SMED30006877

Overview
NameSMED30006877
Smed IDSMED30006877
Length (bp)486
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006877

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30006877SMESG000017276.1 Contig553newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30006877SMESG000017276.1 Contig553uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30006877SMESG000015393.1 Contig553newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30006877SMESG000015393.1 Contig553uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30006877SMESG000017276.1 dd_Smed_v4_1245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006877SMESG000017276.1 dd_Smed_v4_1245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30006877SMESG000017277.1 SMESG000017274.1 SMESG000017276.1 dd_Smed_v6_1245_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30006877SMESG000017276.1 dd_Smed_v4_1245_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006877SMESG000017276.1 dd_Smed_v4_1245_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30006877 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002264:46440..47910 -1601
v31.003911:53412..54594 -1555
v31.009148:20528..21252 +1541
v31.003911:13920..14936 -1530
Homology
BLAST of SMED30006877 vs. Ensembl Human
Match: TNKS2 (tankyrase 2 [Source:HGNC Symbol;Acc:HGNC:15677])

HSP 1 Score: 70.0922 bits (170), Expect = 5.670e-14
Identity = 37/116 (31.90%), Postives = 63/116 (54.31%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A ++G  E  +R    E +  +D   R+  P+H A   G  ++V+ L+++  +++A D   + P+H AC+ GH+  V LL+ H  D  A   WN  P+H A I+G  +   +LL+H
Sbjct:   31 ACRNGDVERVKRLVTPEKVNSRDTAGRKSTPLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 146          

HSP 2 Score: 67.781 bits (164), Expect = 2.854e-13
Identity = 36/116 (31.03%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A K+G  E  ++    + +  +D + R+  P+H A       +V+ L++H  D+ A DK  + P+H AC+ GH    +LL++H   +     W   P+H A  +G  E  KLLL+H
Sbjct:  499 AAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQH 614          

HSP 3 Score: 65.855 bits (159), Expect = 1.642e-12
Identity = 36/116 (31.03%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            + +SG+EE          +    +D R+  P+H A      +IV+LL++H  D+ A DK ++ P+H AC+ GH    +LL++H   + A+  W   P+H A  +   E   LLL +
Sbjct:  184 SARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSY 299          

HSP 4 Score: 55.8398 bits (133), Expect = 4.436e-9
Identity = 33/117 (28.21%), Postives = 56/117 (47.86%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +A K G     ++    + +  +D   R   P+H A    + E+ + L++H  D+ A DK  + P+H A + GH     LLI++   + A   W   P+H A  +G ++   LLL H
Sbjct:  651 DAAKKGCLARVKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAH 767          

HSP 5 Score: 53.9138 bits (128), Expect = 1.952e-8
Identity = 27/75 (36.00%), Postives = 38/75 (50.67%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL +  AD+         P+H AC  GH E+ +LL++H   +   D W   P+H A  KG     KLL++H  D
Sbjct:  543 EYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGAD 617          

HSP 6 Score: 52.7582 bits (125), Expect = 4.836e-8
Identity = 30/89 (33.71%), Postives = 42/89 (47.19%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHL 434
            EYL +  AD+         P+H A   GH ++  LLI++N  + A DKW   P+H A  KG +    LL+ H  D        Q P+ L
Sbjct:  696 EYLLQHGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQTPLDL 784          

HSP 7 Score: 52.7582 bits (125), Expect = 5.024e-8
Identity = 25/71 (35.21%), Postives = 36/71 (50.70%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            P+H AC  GH E+ +LL++H   + A D W   P+H A +K       LL+ +  D   L   N+  I LA
Sbjct:  247 PLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHNKSAIDLA 317          
BLAST of SMED30006877 vs. Ensembl Human
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 68.5514 bits (166), Expect = 1.527e-13
Identity = 34/87 (39.08%), Postives = 48/87 (55.17%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            R  +H A F+GH E+VKLL+    +I AFDK + R IH+A   GH   VKLL+ H  ++      +  P+H A   G    +K LL+
Sbjct:  141 RTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLD 227          

HSP 2 Score: 63.929 bits (154), Expect = 7.417e-12
Identity = 31/95 (32.63%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
             ++KD   RR IH A + GH E+VKLL+ H  ++   DK +  P+H A + G  + VK L++   D+     +   P+H+AC  G    +  L++
Sbjct:  169 FDKKD---RRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELID 260          

HSP 3 Score: 57.3806 bits (137), Expect = 1.448e-9
Identity = 35/108 (32.41%), Postives = 56/108 (51.85%), Query Frame = 3
Query:  117 RDFHLFSNAVKSGSEELFRRY-FKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            RD      A+ +G  +  R   FK+E +  +D + R P+H A + G AEI++LLI     + A D   + P+H A       AV++L++H  D+ A     Q P+H+A
Sbjct:    7 RDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIA 114          

HSP 4 Score: 54.299 bits (129), Expect = 1.307e-8
Identity = 31/111 (27.93%), Postives = 51/111 (45.95%), Query Frame = 3
Query:  153 GSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR--PIHLACIQGHSETIKLLLE 479
            G+ E+         +   D+  R P+H A F  H E ++LL+ HN  + + D     P+  A   G +  V++L+      E     N +   +HLAC +GH  +  L+LE
Sbjct:  802 GAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVS-SASAELTLQDNSKNTALHLACSKGHETSALLILE 911          

HSP 5 Score: 53.5286 bits (127), Expect = 2.625e-8
Identity = 34/115 (29.57%), Postives = 54/115 (46.96%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEY-LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            AV S SEE  +   K    +  +D + + P+H A      +  + L+    ++   D+     +H+A   GH   VKLL+    +I A    ++R IH A   GH E +KLL+ H
Sbjct:   81 AVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSH 195          

HSP 6 Score: 50.447 bits (119), Expect = 3.289e-7
Identity = 30/94 (31.91%), Postives = 49/94 (52.13%), Query Frame = 3
Query:  207 DADLR---RPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLL 476
            D+D R    P+H A + GH + +++L++   D++  +     P+  A  KGH   V +LI     I    +  +R PIH A   GHSE ++LL+
Sbjct:  544 DSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLI 637          

HSP 7 Score: 49.2914 bits (116), Expect = 7.114e-7
Identity = 30/97 (30.93%), Postives = 48/97 (49.48%), Query Frame = 3
Query:  204 KDADLRR-PIHQACFAGHAEIVKLLI---EHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            KD  L+R PIH A   GH+E ++LLI   E    ++  D     P+  +   GH+  V  L+    +++A   W +  +H   + GH E +  LL+H
Sbjct:  612 KDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQH 708          
BLAST of SMED30006877 vs. Ensembl Human
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 68.5514 bits (166), Expect = 1.527e-13
Identity = 34/87 (39.08%), Postives = 48/87 (55.17%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            R  +H A F+GH E+VKLL+    +I AFDK + R IH+A   GH   VKLL+ H  ++      +  P+H A   G    +K LL+
Sbjct:  141 RTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLD 227          

HSP 2 Score: 63.929 bits (154), Expect = 7.417e-12
Identity = 31/95 (32.63%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
             ++KD   RR IH A + GH E+VKLL+ H  ++   DK +  P+H A + G  + VK L++   D+     +   P+H+AC  G    +  L++
Sbjct:  169 FDKKD---RRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELID 260          

HSP 3 Score: 57.3806 bits (137), Expect = 1.448e-9
Identity = 35/108 (32.41%), Postives = 56/108 (51.85%), Query Frame = 3
Query:  117 RDFHLFSNAVKSGSEELFRRY-FKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            RD      A+ +G  +  R   FK+E +  +D + R P+H A + G AEI++LLI     + A D   + P+H A       AV++L++H  D+ A     Q P+H+A
Sbjct:    7 RDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIA 114          

HSP 4 Score: 54.299 bits (129), Expect = 1.307e-8
Identity = 31/111 (27.93%), Postives = 51/111 (45.95%), Query Frame = 3
Query:  153 GSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR--PIHLACIQGHSETIKLLLE 479
            G+ E+         +   D+  R P+H A F  H E ++LL+ HN  + + D     P+  A   G +  V++L+      E     N +   +HLAC +GH  +  L+LE
Sbjct:  802 GAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVS-SASAELTLQDNSKNTALHLACSKGHETSALLILE 911          

HSP 5 Score: 53.5286 bits (127), Expect = 2.625e-8
Identity = 34/115 (29.57%), Postives = 54/115 (46.96%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEY-LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            AV S SEE  +   K    +  +D + + P+H A      +  + L+    ++   D+     +H+A   GH   VKLL+    +I A    ++R IH A   GH E +KLL+ H
Sbjct:   81 AVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSH 195          

HSP 6 Score: 50.447 bits (119), Expect = 3.289e-7
Identity = 30/94 (31.91%), Postives = 49/94 (52.13%), Query Frame = 3
Query:  207 DADLR---RPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLL 476
            D+D R    P+H A + GH + +++L++   D++  +     P+  A  KGH   V +LI     I    +  +R PIH A   GHSE ++LL+
Sbjct:  544 DSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLI 637          

HSP 7 Score: 49.2914 bits (116), Expect = 7.114e-7
Identity = 30/97 (30.93%), Postives = 48/97 (49.48%), Query Frame = 3
Query:  204 KDADLRR-PIHQACFAGHAEIVKLLI---EHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            KD  L+R PIH A   GH+E ++LLI   E    ++  D     P+  +   GH+  V  L+    +++A   W +  +H   + GH E +  LL+H
Sbjct:  612 KDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQH 708          
BLAST of SMED30006877 vs. Ensembl Human
Match: TNKS (tankyrase [Source:HGNC Symbol;Acc:HGNC:11941])

HSP 1 Score: 68.5514 bits (166), Expect = 1.620e-13
Identity = 38/116 (32.76%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A +SG+EE          +    +D R+  P+H A       IV+LL++H  D+ A DK  + P+H AC+ GH    +LL++H   + A+  W   P+H A  +   E   LLL H
Sbjct:  342 AARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSH 457          

HSP 2 Score: 67.781 bits (164), Expect = 2.942e-13
Identity = 38/123 (30.89%), Postives = 60/123 (48.78%), Query Frame = 3
Query:  120 DFHLFSNAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            D+ L   A K+G  E  ++    + +  +D + R   P+H A       +V+ L+ H  D+ A DK  + P+H AC+ GH    +LL+ H   +     W   P+H A  +G  E  KLLL+H
Sbjct:  651 DYRLLE-ASKAGDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKH 772          

HSP 3 Score: 60.077 bits (144), Expect = 1.663e-10
Identity = 35/116 (30.17%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A ++G     +R      +  KD   R+  P+H A   G  ++V+ L++   ++ A D   + P+H AC+ GH+  V LL+    D  A   WN  P+H A I+G  +   +LL+H
Sbjct:  189 ACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 304          

HSP 4 Score: 57.7658 bits (138), Expect = 8.239e-10
Identity = 35/117 (29.91%), Postives = 56/117 (47.86%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +A K G     ++    E +  +D   R   P+H A    + E+ + L+EH  D+ A DK  + P+H A + GH     LLI++   + A   W   P+H A  +G ++   LLL H
Sbjct:  809 DAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAH 925          

HSP 5 Score: 55.0694 bits (131), Expect = 7.232e-9
Identity = 32/90 (35.56%), Postives = 42/90 (46.67%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            EYL    AD+         P+H A   GH +I  LLI++N  + A DKW   P+H A  KG +    LL+ H  D        Q P+ LA
Sbjct:  854 EYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLA 943          

HSP 6 Score: 54.299 bits (129), Expect = 1.372e-8
Identity = 27/75 (36.00%), Postives = 36/75 (48.00%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL    AD+         P+H AC  GH E+ +LL+ H   +   D W   P+H A  KG     KLL++H  D
Sbjct:  701 EYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGAD 775          

HSP 7 Score: 52.373 bits (124), Expect = 7.800e-8
Identity = 24/56 (42.86%), Postives = 31/56 (55.36%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GHAE+V LL+    D  A D WN  P+H A  KG      +L++H  D
Sbjct:  252 PLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAD 307          

