKPTKAKVDLQSLPTRAYLDQTVVPILLQGLATLAKERPPNAIDYLAAYLLKNKSQYE 111          
BLAST of Protein dpy-30-like vs. Ensembl Nematostella
Match: EDO36546 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIC3])

HSP 1 Score: 44.669 bits (104), Expect = 3.298e-6
Identity = 21/46 (45.65%), Postives = 31/46 (67.39%), Query Frame = 1
Query:  217 LEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKN 354
            LE QS+P R YL + V+P L QG+    K RP +PI+++A +L +N
Sbjct:  657 LENQSIPLRNYLMKHVMPTLTQGLIEACKVRPDDPIDFVAEYLFQN 702          
BLAST of Protein dpy-30-like vs. Ensembl Medaka
Match: dpy30 (dpy-30 histone methyltransferase complex regulatory subunit [Source:ZFIN;Acc:ZDB-GENE-040718-136])

HSP 1 Score: 78.5666 bits (192), Expect = 8.589e-20
Identity = 34/68 (50.00%), Postives = 52/68 (76.47%), Query Frame = 1
Query:  175 AIENQRKLKPKLTT--LEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYES 372
            A++  +    KL+   +++Q+LP+R YL++TV+PIL+QG++ L KERPPNPIE++A FLLKNK  +E 
Sbjct:   19 AVDGDKAGADKLSKQKVDLQALPTRAYLDQTVVPILLQGLSVLAKERPPNPIEFLATFLLKNKVQFED 86          
BLAST of Protein dpy-30-like vs. Planmine SMEST
Match: SMESG000008786.1 (SMESG000008786.1)

HSP 1 Score: 185.652 bits (470), Expect = 7.598e-62
Identity = 111/112 (99.11%), Postives = 111/112 (99.11%), Query Frame = 1
Query:   40 MNESNNIDESHLFSSXXXXXXXXXXXXXLPTSVLESKILNIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYESM 375
            MNESNNIDESHLFSSENNEEKERTEEIELPTS LESKILNIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYESM
Sbjct:    1 MNESNNIDESHLFSSENNEEKERTEEIELPTSELESKILNIEKIIAIENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYESM 112          
BLAST of Protein dpy-30-like vs. Planmine SMEST
Match: SMESG000066726.1 (SMESG000066726.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.866e-13
Identity = 25/58 (43.10%), Postives = 41/58 (70.69%), Query Frame = 1
Query:  193 KLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAY 366
            K K   +   +Q+L +R+YL++TV+P+++ G   L K+RP NPIE++A +LLK+K  Y
Sbjct:   14 KSKGSGSDANLQNLSARVYLDQTVVPVVLSGFKVLAKQRPNNPIEFLADYLLKHKDDY 71          
BLAST of Protein dpy-30-like vs. Planmine SMEST
Match: SMESG000075409.1 (SMESG000075409.1)