HSP 8 Score: 51.6026 bits (122), Expect = 1.164e-7
Identity = 21/56 (37.50%), Postives = 30/56 (53.57%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GH E+ +LL++H   + A D W   P+H A +K       LL+ H  D
Sbjct:  405 PLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGAD 460          
BLAST of SMED30006877 vs. Ensembl Human
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 68.1662 bits (165), Expect = 2.223e-13
Identity = 34/87 (39.08%), Postives = 48/87 (55.17%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            R  +H A F+GH E+VKLL+    +I AFDK + R IH+A   GH   VKLL+ H  ++      +  P+H A   G    +K LL+
Sbjct:   85 RTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLD 171          

HSP 2 Score: 63.1586 bits (152), Expect = 1.079e-11
Identity = 31/95 (32.63%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
             ++KD   RR IH A + GH E+VKLL+ H  ++   DK +  P+H A + G  + VK L++   D+     +   P+H+AC  G    +  L++
Sbjct:  113 FDKKD---RRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELID 204          

HSP 3 Score: 49.6766 bits (117), Expect = 4.648e-7
Identity = 27/93 (29.03%), Postives = 45/93 (48.39%), Query Frame = 3
Query:  204 KDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +D + + P+H A      +  + L+    ++   D+     +H+A   GH   VKLL+    +I A    ++R IH A   GH E +KLL+ H
Sbjct:   47 RDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSH 139          

HSP 4 Score: 49.6766 bits (117), Expect = 4.648e-7
Identity = 30/94 (31.91%), Postives = 49/94 (52.13%), Query Frame = 3
Query:  207 DADLR---RPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLL 476
            D+D R    P+H A + GH + +++L++   D++  +     P+  A  KGH   V +LI     I    +  +R PIH A   GHSE ++LL+
Sbjct:  488 DSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLI 581          

HSP 5 Score: 48.9062 bits (115), Expect = 9.676e-7
Identity = 30/97 (30.93%), Postives = 48/97 (49.48%), Query Frame = 3
Query:  204 KDADLRR-PIHQACFAGHAEIVKLLI---EHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            KD  L+R PIH A   GH+E ++LLI   E    ++  D     P+  +   GH+  V  L+    +++A   W +  +H   + GH E +  LL+H
Sbjct:  556 KDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQH 652          
BLAST of SMED30006877 vs. Ensembl Celegans
Match: trp-4 (TRP (Transient receptor potential) channel family [Source:UniProtKB/TrEMBL;Acc:Q9GRV5])

HSP 1 Score: 62.003 bits (149), Expect = 1.189e-11
Identity = 26/85 (30.59%), Postives = 50/85 (58.82%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            P+ +AC  GH+ +  +L++H+  I+ FD+     +H A   GH + V LL++HK  + + +   + P+HLA   GH + + +L++
Sbjct:  890 PLLEACARGHSGVANILLKHHARIDVFDEMGRTALHLAAFNGHLSLVHLLLQHKAFVNSKSKTGEAPLHLAAQHGHVKVVNVLVQ 974          

HSP 2 Score: 56.6102 bits (135), Expect = 9.484e-10
Identity = 28/86 (32.56%), Postives = 46/86 (53.49%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDK-WNIRPIHYACNKGHSAAVKLLIEHKCDIE-ALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H A  +GH  +V++L+     ++A     N+ P+H A  +GH A V +L+      + A  W  + P+HLA   GH E + LL+
Sbjct: 1208 PLHLAAQSGHDSLVRMLLNQGVQVDATSTTMNVIPLHLAAQQGHIAVVGMLLSRSTQQQHAKDWRGRTPLHLAAQNGHYEMVSLLI 1293          

HSP 3 Score: 54.6842 bits (130), Expect = 4.464e-9
Identity = 31/93 (33.33%), Postives = 44/93 (47.31%), Query Frame = 3
Query:  204 KDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            KD   R P+H A   GH E+V LLI    +I   D+     +H+A   GH + VKL I+   D  A     + P+  A    H E ++ LL+ 
Sbjct: 1269 KDWRGRTPLHLAAQNGHYEMVSLLIAQGSNINVMDQNGWTGLHFATRAGHLSVVKLFIDSSADPLAETKEGKVPLCFAAAHNHIECLRFLLKQ 1361          

HSP 4 Score: 50.8322 bits (120), Expect = 7.820e-8
Identity = 28/87 (32.18%), Postives = 42/87 (48.28%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIE-HKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            R  +H A F GH  +V LL++H   + +  K    P+H A   GH   V +L++ H   +EA+   NQ  +H A   G     + LL
Sbjct:  921 RTALHLAAFNGHLSLVHLLLQHKAFVNSKSKTGEAPLHLAAQHGHVKVVNVLVQDHGAALEAITLDNQTALHFAAKFGQLAVSQTLL 1007          
BLAST of SMED30006877 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 55.8398 bits (133), Expect = 1.920e-9
Identity = 29/97 (29.90%), Postives = 49/97 (50.52%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            ++ +  DL  P+H A  +GH ++V LL+     I A  K  + P+H A    H  A + L+ H+  ++ +      P+H+A   GH    KLLL+ +
Sbjct:  286 IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRS 382          

HSP 2 Score: 55.0694 bits (131), Expect = 3.575e-9
Identity = 29/89 (32.58%), Postives = 47/89 (52.81%), Query Frame = 3
Query:  213 DLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            +L+ P+H A   G+ +IV LL++   +  A  + N  P+H A  +G      +L++H  D   L      P+HLA   G+ E ++LLLE
Sbjct:  490 ELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLE 578          

HSP 3 Score: 52.7582 bits (125), Expect = 1.884e-8
Identity = 27/90 (30.00%), Postives = 43/90 (47.78%), Query Frame = 3
Query:  213 DLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            D   P+H A   GH  + KLL++ + D  +       P+H AC K     V+LL++++  IEA       P+H+A   G    +  LL+ 
Sbjct:  358 DYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ 447          

HSP 4 Score: 50.447 bits (119), Expect = 1.058e-7
Identity = 26/87 (29.89%), Postives = 46/87 (52.87%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P+H A  A   ++V++LI +   ++A  +    P+H A   G++  V LL++   +  A    N  P+H+A  +G  E   +LL+HN
Sbjct:  461 PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHN 547          

HSP 5 Score: 48.521 bits (114), Expect = 5.652e-7
Identity = 24/85 (28.24%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  228 IHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +H A   GH+E+V+ LI+    ++A  +     +H A   G S  V +L+E+  ++   +     P+++A  + H E +K LL+H
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH 154          

HSP 6 Score: 48.1358 bits (113), Expect = 7.517e-7
Identity = 23/86 (26.74%), Postives = 43/86 (50.00%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A    H +  + L+ H   ++      + P+H A + GH    KLL++   D  + A     P+H+AC +   + ++LLL++
Sbjct:  329 PLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKY 414          

HSP 7 Score: 46.9802 bits (110), Expect = 1.607e-6
Identity = 23/83 (27.71%), Postives = 41/83 (49.40%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLL 473
            P+H AC  G   +VK L+E+  D+    + +  P+H A  +GH+  V+ L+E+           Q P+ +A   G+   ++ L
Sbjct:  725 PLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 8 Score: 46.9802 bits (110), Expect = 1.962e-6
Identity = 25/86 (29.07%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A   G  E+  +L++HN D     K    P+H A   G+   V+LL+E    ++        P+H+A    + +   LLLE+
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLEN 612          

HSP 9 Score: 46.595 bits (109), Expect = 2.418e-6
Identity = 23/85 (27.06%), Postives = 41/85 (48.24%), Query Frame = 3
Query:  228 IHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +H      H  + ++L  +  +I +       P+H AC+ G    VK L+E+  D+      +  P+H A  QGH+  ++ LLE+
Sbjct:  693 MHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLEN 777          

HSP 10 Score: 45.8246 bits (107), Expect = 4.395e-6
Identity = 24/84 (28.57%), Postives = 40/84 (47.62%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H A   GH  + +LL+E   ++    + NI P+H A   G +    LL+     I++       P+H A   GH + + LL+
Sbjct:  230 PLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV 313          

HSP 11 Score: 45.0542 bits (105), Expect = 7.910e-6
Identity = 25/86 (29.07%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A    + ++  LL+E+    +A  K    P+H A  K        L++ K D  A +     P+HL+  +GH E   LL+E+
Sbjct:  593 PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIEN 678          
BLAST of SMED30006877 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 55.8398 bits (133), Expect = 1.920e-9
Identity = 29/97 (29.90%), Postives = 49/97 (50.52%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            ++ +  DL  P+H A  +GH ++V LL+     I A  K  + P+H A    H  A + L+ H+  ++ +      P+H+A   GH    KLLL+ +
Sbjct:  286 IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRS 382          

HSP 2 Score: 55.0694 bits (131), Expect = 3.575e-9
Identity = 29/89 (32.58%), Postives = 47/89 (52.81%), Query Frame = 3
Query:  213 DLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            +L+ P+H A   G+ +IV LL++   +  A  + N  P+H A  +G      +L++H  D   L      P+HLA   G+ E ++LLLE
Sbjct:  490 ELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLE 578          

HSP 3 Score: 52.7582 bits (125), Expect = 1.884e-8
Identity = 27/90 (30.00%), Postives = 43/90 (47.78%), Query Frame = 3
Query:  213 DLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            D   P+H A   GH  + KLL++ + D  +       P+H AC K     V+LL++++  IEA       P+H+A   G    +  LL+ 
Sbjct:  358 DYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ 447          

HSP 4 Score: 50.447 bits (119), Expect = 1.058e-7
Identity = 26/87 (29.89%), Postives = 46/87 (52.87%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P+H A  A   ++V++LI +   ++A  +    P+H A   G++  V LL++   +  A    N  P+H+A  +G  E   +LL+HN
Sbjct:  461 PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHN 547          

HSP 5 Score: 48.521 bits (114), Expect = 5.652e-7
Identity = 24/85 (28.24%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  228 IHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +H A   GH+E+V+ LI+    ++A  +     +H A   G S  V +L+E+  ++   +     P+++A  + H E +K LL+H
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH 154          

HSP 6 Score: 48.1358 bits (113), Expect = 7.517e-7
Identity = 23/86 (26.74%), Postives = 43/86 (50.00%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A    H +  + L+ H   ++      + P+H A + GH    KLL++   D  + A     P+H+AC +   + ++LLL++
Sbjct:  329 PLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKY 414          

HSP 7 Score: 46.9802 bits (110), Expect = 1.607e-6
Identity = 23/83 (27.71%), Postives = 41/83 (49.40%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLL 473
            P+H AC  G   +VK L+E+  D+    + +  P+H A  +GH+  V+ L+E+           Q P+ +A   G+   ++ L
Sbjct:  725 PLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 8 Score: 46.9802 bits (110), Expect = 1.962e-6
Identity = 25/86 (29.07%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A   G  E+  +L++HN D     K    P+H A   G+   V+LL+E    ++        P+H+A    + +   LLLE+
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLEN 612          

HSP 9 Score: 46.595 bits (109), Expect = 2.418e-6
Identity = 23/85 (27.06%), Postives = 41/85 (48.24%), Query Frame = 3
Query:  228 IHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +H      H  + ++L  +  +I +       P+H AC+ G    VK L+E+  D+      +  P+H A  QGH+  ++ LLE+
Sbjct:  693 MHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLEN 777          

HSP 10 Score: 45.8246 bits (107), Expect = 4.395e-6
Identity = 24/84 (28.57%), Postives = 40/84 (47.62%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H A   GH  + +LL+E   ++    + NI P+H A   G +    LL+     I++       P+H A   GH + + LL+
Sbjct:  230 PLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV 313          

HSP 11 Score: 45.0542 bits (105), Expect = 7.910e-6
Identity = 25/86 (29.07%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A    + ++  LL+E+    +A  K    P+H A  K        L++ K D  A +     P+HL+  +GH E   LL+E+
Sbjct:  593 PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIEN 678          
BLAST of SMED30006877 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 55.4546 bits (132), Expect = 2.176e-9
Identity = 29/97 (29.90%), Postives = 49/97 (50.52%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            ++ +  DL  P+H A  +GH ++V LL+     I A  K  + P+H A    H  A + L+ H+  ++ +      P+H+A   GH    KLLL+ +
Sbjct:  286 IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRS 382          

HSP 2 Score: 54.6842 bits (130), Expect = 4.051e-9
Identity = 29/89 (32.58%), Postives = 47/89 (52.81%), Query Frame = 3
Query:  213 DLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            +L+ P+H A   G+ +IV LL++   +  A  + N  P+H A  +G      +L++H  D   L      P+HLA   G+ E ++LLLE
Sbjct:  490 ELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLE 578          

HSP 3 Score: 52.7582 bits (125), Expect = 2.175e-8
Identity = 27/90 (30.00%), Postives = 43/90 (47.78%), Query Frame = 3
Query:  213 DLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            D   P+H A   GH  + KLL++ + D  +       P+H AC K     V+LL++++  IEA       P+H+A   G    +  LL+ 
Sbjct:  358 DYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ 447          

HSP 4 Score: 50.447 bits (119), Expect = 1.199e-7
Identity = 26/87 (29.89%), Postives = 46/87 (52.87%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P+H A  A   ++V++LI +   ++A  +    P+H A   G++  V LL++   +  A    N  P+H+A  +G  E   +LL+HN
Sbjct:  461 PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHN 547          

HSP 5 Score: 48.521 bits (114), Expect = 6.279e-7
Identity = 24/85 (28.24%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  228 IHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +H A   GH+E+V+ LI+    ++A  +     +H A   G S  V +L+E+  ++   +     P+++A  + H E +K LL+H
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH 154          

HSP 6 Score: 48.1358 bits (113), Expect = 8.194e-7
Identity = 23/86 (26.74%), Postives = 43/86 (50.00%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A    H +  + L+ H   ++      + P+H A + GH    KLL++   D  + A     P+H+AC +   + ++LLL++
Sbjct:  329 PLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKY 414          

HSP 7 Score: 46.9802 bits (110), Expect = 1.719e-6
Identity = 23/83 (27.71%), Postives = 41/83 (49.40%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLL 473
            P+H AC  G   +VK L+E+  D+    + +  P+H A  +GH+  V+ L+E+           Q P+ +A   G+   ++ L
Sbjct:  725 PLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 8 Score: 46.595 bits (109), Expect = 2.180e-6
Identity = 25/86 (29.07%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A   G  E+  +L++HN D     K    P+H A   G+   V+LL+E    ++        P+H+A    + +   LLLE+
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLEN 612          

HSP 9 Score: 46.595 bits (109), Expect = 2.660e-6
Identity = 23/85 (27.06%), Postives = 41/85 (48.24%), Query Frame = 3
Query:  228 IHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +H      H  + ++L  +  +I +       P+H AC+ G    VK L+E+  D+      +  P+H A  QGH+  ++ LLE+
Sbjct:  693 MHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLEN 777          

HSP 10 Score: 45.8246 bits (107), Expect = 4.975e-6
Identity = 24/84 (28.57%), Postives = 40/84 (47.62%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H A   GH  + +LL+E   ++    + NI P+H A   G +    LL+     I++       P+H A   GH + + LL+
Sbjct:  230 PLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV 313          

HSP 11 Score: 45.4394 bits (106), Expect = 5.735e-6
Identity = 24/86 (27.91%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H +   GH EI  LLIE+  D+ A     +  +H    + H    ++L  +  +I +       P+H+AC  G    +K L+E+
Sbjct:  659 PLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVEN 744          

HSP 12 Score: 45.0542 bits (105), Expect = 8.702e-6
Identity = 25/86 (29.07%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A    + ++  LL+E+    +A  K    P+H A  K        L++ K D  A +     P+HL+  +GH E   LL+E+
Sbjct:  593 PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIEN 678          
BLAST of SMED30006877 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 55.4546 bits (132), Expect = 2.176e-9
Identity = 29/97 (29.90%), Postives = 49/97 (50.52%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            ++ +  DL  P+H A  +GH ++V LL+     I A  K  + P+H A    H  A + L+ H+  ++ +      P+H+A   GH    KLLL+ +
Sbjct:  286 IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRS 382          

HSP 2 Score: 54.6842 bits (130), Expect = 4.051e-9
Identity = 29/89 (32.58%), Postives = 47/89 (52.81%), Query Frame = 3
Query:  213 DLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            +L+ P+H A   G+ +IV LL++   +  A  + N  P+H A  +G      +L++H  D   L      P+HLA   G+ E ++LLLE
Sbjct:  490 ELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLE 578          

HSP 3 Score: 52.7582 bits (125), Expect = 2.175e-8
Identity = 27/90 (30.00%), Postives = 43/90 (47.78%), Query Frame = 3
Query:  213 DLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            D   P+H A   GH  + KLL++ + D  +       P+H AC K     V+LL++++  IEA       P+H+A   G    +  LL+ 
Sbjct:  358 DYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ 447          

HSP 4 Score: 50.447 bits (119), Expect = 1.199e-7
Identity = 26/87 (29.89%), Postives = 46/87 (52.87%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P+H A  A   ++V++LI +   ++A  +    P+H A   G++  V LL++   +  A    N  P+H+A  +G  E   +LL+HN
Sbjct:  461 PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHN 547          

HSP 5 Score: 48.521 bits (114), Expect = 6.279e-7
Identity = 24/85 (28.24%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  228 IHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +H A   GH+E+V+ LI+    ++A  +     +H A   G S  V +L+E+  ++   +     P+++A  + H E +K LL+H
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH 154          

HSP 6 Score: 48.1358 bits (113), Expect = 8.194e-7
Identity = 23/86 (26.74%), Postives = 43/86 (50.00%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A    H +  + L+ H   ++      + P+H A + GH    KLL++   D  + A     P+H+AC +   + ++LLL++
Sbjct:  329 PLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKY 414          

HSP 7 Score: 46.9802 bits (110), Expect = 1.719e-6
Identity = 23/83 (27.71%), Postives = 41/83 (49.40%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLL 473
            P+H AC  G   +VK L+E+  D+    + +  P+H A  +GH+  V+ L+E+           Q P+ +A   G+   ++ L
Sbjct:  725 PLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 8 Score: 46.595 bits (109), Expect = 2.180e-6
Identity = 25/86 (29.07%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A   G  E+  +L++HN D     K    P+H A   G+   V+LL+E    ++        P+H+A    + +   LLLE+
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLEN 612          

HSP 9 Score: 46.595 bits (109), Expect = 2.660e-6
Identity = 23/85 (27.06%), Postives = 41/85 (48.24%), Query Frame = 3
Query:  228 IHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +H      H  + ++L  +  +I +       P+H AC+ G    VK L+E+  D+      +  P+H A  QGH+  ++ LLE+
Sbjct:  693 MHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLEN 777          

HSP 10 Score: 45.8246 bits (107), Expect = 4.975e-6
Identity = 24/84 (28.57%), Postives = 40/84 (47.62%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H A   GH  + +LL+E   ++    + NI P+H A   G +    LL+     I++       P+H A   GH + + LL+
Sbjct:  230 PLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV 313          

HSP 11 Score: 45.4394 bits (106), Expect = 5.735e-6
Identity = 24/86 (27.91%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H +   GH EI  LLIE+  D+ A     +  +H    + H    ++L  +  +I +       P+H+AC  G    +K L+E+
Sbjct:  659 PLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVEN 744          

HSP 12 Score: 45.0542 bits (105), Expect = 8.702e-6
Identity = 25/86 (29.07%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A    + ++  LL+E+    +A  K    P+H A  K        L++ K D  A +     P+HL+  +GH E   LL+E+
Sbjct:  593 PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIEN 678          
BLAST of SMED30006877 vs. Ensembl Fly
Match: mask (gene:FBgn0043884 transcript:FBtr0345261)

HSP 1 Score: 66.2402 bits (160), Expect = 5.418e-13
Identity = 41/120 (34.17%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  129 LFSNAVKSGSEELFRRYF--KEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            L S A  +G  EL +         +E K      P+ +A  AGH +IVKLL+ HN D+ A       P+ +AC  G    VK+L++H  ++E        P+  A   GH E  K+LLEH
Sbjct:  210 LLSMACSAGYYELAQVLLAMSAAQVEDKGQKDSTPLMEAASAGHLDIVKLLLNHNADVNAHCATGNTPLMFACAGGQVDVVKVLLKHGANVEEQNENGHTPLMEAASAGHVEVAKVLLEH 329          

HSP 2 Score: 59.3066 bits (142), Expect = 1.430e-10
Identity = 31/81 (38.27%), Postives = 45/81 (55.56%), Query Frame = 3
Query:  237 ACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQ-RPIHLACIQGHSETIKLLL 476
            AC  GH E+V+LLI    +IE  DK    P+  A   GH   V +L++H  ++EA +   +  P+ LAC  G  E ++LLL
Sbjct: 1942 ACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVVDILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLL 2022          

HSP 3 Score: 57.7658 bits (138), Expect = 5.311e-10
Identity = 34/97 (35.05%), Postives = 50/97 (51.55%), Query Frame = 3
Query:  198 ERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAF--DKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLLE 479
            E ++     P+  A   G+  I+KLL+ H  +I +    K  I P+  A   GH+ AVKLL++   DI A    N+   + LAC QG  E + LLL+
Sbjct: 2029 EHRNVSDYTPLSLAASGGYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQGSDINAQIETNRNTALTLACFQGRHEVVSLLLD 2125          

HSP 4 Score: 52.7582 bits (125), Expect = 2.317e-8
Identity = 25/86 (29.07%), Postives = 48/86 (55.81%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALA-WWNQRPIHLACIQGHSETIKLLLE 479
            P+  AC  G  ++VK+L++H  ++E  ++    P+  A + GH    K+L+EH   I   +  + +  + LAC +GH + ++ LL+
Sbjct:  277 PLMFACAGGQVDVVKVLLKHGANVEEQNENGHTPLMEAASAGHVEVAKVLLEHGAGINTHSNEFKESALTLACYKGHLDMVRFLLQ 362          

HSP 5 Score: 50.0618 bits (118), Expect = 1.869e-7
Identity = 35/116 (30.17%), Postives = 57/116 (49.14%), Query Frame = 3
Query:  141 AVKSGSEELFRRYF-KEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEA-FDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A   G EEL      +   +E +D     P+  A  AGH ++V +L++H+ ++EA  ++    P+  AC+ G    V+LL+    + E     +  P+ LA   G+   IKLLL H
Sbjct: 1942 ACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVVDILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAASGGYVNIIKLLLSH 2057          

HSP 6 Score: 48.521 bits (114), Expect = 8.323e-7
Identity = 28/96 (29.17%), Postives = 48/96 (50.00%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAF-DKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            +E ++ +   P+ +A  AGH E+ K+L+EH   I    +++    +  AC KGH   V+ L++   D E         +  A + GH E  +LLL+
Sbjct:  300 VEEQNENGHTPLMEAASAGHVEVAKVLLEHGAGINTHSNEFKESALTLACYKGHLDMVRFLLQAGADQEHKTDEMHTALMEASMDGHVEVARLLLD 395          

HSP 7 Score: 48.1358 bits (113), Expect = 1.107e-6
Identity = 25/85 (29.41%), Postives = 41/85 (48.24%), Query Frame = 3
Query:  234 QACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLLEHN 485
             AC  GH +   +L+ +  ++E   +    P+  AC  GH   VK LI+   ++      N    + LAC  GH   ++LLL++N
Sbjct:  543 HACENGHTDAAGVLLSYGAELEHESEGGRTPLMKACRAGHLCTVKFLIQKGANVNKQTTSNDHTALSLACAGGHQSVVELLLKNN 627          

HSP 8 Score: 47.7506 bits (112), Expect = 1.313e-6
Identity = 22/85 (25.88%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            P+ +A   GH ++V  L++   ++ A  +     + +AC  GH+ A  +L+ +  ++E  +   + P+  AC  GH  T+K L++
Sbjct:  507 PLMEASQEGHTDLVSFLLKKKANVHAETQTGDTALTHACENGHTDAAGVLLSYGAELEHESEGGRTPLMKACRAGHLCTVKFLIQ 591          

HSP 9 Score: 46.2098 bits (108), Expect = 3.839e-6
Identity = 26/88 (29.55%), Postives = 46/88 (52.27%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEAL--AWWNQRPIHLACIQGHSETIKLLLEH 482
            P+  AC  G  E+V+LL+    + E  +  +  P+  A + G+   +KLL+ H  +I +   +     P+ LA + GH+  +KLLL+ 
Sbjct: 2005 PLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAASGGYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQ 2092          
BLAST of SMED30006877 vs. Ensembl Fly
Match: mask (gene:FBgn0043884 transcript:FBtr0334942)