HSP 1 Score: 46.2098 bits (108), Expect = 1.947e-6
Identity = 21/51 (41.18%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  217 LEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEYMAAFLLKNKSAYE 369
            LE +S P R YL   V+P+L +G+   VK RP N I+++A +L +N   Y+
Sbjct:  663 LEEKSQPLRNYLMRHVMPVLTEGLIDCVKHRPDNAIDHLAEYLFRNNPQYD 713          
The following BLAST results are available for this feature:
BLAST of Protein dpy-30-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
DPY302.068e-2050.00dpy-30 histone methyltransferase complex regulator... [more]
DPY302.068e-2050.00dpy-30 histone methyltransferase complex regulator... [more]
AK72.661e-747.83adenylate kinase 7 [Source:HGNC Symbol;Acc:HGNC:20... [more]
back to top
BLAST of Protein dpy-30-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dpy-301.454e-1352.08Dosage compensation protein dpy-30 [Source:UniPro... [more]
dpy-301.454e-1352.08Dosage compensation protein dpy-30 [Source:UniPro... [more]
back to top
BLAST of Protein dpy-30-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Dpy-30L23.190e-1240.30gene:FBgn0035491 transcript:FBtr0073281[more]
Dpy-30L23.190e-1240.30gene:FBgn0035491 transcript:FBtr0332981[more]
Dpy-30L11.543e-1140.00gene:FBgn0032293 transcript:FBtr0080112[more]
CG330607.590e-641.86gene:FBgn0053060 transcript:FBtr0305307[more]
back to top
BLAST of Protein dpy-30-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dpy302.583e-2053.42dpy-30 histone methyltransferase complex regulator... [more]
ak7b2.232e-642.31adenylate kinase 7b [Source:ZFIN;Acc:ZDB-GENE-0503... [more]
dpy305.750e-642.59dpy-30 histone methyltransferase complex regulator... [more]
back to top
BLAST of Protein dpy-30-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtf3c62.439e-2152.11general transcription factor IIIC subunit 6 [Sourc... [more]
sesn12.272e-743.48sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636][more]
sesn12.316e-743.48sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636][more]
sesn12.339e-743.48sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636][more]
sesn12.644e-743.48sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636][more]
back to top
BLAST of Protein dpy-30-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dpy307.138e-2048.61dpy-30, histone methyltransferase complex regulato... [more]
Dpy307.138e-2048.61dpy-30, histone methyltransferase complex regulato... [more]
Dpy307.138e-2048.61dpy-30, histone methyltransferase complex regulato... [more]
Dpy307.138e-2048.61dpy-30, histone methyltransferase complex regulato... [more]
Ak73.236e-847.83adenylate kinase 7 [Source:MGI Symbol;Acc:MGI:1926... [more]
back to top
BLAST of Protein dpy-30-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9C005|DPY30_HUMAN9.930e-2050.00Protein dpy-30 homolog OS=Homo sapiens OX=9606 GN=... [more]
sp|Q2NKU6|DPY30_BOVIN9.930e-2050.00Protein dpy-30 homolog OS=Bos taurus OX=9913 GN=DP... [more]
sp|Q99LT0|DPY30_MOUSE4.993e-1948.61Protein dpy-30 homolog OS=Mus musculus OX=10090 GN... [more]
sp|Q8K3E7|DPY30_RAT2.325e-1847.22Protein dpy-30 homolog OS=Rattus norvegicus OX=101... [more]
sp|Q10661|DPY30_CAEEL1.849e-1252.08Dosage compensation protein dpy-30 OS=Caenorhabdit... [more]
back to top
BLAST of Protein dpy-30-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
L0H7551.305e-4898.81Dpy30-1 (Fragment) OS=Schmidtea mediterranea OX=79... [more]
L0H9N74.658e-3694.29Dpy30-1 (Fragment) OS=Schmidtea mediterranea OX=79... [more]
C3XZ394.861e-2157.75Uncharacterized protein OS=Branchiostoma floridae ... [more]
R7VAY81.618e-2059.46Uncharacterized protein OS=Capitella teleta OX=283... [more]
A7RP674.700e-2056.34Predicted protein OS=Nematostella vectensis OX=453... [more]
back to top
BLAST of Protein dpy-30-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dpy303.622e-2150.67dpy-30 histone methyltransferase complex regulator... [more]
ak7b3.059e-643.48adenylate kinase 7 [Source:NCBI gene;Acc:103041221... [more]
back to top
BLAST of Protein dpy-30-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein dpy-30-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein dpy-30-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO468066.500e-2456.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365463.298e-645.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein dpy-30-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dpy308.589e-2050.00dpy-30 histone methyltransferase complex regulator... [more]
back to top
BLAST of Protein dpy-30-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000008786.17.598e-6299.11SMESG000008786.1[more]
SMESG000066726.11.866e-1343.10SMESG000066726.1[more]
SMESG000075409.11.947e-641.18SMESG000075409.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006884 ID=SMED30006884|Name=Protein dpy-30-like|organism=Schmidtea mediterranea sexual|type=transcript|length=423bp
TTTAAATCTTAGTAACTAAGTAAAATAAATATGAAAAATATGAATGAATC
AAATAATATAGATGAATCCCATTTATTTTCATCAGAAAACAATGAAGAAA
AGGAACGGACTGAAGAAATTGAATTGCCAACTAGTGTGTTAGAATCTAAG
ATTTTAAACATAGAAAAAATAATTGCGATTGAAAATCAAAGAAAGCTAAA
ACCCAAACTTACAACATTAGAAATTCAATCTTTACCATCAAGATTATATT
TAGAAGAAACAGTTATACCAATTTTAATACAAGGAATGAATTATTTAGTT
AAAGAAAGACCGCCCAATCCAATTGAATATATGGCAGCTTTTCTCTTGAA
AAATAAATCTGCCTATGAATCTATGTGATGATTTTATGCTAAAATAATTA
ATGTTGTTCATTTTTAAAAAAAA
back to top

protein sequence of SMED30006884-orf-1

>SMED30006884-orf-1 ID=SMED30006884-orf-1|Name=SMED30006884-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=116bp
MKNMNESNNIDESHLFSSENNEEKERTEEIELPTSVLESKILNIEKIIAI
ENQRKLKPKLTTLEIQSLPSRLYLEETVIPILIQGMNYLVKERPPNPIEY
MAAFLLKNKSAYESM*
back to top
Aliases
The feature 'Protein dpy-30-like' has the following synonyms
Synonym
dpy30-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR037856Sdc1/DPY30
IPR007858Dpy-30_motif
Vocabulary: cellular component
TermDefinition
GO:0000781chromosome, telomeric region
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005794Golgi apparatus
GO:0005802trans-Golgi network
GO:0035097histone methyltransferase complex
GO:0044666MLL3/4 complex
GO:0048188Set1C/COMPASS complex
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0018024histone-lysine N-methyltransferase activity
GO:0042802identical protein binding
GO:0042803protein homodimerization activity
Vocabulary: biological process
TermDefinition
GO:0006348chromatin silencing at telomere
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0016197endosomal transport
GO:0016569covalent chromatin modification
GO:0051568histone H3-K4 methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.890.10coord: 62..115
e-value: 2.9E-23
score: 83.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..32
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 16..32
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..15
IPR007858Dpy-30 motifPFAMPF05186Dpy-30coord: 69..109
e-value: 2.6E-16
score: 59.0
IPR037856Sdc1/DPY30PANTHERPTHR23356DPY30-RELATEDcoord: 31..111