HSP 1 Score: 66.2402 bits (160), Expect = 5.419e-13
Identity = 41/120 (34.17%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  129 LFSNAVKSGSEELFRRYF--KEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            L S A  +G  EL +         +E K      P+ +A  AGH +IVKLL+ HN D+ A       P+ +AC  G    VK+L++H  ++E        P+  A   GH E  K+LLEH
Sbjct:  223 LLSMACSAGYYELAQVLLAMSAAQVEDKGQKDSTPLMEAASAGHLDIVKLLLNHNADVNAHCATGNTPLMFACAGGQVDVVKVLLKHGANVEEQNENGHTPLMEAASAGHVEVAKVLLEH 342          

HSP 2 Score: 59.3066 bits (142), Expect = 1.430e-10
Identity = 31/81 (38.27%), Postives = 45/81 (55.56%), Query Frame = 3
Query:  237 ACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQ-RPIHLACIQGHSETIKLLL 476
            AC  GH E+V+LLI    +IE  DK    P+  A   GH   V +L++H  ++EA +   +  P+ LAC  G  E ++LLL
Sbjct: 1955 ACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVVDILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLL 2035          

HSP 3 Score: 57.7658 bits (138), Expect = 5.311e-10
Identity = 34/97 (35.05%), Postives = 50/97 (51.55%), Query Frame = 3
Query:  198 ERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAF--DKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLLE 479
            E ++     P+  A   G+  I+KLL+ H  +I +    K  I P+  A   GH+ AVKLL++   DI A    N+   + LAC QG  E + LLL+
Sbjct: 2042 EHRNVSDYTPLSLAASGGYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQGSDINAQIETNRNTALTLACFQGRHEVVSLLLD 2138          

HSP 4 Score: 52.7582 bits (125), Expect = 2.317e-8
Identity = 25/86 (29.07%), Postives = 48/86 (55.81%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALA-WWNQRPIHLACIQGHSETIKLLLE 479
            P+  AC  G  ++VK+L++H  ++E  ++    P+  A + GH    K+L+EH   I   +  + +  + LAC +GH + ++ LL+
Sbjct:  290 PLMFACAGGQVDVVKVLLKHGANVEEQNENGHTPLMEAASAGHVEVAKVLLEHGAGINTHSNEFKESALTLACYKGHLDMVRFLLQ 375          

HSP 5 Score: 50.0618 bits (118), Expect = 1.869e-7
Identity = 35/116 (30.17%), Postives = 57/116 (49.14%), Query Frame = 3
Query:  141 AVKSGSEELFRRYF-KEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEA-FDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A   G EEL      +   +E +D     P+  A  AGH ++V +L++H+ ++EA  ++    P+  AC+ G    V+LL+    + E     +  P+ LA   G+   IKLLL H
Sbjct: 1955 ACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVVDILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAASGGYVNIIKLLLSH 2070          

HSP 6 Score: 48.521 bits (114), Expect = 8.324e-7
Identity = 28/96 (29.17%), Postives = 48/96 (50.00%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAF-DKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            +E ++ +   P+ +A  AGH E+ K+L+EH   I    +++    +  AC KGH   V+ L++   D E         +  A + GH E  +LLL+
Sbjct:  313 VEEQNENGHTPLMEAASAGHVEVAKVLLEHGAGINTHSNEFKESALTLACYKGHLDMVRFLLQAGADQEHKTDEMHTALMEASMDGHVEVARLLLD 408          

HSP 7 Score: 48.1358 bits (113), Expect = 1.107e-6
Identity = 25/85 (29.41%), Postives = 41/85 (48.24%), Query Frame = 3
Query:  234 QACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLLEHN 485
             AC  GH +   +L+ +  ++E   +    P+  AC  GH   VK LI+   ++      N    + LAC  GH   ++LLL++N
Sbjct:  556 HACENGHTDAAGVLLSYGAELEHESEGGRTPLMKACRAGHLCTVKFLIQKGANVNKQTTSNDHTALSLACAGGHQSVVELLLKNN 640          

HSP 8 Score: 47.7506 bits (112), Expect = 1.314e-6
Identity = 22/85 (25.88%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            P+ +A   GH ++V  L++   ++ A  +     + +AC  GH+ A  +L+ +  ++E  +   + P+  AC  GH  T+K L++
Sbjct:  520 PLMEASQEGHTDLVSFLLKKKANVHAETQTGDTALTHACENGHTDAAGVLLSYGAELEHESEGGRTPLMKACRAGHLCTVKFLIQ 604          

HSP 9 Score: 46.2098 bits (108), Expect = 3.840e-6
Identity = 26/88 (29.55%), Postives = 46/88 (52.27%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEAL--AWWNQRPIHLACIQGHSETIKLLLEH 482
            P+  AC  G  E+V+LL+    + E  +  +  P+  A + G+   +KLL+ H  +I +   +     P+ LA + GH+  +KLLL+ 
Sbjct: 2018 PLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAASGGYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQ 2105          
BLAST of SMED30006877 vs. Ensembl Fly
Match: mask (gene:FBgn0043884 transcript:FBtr0334943)

HSP 1 Score: 66.2402 bits (160), Expect = 5.432e-13
Identity = 41/120 (34.17%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  129 LFSNAVKSGSEELFRRYF--KEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            L S A  +G  EL +         +E K      P+ +A  AGH +IVKLL+ HN D+ A       P+ +AC  G    VK+L++H  ++E        P+  A   GH E  K+LLEH
Sbjct:  588 LLSMACSAGYYELAQVLLAMSAAQVEDKGQKDSTPLMEAASAGHLDIVKLLLNHNADVNAHCATGNTPLMFACAGGQVDVVKVLLKHGANVEEQNENGHTPLMEAASAGHVEVAKVLLEH 707          

HSP 2 Score: 59.3066 bits (142), Expect = 1.434e-10
Identity = 31/81 (38.27%), Postives = 45/81 (55.56%), Query Frame = 3
Query:  237 ACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQ-RPIHLACIQGHSETIKLLL 476
            AC  GH E+V+LLI    +IE  DK    P+  A   GH   V +L++H  ++EA +   +  P+ LAC  G  E ++LLL
Sbjct: 2319 ACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVVDILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLL 2399          

HSP 3 Score: 57.7658 bits (138), Expect = 5.324e-10
Identity = 34/97 (35.05%), Postives = 50/97 (51.55%), Query Frame = 3
Query:  198 ERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAF--DKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLLE 479
            E ++     P+  A   G+  I+KLL+ H  +I +    K  I P+  A   GH+ AVKLL++   DI A    N+   + LAC QG  E + LLL+
Sbjct: 2406 EHRNVSDYTPLSLAASGGYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQGSDINAQIETNRNTALTLACFQGRHEVVSLLLD 2502          

HSP 4 Score: 52.7582 bits (125), Expect = 2.323e-8
Identity = 25/86 (29.07%), Postives = 48/86 (55.81%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALA-WWNQRPIHLACIQGHSETIKLLLE 479
            P+  AC  G  ++VK+L++H  ++E  ++    P+  A + GH    K+L+EH   I   +  + +  + LAC +GH + ++ LL+
Sbjct:  655 PLMFACAGGQVDVVKVLLKHGANVEEQNENGHTPLMEAASAGHVEVAKVLLEHGAGINTHSNEFKESALTLACYKGHLDMVRFLLQ 740          

HSP 5 Score: 50.0618 bits (118), Expect = 1.874e-7
Identity = 35/116 (30.17%), Postives = 57/116 (49.14%), Query Frame = 3
Query:  141 AVKSGSEELFRRYF-KEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEA-FDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A   G EEL      +   +E +D     P+  A  AGH ++V +L++H+ ++EA  ++    P+  AC+ G    V+LL+    + E     +  P+ LA   G+   IKLLL H
Sbjct: 2319 ACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVVDILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAASGGYVNIIKLLLSH 2434          

HSP 6 Score: 48.521 bits (114), Expect = 8.344e-7
Identity = 28/96 (29.17%), Postives = 48/96 (50.00%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAF-DKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            +E ++ +   P+ +A  AGH E+ K+L+EH   I    +++    +  AC KGH   V+ L++   D E         +  A + GH E  +LLL+
Sbjct:  678 VEEQNENGHTPLMEAASAGHVEVAKVLLEHGAGINTHSNEFKESALTLACYKGHLDMVRFLLQAGADQEHKTDEMHTALMEASMDGHVEVARLLLD 773          

HSP 7 Score: 48.1358 bits (113), Expect = 1.110e-6
Identity = 25/85 (29.41%), Postives = 41/85 (48.24%), Query Frame = 3
Query:  234 QACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLLEHN 485
             AC  GH +   +L+ +  ++E   +    P+  AC  GH   VK LI+   ++      N    + LAC  GH   ++LLL++N
Sbjct:  921 HACENGHTDAAGVLLSYGAELEHESEGGRTPLMKACRAGHLCTVKFLIQKGANVNKQTTSNDHTALSLACAGGHQSVVELLLKNN 1005          

HSP 8 Score: 47.7506 bits (112), Expect = 1.317e-6
Identity = 22/85 (25.88%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            P+ +A   GH ++V  L++   ++ A  +     + +AC  GH+ A  +L+ +  ++E  +   + P+  AC  GH  T+K L++
Sbjct:  885 PLMEASQEGHTDLVSFLLKKKANVHAETQTGDTALTHACENGHTDAAGVLLSYGAELEHESEGGRTPLMKACRAGHLCTVKFLIQ 969          

HSP 9 Score: 46.2098 bits (108), Expect = 3.849e-6
Identity = 26/88 (29.55%), Postives = 46/88 (52.27%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEAL--AWWNQRPIHLACIQGHSETIKLLLEH 482
            P+  AC  G  E+V+LL+    + E  +  +  P+  A + G+   +KLL+ H  +I +   +     P+ LA + GH+  +KLLL+ 
Sbjct: 2382 PLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAASGGYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQ 2469          
BLAST of SMED30006877 vs. Ensembl Fly
Match: mask (gene:FBgn0043884 transcript:FBtr0084562)

HSP 1 Score: 66.2402 bits (160), Expect = 5.432e-13
Identity = 41/120 (34.17%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  129 LFSNAVKSGSEELFRRYF--KEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            L S A  +G  EL +         +E K      P+ +A  AGH +IVKLL+ HN D+ A       P+ +AC  G    VK+L++H  ++E        P+  A   GH E  K+LLEH
Sbjct:  588 LLSMACSAGYYELAQVLLAMSAAQVEDKGQKDSTPLMEAASAGHLDIVKLLLNHNADVNAHCATGNTPLMFACAGGQVDVVKVLLKHGANVEEQNENGHTPLMEAASAGHVEVAKVLLEH 707          

HSP 2 Score: 59.3066 bits (142), Expect = 1.434e-10
Identity = 31/81 (38.27%), Postives = 45/81 (55.56%), Query Frame = 3
Query:  237 ACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQ-RPIHLACIQGHSETIKLLL 476
            AC  GH E+V+LLI    +IE  DK    P+  A   GH   V +L++H  ++EA +   +  P+ LAC  G  E ++LLL
Sbjct: 2320 ACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVVDILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLL 2400          

HSP 3 Score: 57.7658 bits (138), Expect = 5.324e-10
Identity = 34/97 (35.05%), Postives = 50/97 (51.55%), Query Frame = 3
Query:  198 ERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAF--DKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLLE 479
            E ++     P+  A   G+  I+KLL+ H  +I +    K  I P+  A   GH+ AVKLL++   DI A    N+   + LAC QG  E + LLL+
Sbjct: 2407 EHRNVSDYTPLSLAASGGYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQGSDINAQIETNRNTALTLACFQGRHEVVSLLLD 2503          

HSP 4 Score: 52.7582 bits (125), Expect = 2.323e-8
Identity = 25/86 (29.07%), Postives = 48/86 (55.81%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALA-WWNQRPIHLACIQGHSETIKLLLE 479
            P+  AC  G  ++VK+L++H  ++E  ++    P+  A + GH    K+L+EH   I   +  + +  + LAC +GH + ++ LL+
Sbjct:  655 PLMFACAGGQVDVVKVLLKHGANVEEQNENGHTPLMEAASAGHVEVAKVLLEHGAGINTHSNEFKESALTLACYKGHLDMVRFLLQ 740          

HSP 5 Score: 50.0618 bits (118), Expect = 1.874e-7
Identity = 35/116 (30.17%), Postives = 57/116 (49.14%), Query Frame = 3
Query:  141 AVKSGSEELFRRYF-KEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEA-FDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A   G EEL      +   +E +D     P+  A  AGH ++V +L++H+ ++EA  ++    P+  AC+ G    V+LL+    + E     +  P+ LA   G+   IKLLL H
Sbjct: 2320 ACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVVDILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAASGGYVNIIKLLLSH 2435          

HSP 6 Score: 48.521 bits (114), Expect = 8.344e-7
Identity = 28/96 (29.17%), Postives = 48/96 (50.00%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAF-DKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            +E ++ +   P+ +A  AGH E+ K+L+EH   I    +++    +  AC KGH   V+ L++   D E         +  A + GH E  +LLL+
Sbjct:  678 VEEQNENGHTPLMEAASAGHVEVAKVLLEHGAGINTHSNEFKESALTLACYKGHLDMVRFLLQAGADQEHKTDEMHTALMEASMDGHVEVARLLLD 773          

HSP 7 Score: 48.1358 bits (113), Expect = 1.110e-6
Identity = 25/85 (29.41%), Postives = 41/85 (48.24%), Query Frame = 3
Query:  234 QACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLLEHN 485
             AC  GH +   +L+ +  ++E   +    P+  AC  GH   VK LI+   ++      N    + LAC  GH   ++LLL++N
Sbjct:  921 HACENGHTDAAGVLLSYGAELEHESEGGRTPLMKACRAGHLCTVKFLIQKGANVNKQTTSNDHTALSLACAGGHQSVVELLLKNN 1005          

HSP 8 Score: 47.7506 bits (112), Expect = 1.317e-6
Identity = 22/85 (25.88%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            P+ +A   GH ++V  L++   ++ A  +     + +AC  GH+ A  +L+ +  ++E  +   + P+  AC  GH  T+K L++
Sbjct:  885 PLMEASQEGHTDLVSFLLKKKANVHAETQTGDTALTHACENGHTDAAGVLLSYGAELEHESEGGRTPLMKACRAGHLCTVKFLIQ 969          

HSP 9 Score: 46.2098 bits (108), Expect = 3.849e-6
Identity = 26/88 (29.55%), Postives = 46/88 (52.27%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEAL--AWWNQRPIHLACIQGHSETIKLLLEH 482
            P+  AC  G  E+V+LL+    + E  +  +  P+  A + G+   +KLL+ H  +I +   +     P+ LA + GH+  +KLLL+ 
Sbjct: 2383 PLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAASGGYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQ 2470          
BLAST of SMED30006877 vs. Ensembl Fly
Match: mask (gene:FBgn0043884 transcript:FBtr0084563)

HSP 1 Score: 66.2402 bits (160), Expect = 5.432e-13
Identity = 41/120 (34.17%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  129 LFSNAVKSGSEELFRRYF--KEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            L S A  +G  EL +         +E K      P+ +A  AGH +IVKLL+ HN D+ A       P+ +AC  G    VK+L++H  ++E        P+  A   GH E  K+LLEH
Sbjct:  588 LLSMACSAGYYELAQVLLAMSAAQVEDKGQKDSTPLMEAASAGHLDIVKLLLNHNADVNAHCATGNTPLMFACAGGQVDVVKVLLKHGANVEEQNENGHTPLMEAASAGHVEVAKVLLEH 707          

HSP 2 Score: 59.3066 bits (142), Expect = 1.434e-10
Identity = 31/81 (38.27%), Postives = 45/81 (55.56%), Query Frame = 3
Query:  237 ACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQ-RPIHLACIQGHSETIKLLL 476
            AC  GH E+V+LLI    +IE  DK    P+  A   GH   V +L++H  ++EA +   +  P+ LAC  G  E ++LLL
Sbjct: 2320 ACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVVDILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLL 2400          

HSP 3 Score: 57.7658 bits (138), Expect = 5.324e-10
Identity = 34/97 (35.05%), Postives = 50/97 (51.55%), Query Frame = 3
Query:  198 ERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAF--DKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLLE 479
            E ++     P+  A   G+  I+KLL+ H  +I +    K  I P+  A   GH+ AVKLL++   DI A    N+   + LAC QG  E + LLL+
Sbjct: 2407 EHRNVSDYTPLSLAASGGYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQGSDINAQIETNRNTALTLACFQGRHEVVSLLLD 2503          

HSP 4 Score: 52.7582 bits (125), Expect = 2.323e-8
Identity = 25/86 (29.07%), Postives = 48/86 (55.81%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALA-WWNQRPIHLACIQGHSETIKLLLE 479
            P+  AC  G  ++VK+L++H  ++E  ++    P+  A + GH    K+L+EH   I   +  + +  + LAC +GH + ++ LL+
Sbjct:  655 PLMFACAGGQVDVVKVLLKHGANVEEQNENGHTPLMEAASAGHVEVAKVLLEHGAGINTHSNEFKESALTLACYKGHLDMVRFLLQ 740          

HSP 5 Score: 50.0618 bits (118), Expect = 1.874e-7
Identity = 35/116 (30.17%), Postives = 57/116 (49.14%), Query Frame = 3
Query:  141 AVKSGSEELFRRYF-KEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEA-FDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A   G EEL      +   +E +D     P+  A  AGH ++V +L++H+ ++EA  ++    P+  AC+ G    V+LL+    + E     +  P+ LA   G+   IKLLL H
Sbjct: 2320 ACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVVDILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAASGGYVNIIKLLLSH 2435          

HSP 6 Score: 48.521 bits (114), Expect = 8.344e-7
Identity = 28/96 (29.17%), Postives = 48/96 (50.00%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAF-DKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            +E ++ +   P+ +A  AGH E+ K+L+EH   I    +++    +  AC KGH   V+ L++   D E         +  A + GH E  +LLL+
Sbjct:  678 VEEQNENGHTPLMEAASAGHVEVAKVLLEHGAGINTHSNEFKESALTLACYKGHLDMVRFLLQAGADQEHKTDEMHTALMEASMDGHVEVARLLLD 773          

HSP 7 Score: 48.1358 bits (113), Expect = 1.110e-6
Identity = 25/85 (29.41%), Postives = 41/85 (48.24%), Query Frame = 3
Query:  234 QACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLLEHN 485
             AC  GH +   +L+ +  ++E   +    P+  AC  GH   VK LI+   ++      N    + LAC  GH   ++LLL++N
Sbjct:  921 HACENGHTDAAGVLLSYGAELEHESEGGRTPLMKACRAGHLCTVKFLIQKGANVNKQTTSNDHTALSLACAGGHQSVVELLLKNN 1005          

HSP 8 Score: 47.7506 bits (112), Expect = 1.317e-6
Identity = 22/85 (25.88%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            P+ +A   GH ++V  L++   ++ A  +     + +AC  GH+ A  +L+ +  ++E  +   + P+  AC  GH  T+K L++
Sbjct:  885 PLMEASQEGHTDLVSFLLKKKANVHAETQTGDTALTHACENGHTDAAGVLLSYGAELEHESEGGRTPLMKACRAGHLCTVKFLIQ 969          

HSP 9 Score: 46.2098 bits (108), Expect = 3.849e-6
Identity = 26/88 (29.55%), Postives = 46/88 (52.27%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEAL--AWWNQRPIHLACIQGHSETIKLLLEH 482
            P+  AC  G  E+V+LL+    + E  +  +  P+  A + G+   +KLL+ H  +I +   +     P+ LA + GH+  +KLLL+ 
Sbjct: 2383 PLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAASGGYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQ 2470          
BLAST of SMED30006877 vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 75.8702 bits (185), Expect = 3.188e-16
Identity = 35/102 (34.31%), Postives = 59/102 (57.84%), Query Frame = 3
Query:  180 FKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            F  +Y+E        P+H A  AGH E+ + L+++N  ++A  K +  P+H A   GH   VKLL+EHK + ++       P+H+A  +GH++T ++LL+ N
Sbjct:  418 FSSDYVET-------PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDEN 512          

HSP 2 Score: 60.077 bits (144), Expect = 1.065e-10
Identity = 28/85 (32.94%), Postives = 44/85 (51.76%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            P+H A   GH  +VK+L++      A       P+H AC K H  ++ LL++H   +EA+      P+H+A   GH   +K LL+
Sbjct:  324 PLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQ 408          

HSP 3 Score: 59.6918 bits (143), Expect = 1.519e-10
Identity = 29/95 (30.53%), Postives = 50/95 (52.63%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            ++ K  D + P+H A   GH E+VKLL+EH  + ++       P+H A  +GH+   ++L++       +      P+H+AC  G  +  +LLLE
Sbjct:  449 VDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLE 543          

HSP 4 Score: 59.3066 bits (142), Expect = 1.721e-10
Identity = 28/87 (32.18%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            PIH A    H + V+ L+++N +I+     ++ P+H A + GH   VK+L++      A A     P+H+AC + H  ++ LLL+H+
Sbjct:  291 PIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHS 377          

HSP 5 Score: 58.151 bits (139), Expect = 4.704e-10
Identity = 25/86 (29.07%), Postives = 44/86 (51.16%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H     GH  I  +L++    + A  +    P+H AC+ G+   VK L++ +  + +       P+H A  QGH++ + LLL+H
Sbjct:  657 PLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKH 742          

HSP 6 Score: 51.2174 bits (121), Expect = 9.737e-8
Identity = 23/86 (26.74%), Postives = 43/86 (50.00%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A   G  ++V LLI    ++   +K  + P+H    +GH     +L++    + A +     P+H+AC  G+ + +K LL+ 
Sbjct:  624 PLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQ 709          

HSP 7 Score: 48.1358 bits (113), Expect = 1.285e-6
Identity = 24/84 (28.57%), Postives = 40/84 (47.62%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H A   GHA+  ++L++ N       K    P+H AC  G     +LL+E   +  A       P+H+A    + + +KLL+
Sbjct:  492 PLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV 575          
BLAST of SMED30006877 vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 75.8702 bits (185), Expect = 3.189e-16
Identity = 35/102 (34.31%), Postives = 59/102 (57.84%), Query Frame = 3
Query:  180 FKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            F  +Y+E        P+H A  AGH E+ + L+++N  ++A  K +  P+H A   GH   VKLL+EHK + ++       P+H+A  +GH++T ++LL+ N
Sbjct:  430 FSSDYVET-------PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDEN 524          

HSP 2 Score: 60.077 bits (144), Expect = 1.066e-10
Identity = 28/85 (32.94%), Postives = 44/85 (51.76%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            P+H A   GH  +VK+L++      A       P+H AC K H  ++ LL++H   +EA+      P+H+A   GH   +K LL+
Sbjct:  336 PLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQ 420          

HSP 3 Score: 59.6918 bits (143), Expect = 1.520e-10
Identity = 29/95 (30.53%), Postives = 50/95 (52.63%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            ++ K  D + P+H A   GH E+VKLL+EH  + ++       P+H A  +GH+   ++L++       +      P+H+AC  G  +  +LLLE
Sbjct:  461 VDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLE 555          

HSP 4 Score: 59.3066 bits (142), Expect = 1.721e-10
Identity = 28/87 (32.18%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            PIH A    H + V+ L+++N +I+     ++ P+H A + GH   VK+L++      A A     P+H+AC + H  ++ LLL+H+
Sbjct:  303 PIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHS 389          

HSP 5 Score: 58.151 bits (139), Expect = 4.707e-10
Identity = 25/86 (29.07%), Postives = 44/86 (51.16%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H     GH  I  +L++    + A  +    P+H AC+ G+   VK L++ +  + +       P+H A  QGH++ + LLL+H
Sbjct:  669 PLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKH 754          

HSP 6 Score: 51.2174 bits (121), Expect = 9.742e-8
Identity = 23/86 (26.74%), Postives = 43/86 (50.00%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A   G  ++V LLI    ++   +K  + P+H    +GH     +L++    + A +     P+H+AC  G+ + +K LL+ 
Sbjct:  636 PLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQ 721          

HSP 7 Score: 48.1358 bits (113), Expect = 1.286e-6
Identity = 24/84 (28.57%), Postives = 40/84 (47.62%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H A   GHA+  ++L++ N       K    P+H AC  G     +LL+E   +  A       P+H+A    + + +KLL+
Sbjct:  504 PLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV 587          
BLAST of SMED30006877 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 75.8702 bits (185), Expect = 3.193e-16
Identity = 35/102 (34.31%), Postives = 59/102 (57.84%), Query Frame = 3
Query:  180 FKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            F  +Y+E        P+H A  AGH E+ + L+++N  ++A  K +  P+H A   GH   VKLL+EHK + ++       P+H+A  +GH++T ++LL+ N
Sbjct:  465 FSSDYVET-------PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDEN 559          

HSP 2 Score: 61.2326 bits (147), Expect = 4.170e-11
Identity = 29/95 (30.53%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            ++ K  D + P+H A   GH E+VKLL+EH  + ++       P+H A  +GH+   ++L++       +      P+H+AC  G  + ++LLLE
Sbjct:  496 VDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLE 590          

HSP 3 Score: 60.077 bits (144), Expect = 9.790e-11
Identity = 30/97 (30.93%), Postives = 53/97 (54.64%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            L+ K  +   PIH A    H + V+ L+++N +I+     ++ P+H A + GH   VK+L++      A A     P+H+AC + H  ++ LLL+H+
Sbjct:  328 LQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHS 424          

HSP 4 Score: 60.077 bits (144), Expect = 1.067e-10
Identity = 28/85 (32.94%), Postives = 44/85 (51.76%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            P+H A   GH  +VK+L++      A       P+H AC K H  ++ LL++H   +EA+      P+H+A   GH   +K LL+
Sbjct:  371 PLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQ 455          

HSP 5 Score: 58.151 bits (139), Expect = 4.712e-10
Identity = 25/86 (29.07%), Postives = 44/86 (51.16%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H     GH  I  +L++    + A  +    P+H AC+ G+   VK L++ +  + +       P+H A  QGH++ + LLL+H
Sbjct:  704 PLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKH 789          

HSP 6 Score: 56.225 bits (134), Expect = 1.852e-9
Identity = 27/95 (28.42%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            ++ K  D   P+H A   GH  +V++L++    ++A  K  + PIH A    H   V+ L+++  +I+ +   +  P+H+A   GH   +K+LL+
Sbjct:  295 IDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLD 389          

HSP 7 Score: 52.373 bits (124), Expect = 4.815e-8
Identity = 26/87 (29.89%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P+H A   G+  +V+LL++    I+A  K  + P+H A   GH   V++L++    ++A       PIH+A    H + ++ LL++N
Sbjct:  272 PLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYN 358          

HSP 8 Score: 51.2174 bits (121), Expect = 9.752e-8
Identity = 23/86 (26.74%), Postives = 43/86 (50.00%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A   G  ++V LLI    ++   +K  + P+H    +GH     +L++    + A +     P+H+AC  G+ + +K LL+ 
Sbjct:  671 PLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQ 756          

HSP 9 Score: 49.6766 bits (117), Expect = 3.430e-7
Identity = 25/84 (29.76%), Postives = 41/84 (48.81%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H A   GHA+  ++L++ N       K    P+H AC  G    V+LL+E   +  A       P+H+A    + + +KLL+
Sbjct:  539 PLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV 622          
BLAST of SMED30006877 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 75.8702 bits (185), Expect = 3.253e-16
Identity = 35/102 (34.31%), Postives = 59/102 (57.84%), Query Frame = 3
Query:  180 FKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            F  +Y+E        P+H A  AGH E+ + L+++N  ++A  K +  P+H A   GH   VKLL+EHK + ++       P+H+A  +GH++T ++LL+ N
Sbjct:  446 FSSDYVET-------PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDEN 540          

HSP 2 Score: 61.2326 bits (147), Expect = 4.414e-11
Identity = 29/95 (30.53%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            ++ K  D + P+H A   GH E+VKLL+EH  + ++       P+H A  +GH+   ++L++       +      P+H+AC  G  + ++LLLE
Sbjct:  477 VDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLE 571          

HSP 3 Score: 60.077 bits (144), Expect = 9.973e-11
Identity = 30/97 (30.93%), Postives = 53/97 (54.64%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            L+ K  +   PIH A    H + V+ L+++N +I+     ++ P+H A + GH   VK+L++      A A     P+H+AC + H  ++ LLL+H+
Sbjct:  309 LQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHS 405          

HSP 4 Score: 60.077 bits (144), Expect = 1.087e-10
Identity = 28/85 (32.94%), Postives = 44/85 (51.76%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            P+H A   GH  +VK+L++      A       P+H AC K H  ++ LL++H   +EA+      P+H+A   GH   +K LL+
Sbjct:  352 PLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQ 436          

HSP 5 Score: 58.151 bits (139), Expect = 4.664e-10
Identity = 25/86 (29.07%), Postives = 44/86 (51.16%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H     GH  I  +L++    + A  +    P+H AC+ G+   VK L++ +  + +       P+H A  QGH++ + LLL+H
Sbjct:  685 PLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKH 770          

HSP 6 Score: 56.225 bits (134), Expect = 1.923e-9
Identity = 27/95 (28.42%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            ++ K  D   P+H A   GH  +V++L++    ++A  K  + PIH A    H   V+ L+++  +I+ +   +  P+H+A   GH   +K+LL+
Sbjct:  276 IDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLD 370          

HSP 7 Score: 52.373 bits (124), Expect = 4.858e-8
Identity = 26/87 (29.89%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P+H A   G+  +V+LL++    I+A  K  + P+H A   GH   V++L++    ++A       PIH+A    H + ++ LL++N
Sbjct:  253 PLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYN 339          

HSP 8 Score: 51.2174 bits (121), Expect = 9.746e-8
Identity = 23/86 (26.74%), Postives = 43/86 (50.00%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A   G  ++V LLI    ++   +K  + P+H    +GH     +L++    + A +     P+H+AC  G+ + +K LL+ 
Sbjct:  652 PLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQ 737          

HSP 9 Score: 49.6766 bits (117), Expect = 3.494e-7
Identity = 25/84 (29.76%), Postives = 41/84 (48.81%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H A   GHA+  ++L++ N       K    P+H AC  G    V+LL+E   +  A       P+H+A    + + +KLL+
Sbjct:  520 PLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV 603          
BLAST of SMED30006877 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 75.0998 bits (183), Expect = 5.854e-16
Identity = 32/87 (36.78%), Postives = 54/87 (62.07%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P+H A  AGH E+ + L+++N  ++A  K +  P+H A   GH   VKLL+EHK + ++       P+H+A  +GH++T ++LL+ N
Sbjct:  381 PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDEN 467          

HSP 2 Score: 64.6994 bits (156), Expect = 2.231e-12
Identity = 31/86 (36.05%), Postives = 46/86 (53.49%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A F GH  IVK L++      A +     P+H A   GH    + L+++   ++A A  +Q P+H A   GH E +KLL+EH
Sbjct:  348 PLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEH 433          

HSP 3 Score: 61.2326 bits (147), Expect = 4.051e-11
Identity = 29/95 (30.53%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            ++ K  D + P+H A   GH E+VKLL+EH  + ++       P+H A  +GH+   ++L++       +      P+H+AC  G  + ++LLLE
Sbjct:  404 VDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLE 498          

HSP 4 Score: 60.077 bits (144), Expect = 9.511e-11
Identity = 30/97 (30.93%), Postives = 53/97 (54.64%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            L+ K  +   PIH A    H + V+ L+++N +I+     ++ P+H A + GH   VK+L++      A A     P+H+AC + H  ++ LLL+H+
Sbjct:  239 LQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHS 335          

HSP 5 Score: 60.077 bits (144), Expect = 1.037e-10
Identity = 28/85 (32.94%), Postives = 44/85 (51.76%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            P+H A   GH  +VK+L++      A       P+H AC K H  ++ LL++H   +EA+      P+H+A   GH   +K LL+
Sbjct:  282 PLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQ 366          

HSP 6 Score: 58.151 bits (139), Expect = 4.579e-10
Identity = 25/86 (29.07%), Postives = 44/86 (51.16%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H     GH  I  +L++    + A  +    P+H AC+ G+   VK L++ +  + +       P+H A  QGH++ + LLL+H
Sbjct:  612 PLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKH 697          

HSP 7 Score: 56.225 bits (134), Expect = 1.800e-9
Identity = 27/95 (28.42%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            ++ K  D   P+H A   GH  +V++L++    ++A  K  + PIH A    H   V+ L+++  +I+ +   +  P+H+A   GH   +K+LL+
Sbjct:  206 IDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLD 300          

HSP 8 Score: 56.225 bits (134), Expect = 2.000e-9
Identity = 28/87 (32.18%), Postives = 45/87 (51.72%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P+H AC   H   + LL++H+  +EA  +  + P+H A   GH   VK L++      A     + P+H+A   GH E  + LL++N
Sbjct:  315 PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNN 401          

HSP 9 Score: 52.373 bits (124), Expect = 4.682e-8
Identity = 26/87 (29.89%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P+H A   G+  +V+LL++    I+A  K  + P+H A   GH   V++L++    ++A       PIH+A    H + ++ LL++N
Sbjct:  183 PLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYN 269          

HSP 10 Score: 51.2174 bits (121), Expect = 9.484e-8
Identity = 23/86 (26.74%), Postives = 43/86 (50.00%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A   G  ++V LLI    ++   +K  + P+H    +GH     +L++    + A +     P+H+AC  G+ + +K LL+ 
Sbjct:  579 PLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQ 664          

HSP 11 Score: 49.6766 bits (117), Expect = 3.336e-7
Identity = 25/84 (29.76%), Postives = 41/84 (48.81%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H A   GHA+  ++L++ N       K    P+H AC  G    V+LL+E   +  A       P+H+A    + + +KLL+
Sbjct:  447 PLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV 530          

HSP 12 Score: 45.4394 bits (106), Expect = 9.922e-6
Identity = 23/86 (26.74%), Postives = 42/86 (48.84%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A    +  + +LL+    ++    K  I P+H A  +G+   V+LL++    I+A       P+H A   GH   +++LL+ 
Sbjct:  150 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQ 235          
BLAST of SMED30006877 vs. Ensembl Xenopus
Match: tnks2 (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [Source:NCBI gene;Acc:549762])

HSP 1 Score: 69.707 bits (169), Expect = 6.439e-14
Identity = 37/116 (31.90%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A K+G  E  ++    + +  +D + R+  P+H A       +V+ L++H  D+ A DK  + P+H AC+ GH    +LL++H   I     W   P+H A  +G  E  KLLL+H
Sbjct:  552 AAKAGDVETVKKLCTSQSVNCRDIEGRQSTPLHFAAGYNRVAVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGAVINVADLWKFTPLHEAAAKGKYEICKLLLQH 667          

HSP 2 Score: 67.0106 bits (162), Expect = 4.900e-13
Identity = 36/116 (31.03%), Postives = 61/116 (52.59%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A ++G  E  R+    + +  +D   R+  P+H A   G  ++V+ L++   ++ A D   + P+H AC+ GH+  V LL+ H  D  A   WN  P+H A I+G  +   +LL+H
Sbjct:   81 ACRNGDVERVRKLVNADNVNSRDTAGRKSTPLHFAAGFGRKDVVEHLLQSGANVHARDDGGLIPLHNACSFGHAEVVSLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 196          

HSP 3 Score: 57.3806 bits (137), Expect = 1.175e-9
Identity = 35/119 (29.41%), Postives = 58/119 (48.74%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLI---EHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            + +SG+EE          +    +D R+  P+H A      +IV+LL++H  D+ A DK ++ P+H AC+ GH    +LL+        + A+  W   P+H A  +   E   LLL +
Sbjct:  234 SARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLLCMHMRGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSY 352          

HSP 4 Score: 56.225 bits (134), Expect = 2.779e-9
Identity = 25/56 (44.64%), Postives = 32/56 (57.14%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GHAE+V LL+ H  D  A D WN  P+H A  KG      +L++H  D
Sbjct:  144 PLHNACSFGHAEVVSLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAD 199          

HSP 5 Score: 55.0694 bits (131), Expect = 7.515e-9
Identity = 33/117 (28.21%), Postives = 56/117 (47.86%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +A K G     ++    E +  +D   R   P+H A    + E+ + L+++  D+ A DK  + P+H A + GH     LLI++   + A   W   P+H A  +G ++   LLL H
Sbjct:  704 DAAKKGCVSRVKKLCTPENVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQNGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAH 820          

HSP 6 Score: 55.0694 bits (131), Expect = 7.959e-9
Identity = 28/75 (37.33%), Postives = 38/75 (50.67%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL +  AD+         P+H AC  GH E+ +LL++H   I   D W   P+H A  KG     KLL++H  D
Sbjct:  596 EYLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGAVINVADLWKFTPLHEAAAKGKYEICKLLLQHGAD 670          

HSP 7 Score: 53.1434 bits (126), Expect = 2.975e-8
Identity = 30/89 (33.71%), Postives = 42/89 (47.19%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHL 434
            EYL +  AD+         P+H A   GH ++  LLI++N  + A DKW   P+H A  KG +    LL+ H  D        Q P+ L
Sbjct:  749 EYLLQNGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQAPLDL 837          
BLAST of SMED30006877 vs. Ensembl Xenopus
Match: tnks2 (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [Source:NCBI gene;Acc:549762])

HSP 1 Score: 69.707 bits (169), Expect = 6.700e-14
Identity = 37/116 (31.90%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A K+G  E  ++    + +  +D + R+  P+H A       +V+ L++H  D+ A DK  + P+H AC+ GH    +LL++H   I     W   P+H A  +G  E  KLLL+H
Sbjct:  571 AAKAGDVETVKKLCTSQSVNCRDIEGRQSTPLHFAAGYNRVAVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGAVINVADLWKFTPLHEAAAKGKYEICKLLLQH 686          

HSP 2 Score: 67.0106 bits (162), Expect = 4.953e-13
Identity = 36/116 (31.03%), Postives = 61/116 (52.59%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A ++G  E  R+    + +  +D   R+  P+H A   G  ++V+ L++   ++ A D   + P+H AC+ GH+  V LL+ H  D  A   WN  P+H A I+G  +   +LL+H
Sbjct:  100 ACRNGDVERVRKLVNADNVNSRDTAGRKSTPLHFAAGFGRKDVVEHLLQSGANVHARDDGGLIPLHNACSFGHAEVVSLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 215          

HSP 3 Score: 57.3806 bits (137), Expect = 1.199e-9
Identity = 35/119 (29.41%), Postives = 58/119 (48.74%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLI---EHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            + +SG+EE          +    +D R+  P+H A      +IV+LL++H  D+ A DK ++ P+H AC+ GH    +LL+        + A+  W   P+H A  +   E   LLL +
Sbjct:  253 SARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLLCMHMRGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSY 371          

HSP 4 Score: 56.225 bits (134), Expect = 2.783e-9
Identity = 25/56 (44.64%), Postives = 32/56 (57.14%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GHAE+V LL+ H  D  A D WN  P+H A  KG      +L++H  D
Sbjct:  163 PLHNACSFGHAEVVSLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAD 218          

HSP 5 Score: 55.0694 bits (131), Expect = 7.892e-9
Identity = 33/117 (28.21%), Postives = 56/117 (47.86%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +A K G     ++    E +  +D   R   P+H A    + E+ + L+++  D+ A DK  + P+H A + GH     LLI++   + A   W   P+H A  +G ++   LLL H
Sbjct:  723 DAAKKGCVSRVKKLCTPENVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQNGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAH 839          

HSP 6 Score: 55.0694 bits (131), Expect = 7.968e-9
Identity = 28/75 (37.33%), Postives = 38/75 (50.67%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL +  AD+         P+H AC  GH E+ +LL++H   I   D W   P+H A  KG     KLL++H  D
Sbjct:  615 EYLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGAVINVADLWKFTPLHEAAAKGKYEICKLLLQHGAD 689          

HSP 7 Score: 53.1434 bits (126), Expect = 3.036e-8
Identity = 30/89 (33.71%), Postives = 42/89 (47.19%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHL 434
            EYL +  AD+         P+H A   GH ++  LLI++N  + A DKW   P+H A  KG +    LL+ H  D        Q P+ L
Sbjct:  768 EYLLQNGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQAPLDL 856          
BLAST of SMED30006877 vs. Ensembl Xenopus
Match: tnks2 (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [Source:NCBI gene;Acc:549762])

HSP 1 Score: 69.3218 bits (168), Expect = 7.299e-14
Identity = 37/116 (31.90%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A K+G  E  ++    + +  +D + R+  P+H A       +V+ L++H  D+ A DK  + P+H AC+ GH    +LL++H   I     W   P+H A  +G  E  KLLL+H
Sbjct:  500 AAKAGDVETVKKLCTSQSVNCRDIEGRQSTPLHFAAGYNRVAVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGAVINVADLWKFTPLHEAAAKGKYEICKLLLQH 615          

HSP 2 Score: 67.0106 bits (162), Expect = 5.662e-13
Identity = 36/116 (31.03%), Postives = 61/116 (52.59%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A ++G  E  R+    + +  +D   R+  P+H A   G  ++V+ L++   ++ A D   + P+H AC+ GH+  V LL+ H  D  A   WN  P+H A I+G  +   +LL+H
Sbjct:   32 ACRNGDVERVRKLVNADNVNSRDTAGRKSTPLHFAAGFGRKDVVEHLLQSGANVHARDDGGLIPLHNACSFGHAEVVSLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 147          

HSP 3 Score: 64.3142 bits (155), Expect = 5.161e-12
Identity = 35/116 (30.17%), Postives = 59/116 (50.86%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            + +SG+EE          +    +D R+  P+H A      +IV+LL++H  D+ A DK ++ P+H AC+ GH    +LL++    + A+  W   P+H A  +   E   LLL +
Sbjct:  185 SARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKRGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSY 300          

HSP 4 Score: 56.225 bits (134), Expect = 3.119e-9
Identity = 25/56 (44.64%), Postives = 32/56 (57.14%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GHAE+V LL+ H  D  A D WN  P+H A  KG      +L++H  D
Sbjct:   95 PLHNACSFGHAEVVSLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAD 150          

HSP 5 Score: 54.6842 bits (130), Expect = 8.847e-9
Identity = 28/75 (37.33%), Postives = 38/75 (50.67%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL +  AD+         P+H AC  GH E+ +LL++H   I   D W   P+H A  KG     KLL++H  D
Sbjct:  544 EYLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGAVINVADLWKFTPLHEAAAKGKYEICKLLLQHGAD 618          

HSP 6 Score: 51.2174 bits (121), Expect = 1.424e-7
Identity = 24/71 (33.80%), Postives = 35/71 (49.30%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            P+H AC  GH E+ +LL++    + A D W   P+H A +K       LL+ +  D   L   N+  I LA
Sbjct:  248 PLHNACSYGHYEVTELLVKRGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTMLNCHNKSAIDLA 318          
BLAST of SMED30006877 vs. Ensembl Xenopus
Match: tnks2 (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [Source:NCBI gene;Acc:549762])

HSP 1 Score: 69.3218 bits (168), Expect = 7.782e-14
Identity = 37/116 (31.90%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A K+G  E  ++    + +  +D + R+  P+H A       +V+ L++H  D+ A DK  + P+H AC+ GH    +LL++H   I     W   P+H A  +G  E  KLLL+H
Sbjct:  516 AAKAGDVETVKKLCTSQSVNCRDIEGRQSTPLHFAAGYNRVAVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGAVINVADLWKFTPLHEAAAKGKYEICKLLLQH 631          

HSP 2 Score: 67.0106 bits (162), Expect = 6.036e-13
Identity = 36/116 (31.03%), Postives = 61/116 (52.59%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A ++G  E  R+    + +  +D   R+  P+H A   G  ++V+ L++   ++ A D   + P+H AC+ GH+  V LL+ H  D  A   WN  P+H A I+G  +   +LL+H
Sbjct:   45 ACRNGDVERVRKLVNADNVNSRDTAGRKSTPLHFAAGFGRKDVVEHLLQSGANVHARDDGGLIPLHNACSFGHAEVVSLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 160          

HSP 3 Score: 56.9954 bits (136), Expect = 1.339e-9
Identity = 35/119 (29.41%), Postives = 58/119 (48.74%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLI---EHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            + +SG+EE          +    +D R+  P+H A      +IV+LL++H  D+ A DK ++ P+H AC+ GH    +LL+        + A+  W   P+H A  +   E   LLL +
Sbjct:  198 SARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLLCMHMRGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSY 316          

HSP 4 Score: 56.225 bits (134), Expect = 3.169e-9
Identity = 25/56 (44.64%), Postives = 32/56 (57.14%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GHAE+V LL+ H  D  A D WN  P+H A  KG      +L++H  D
Sbjct:  108 PLHNACSFGHAEVVSLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAD 163          

HSP 5 Score: 54.6842 bits (130), Expect = 8.901e-9
Identity = 33/117 (28.21%), Postives = 56/117 (47.86%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +A K G     ++    E +  +D   R   P+H A    + E+ + L+++  D+ A DK  + P+H A + GH     LLI++   + A   W   P+H A  +G ++   LLL H
Sbjct:  668 DAAKKGCVSRVKKLCTPENVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQNGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAH 784          

HSP 6 Score: 54.6842 bits (130), Expect = 8.986e-9
Identity = 28/75 (37.33%), Postives = 38/75 (50.67%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL +  AD+         P+H AC  GH E+ +LL++H   I   D W   P+H A  KG     KLL++H  D
Sbjct:  560 EYLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGAVINVADLWKFTPLHEAAAKGKYEICKLLLQHGAD 634          

HSP 7 Score: 53.1434 bits (126), Expect = 3.391e-8
Identity = 30/89 (33.71%), Postives = 42/89 (47.19%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHL 434
            EYL +  AD+         P+H A   GH ++  LLI++N  + A DKW   P+H A  KG +    LL+ H  D        Q P+ L
Sbjct:  713 EYLLQNGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQAPLDL 801          
BLAST of SMED30006877 vs. Ensembl Xenopus
Match: tnks2 (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [Source:NCBI gene;Acc:549762])

HSP 1 Score: 69.3218 bits (168), Expect = 7.987e-14
Identity = 37/116 (31.90%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A K+G  E  ++    + +  +D + R+  P+H A       +V+ L++H  D+ A DK  + P+H AC+ GH    +LL++H   I     W   P+H A  +G  E  KLLL+H
Sbjct:  500 AAKAGDVETVKKLCTSQSVNCRDIEGRQSTPLHFAAGYNRVAVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGAVINVADLWKFTPLHEAAAKGKYEICKLLLQH 615          

HSP 2 Score: 66.6254 bits (161), Expect = 6.194e-13
Identity = 36/116 (31.03%), Postives = 61/116 (52.59%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A ++G  E  R+    + +  +D   R+  P+H A   G  ++V+ L++   ++ A D   + P+H AC+ GH+  V LL+ H  D  A   WN  P+H A I+G  +   +LL+H
Sbjct:   32 ACRNGDVERVRKLVNADNVNSRDTAGRKSTPLHFAAGFGRKDVVEHLLQSGANVHARDDGGLIPLHNACSFGHAEVVSLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 147          

HSP 3 Score: 63.929 bits (154), Expect = 5.486e-12
Identity = 35/116 (30.17%), Postives = 59/116 (50.86%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            + +SG+EE          +    +D R+  P+H A      +IV+LL++H  D+ A DK ++ P+H AC+ GH    +LL++    + A+  W   P+H A  +   E   LLL +
Sbjct:  185 SARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKRGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSY 300          

HSP 4 Score: 56.225 bits (134), Expect = 3.283e-9
Identity = 25/56 (44.64%), Postives = 32/56 (57.14%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GHAE+V LL+ H  D  A D WN  P+H A  KG      +L++H  D
Sbjct:   95 PLHNACSFGHAEVVSLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAD 150          

HSP 5 Score: 54.6842 bits (130), Expect = 9.134e-9
Identity = 33/117 (28.21%), Postives = 56/117 (47.86%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +A K G     ++    E +  +D   R   P+H A    + E+ + L+++  D+ A DK  + P+H A + GH     LLI++   + A   W   P+H A  +G ++   LLL H
Sbjct:  652 DAAKKGCVSRVKKLCTPENVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQNGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAH 768          

HSP 6 Score: 54.6842 bits (130), Expect = 9.222e-9
Identity = 28/75 (37.33%), Postives = 38/75 (50.67%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL +  AD+         P+H AC  GH E+ +LL++H   I   D W   P+H A  KG     KLL++H  D
Sbjct:  544 EYLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGAVINVADLWKFTPLHEAAAKGKYEICKLLLQHGAD 618          

HSP 7 Score: 53.1434 bits (126), Expect = 3.513e-8
Identity = 30/89 (33.71%), Postives = 42/89 (47.19%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHL 434
            EYL +  AD+         P+H A   GH ++  LLI++N  + A DKW   P+H A  KG +    LL+ H  D        Q P+ L
Sbjct:  697 EYLLQNGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQAPLDL 785          

HSP 8 Score: 51.2174 bits (121), Expect = 1.470e-7
Identity = 24/71 (33.80%), Postives = 35/71 (49.30%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            P+H AC  GH E+ +LL++    + A D W   P+H A +K       LL+ +  D   L   N+  I LA
Sbjct:  248 PLHNACSYGHYEVTELLVKRGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTMLNCHNKSAIDLA 318          
BLAST of SMED30006877 vs. Ensembl Mouse
Match: Tnks2 (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [Source:MGI Symbol;Acc:MGI:1921743])

HSP 1 Score: 70.4774 bits (171), Expect = 2.271e-14
Identity = 37/116 (31.90%), Postives = 64/116 (55.17%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A ++G  E  +R    E +  +D   R+  P+H A   G  ++V+ L+++  +++A D   + P+H AC+ GH+  V LL++H  D  A   WN  P+H A I+G  +   +LL+H
Sbjct:   31 ACRNGDVERVKRLVTPEKVNSRDTAGRKSTPLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLQHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 146          

HSP 2 Score: 67.781 bits (164), Expect = 2.116e-13
Identity = 36/116 (31.03%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A K+G  E  ++    + +  +D + R+  P+H A       +V+ L++H  D+ A DK  + P+H AC+ GH    +LL++H   +     W   P+H A  +G  E  KLLL+H
Sbjct:  499 AAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQH 614          

HSP 3 Score: 64.6994 bits (156), Expect = 2.918e-12
Identity = 36/116 (31.03%), Postives = 59/116 (50.86%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            + +SG+EE          +    +D R+  P+H A      +IV+LL+ H  D+ A DK ++ P+H AC+ GH    +LL++H   + A+  W   P+H A  +   E   LLL +
Sbjct:  184 SARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLHHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRIEVCSLLLSY 299          

HSP 4 Score: 55.8398 bits (133), Expect = 3.194e-9
Identity = 33/117 (28.21%), Postives = 56/117 (47.86%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +A K G     ++    + +  +D   R   P+H A    + E+ + L++H  D+ A DK  + P+H A + GH     LLI++   + A   W   P+H A  +G ++   LLL H
Sbjct:  651 DAAKKGCLARVKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAH 767          

HSP 5 Score: 53.9138 bits (128), Expect = 1.433e-8
Identity = 27/75 (36.00%), Postives = 38/75 (50.67%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL +  AD+         P+H AC  GH E+ +LL++H   +   D W   P+H A  KG     KLL++H  D
Sbjct:  543 EYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGAD 617          

HSP 6 Score: 52.7582 bits (125), Expect = 3.516e-8
Identity = 30/89 (33.71%), Postives = 42/89 (47.19%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHL 434
            EYL +  AD+         P+H A   GH ++  LLI++N  + A DKW   P+H A  KG +    LL+ H  D        Q P+ L
Sbjct:  696 EYLLQHGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQTPLDL 784          

HSP 7 Score: 52.373 bits (124), Expect = 4.549e-8
Identity = 25/71 (35.21%), Postives = 36/71 (50.70%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            P+H AC  GH E+ +LL++H   + A D W   P+H A +K       LL+ +  D   L   N+  I LA
Sbjct:  247 PLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRIEVCSLLLSYGADPTLLNCHNKSAIDLA 317          
BLAST of SMED30006877 vs. Ensembl Mouse
Match: Ankrd65 (ankyrin repeat domain 65 [Source:MGI Symbol;Acc:MGI:2685285])

HSP 1 Score: 70.0922 bits (170), Expect = 2.532e-14
Identity = 32/94 (34.04%), Postives = 51/94 (54.26%), Query Frame = 3
Query:  204 KDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            +D + R  +H+A   GH  + +LL+    +I+A D   + P+H+A   GH   V  L++    I A  W ++ P+HLA   GHS T++LLL   
Sbjct:  273 RDRNNRSALHRAATGGHLRVTQLLVAKGIEIDAQDSLGLTPLHHAARGGHVEVVSHLLDRGAHINAAGWLHKTPLHLAVENGHSTTVELLLSRG 366          

HSP 2 Score: 50.447 bits (119), Expect = 1.946e-7
Identity = 32/117 (27.35%), Postives = 51/117 (43.59%), Query Frame = 3
Query:  108 LMNRDFHLFSNAVKSGSEELFRRYFKE-EYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHS 455
            L +  +     AV  G+  L  +  ++   +E +D   R P+H A   GHA +V+LL++      A D     P+H A   GHS   +LL+       A +     P+H A   G +
Sbjct:   47 LTSPGWSTLFQAVWWGAPSLVMQLLRQGSSVEERDHTGRTPLHLAVMRGHAPLVRLLLQRGALAGAPDHTGRTPLHEAAWHGHSNVAELLLRRGASAAACSQTGLTPLHGAAALGRT 163          
BLAST of SMED30006877 vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 68.9366 bits (167), Expect = 9.708e-14
Identity = 34/87 (39.08%), Postives = 48/87 (55.17%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            R  +H A F+GH E+VKLL+    +I AFDK + R IH+A   GH   VKLL+ H  ++      +  P+H A   G    +K LL+
Sbjct:  141 RTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLD 227          

HSP 2 Score: 63.929 bits (154), Expect = 4.853e-12
Identity = 31/95 (32.63%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
             ++KD   RR IH A + GH E+VKLL+ H  ++   DK +  P+H A + G  + VK L++   D+     +   P+H+AC  G    +  L++
Sbjct:  169 FDKKD---RRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELID 260          

HSP 3 Score: 57.3806 bits (137), Expect = 7.676e-10
Identity = 35/108 (32.41%), Postives = 56/108 (51.85%), Query Frame = 3
Query:  117 RDFHLFSNAVKSGSEELFRRY-FKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            RD      A+ +G  +  R   FK+E +  +D + R P+H A + G AEI++LLI     + A D   + P+H A       AV++L++H  D+ A     Q P+H+A
Sbjct:    7 RDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIA 114          

HSP 4 Score: 53.1434 bits (126), Expect = 2.796e-8
Identity = 34/115 (29.57%), Postives = 54/115 (46.96%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEY-LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            AV S SEE  +   K    +  +D + + P+H A      +  + L+    ++   D+     +H+A   GH   VKLL+    +I A    ++R IH A   GH E +KLL+ H
Sbjct:   81 AVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSH 195          

HSP 5 Score: 52.373 bits (124), Expect = 4.911e-8
Identity = 29/110 (26.36%), Postives = 49/110 (44.55%), Query Frame = 3
Query:  153 GSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEH-KCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            G+ E+         +   D+  R P+H A F  H E ++LL+  N  + + D     P+  A   G +  V++L+     D+          +HLAC +GH  +  L+LE
Sbjct:  802 GAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILE 911          

HSP 6 Score: 50.447 bits (119), Expect = 2.302e-7
Identity = 30/94 (31.91%), Postives = 49/94 (52.13%), Query Frame = 3
Query:  207 DADLR---RPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLL 476
            D+D R    P+H A + GH + +++L++   D++  +     P+  A  KGH   V +LI     I    +  +R PIH A   GHSE ++LL+
Sbjct:  544 DSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLI 637          

HSP 7 Score: 49.2914 bits (116), Expect = 4.702e-7
Identity = 30/97 (30.93%), Postives = 48/97 (49.48%), Query Frame = 3
Query:  204 KDADLRR-PIHQACFAGHAEIVKLLI---EHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            KD  L+R PIH A   GH+E ++LLI   E    ++  D     P+  +   GH+  V  L+    +++A   W +  +H   + GH E +  LL+H
Sbjct:  612 KDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQH 708          
BLAST of SMED30006877 vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 68.9366 bits (167), Expect = 9.829e-14
Identity = 34/87 (39.08%), Postives = 48/87 (55.17%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            R  +H A F+GH E+VKLL+    +I AFDK + R IH+A   GH   VKLL+ H  ++      +  P+H A   G    +K LL+
Sbjct:  171 RTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLD 257          

HSP 2 Score: 63.929 bits (154), Expect = 4.595e-12
Identity = 31/95 (32.63%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
             ++KD   RR IH A + GH E+VKLL+ H  ++   DK +  P+H A + G  + VK L++   D+     +   P+H+AC  G    +  L++
Sbjct:  199 FDKKD---RRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELID 290          

HSP 3 Score: 57.3806 bits (137), Expect = 7.479e-10
Identity = 30/86 (34.88%), Postives = 48/86 (55.81%), Query Frame = 3
Query:  180 FKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            FK+E +  +D + R P+H A + G AEI++LLI     + A D   + P+H A       AV++L++H  D+ A     Q P+H+A
Sbjct:   59 FKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIA 144          

HSP 4 Score: 53.1434 bits (126), Expect = 2.725e-8
Identity = 34/115 (29.57%), Postives = 54/115 (46.96%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEY-LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            AV S SEE  +   K    +  +D + + P+H A      +  + L+    ++   D+     +H+A   GH   VKLL+    +I A    ++R IH A   GH E +KLL+ H
Sbjct:  111 AVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSH 225          

HSP 5 Score: 52.373 bits (124), Expect = 4.877e-8
Identity = 29/110 (26.36%), Postives = 49/110 (44.55%), Query Frame = 3
Query:  153 GSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEH-KCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            G+ E+         +   D+  R P+H A F  H E ++LL+  N  + + D     P+  A   G +  V++L+     D+          +HLAC +GH  +  L+LE
Sbjct:  832 GAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILE 941          

HSP 6 Score: 50.447 bits (119), Expect = 2.286e-7
Identity = 30/94 (31.91%), Postives = 49/94 (52.13%), Query Frame = 3
Query:  207 DADLR---RPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLL 476
            D+D R    P+H A + GH + +++L++   D++  +     P+  A  KGH   V +LI     I    +  +R PIH A   GHSE ++LL+
Sbjct:  574 DSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLI 667          

HSP 7 Score: 49.6766 bits (117), Expect = 4.452e-7
Identity = 30/97 (30.93%), Postives = 48/97 (49.48%), Query Frame = 3
Query:  204 KDADLRR-PIHQACFAGHAEIVKLLI---EHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            KD  L+R PIH A   GH+E ++LLI   E    ++  D     P+  +   GH+  V  L+    +++A   W +  +H   + GH E +  LL+H
Sbjct:  642 KDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQH 738          
BLAST of SMED30006877 vs. Ensembl Mouse
Match: Tnks (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase [Source:MGI Symbol;Acc:MGI:1341087])

HSP 1 Score: 68.1662 bits (165), Expect = 1.527e-13
Identity = 38/116 (32.76%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A +SG+EE          +    +D R+  P+H A       IV+LL++H  D+ A DK  + P+H AC+ GH    +LL++H   + A+  W   P+H A  +   E   LLL H
Sbjct:  335 AARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSH 450          

HSP 2 Score: 67.0106 bits (162), Expect = 3.735e-13
Identity = 38/123 (30.89%), Postives = 60/123 (48.78%), Query Frame = 3
Query:  120 DFHLFSNAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            D+ L   A K+G  E  ++    + +  +D + R   P+H A       +V+ L+ H  D+ A DK  + P+H AC+ GH    +LL+ H   +     W   P+H A  +G  E  KLLL+H
Sbjct:  644 DYRLLE-ASKAGDLETVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKH 765          

HSP 3 Score: 59.6918 bits (143), Expect = 1.536e-10
Identity = 35/116 (30.17%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A ++G     +R      +  KD   R+  P+H A   G  ++V+ L++   ++ A D   + P+H AC+ GH+  V LL+    D  A   WN  P+H A I+G  +   +LL+H
Sbjct:  182 ACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 297          

HSP 4 Score: 57.7658 bits (138), Expect = 7.253e-10
Identity = 35/117 (29.91%), Postives = 56/117 (47.86%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +A K G     ++    E +  +D   R   P+H A    + E+ + L+EH  D+ A DK  + P+H A + GH     LLI++   + A   W   P+H A  +G ++   LLL H
Sbjct:  802 DAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAH 918          

HSP 5 Score: 54.6842 bits (130), Expect = 6.611e-9
Identity = 32/90 (35.56%), Postives = 42/90 (46.67%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            EYL    AD+         P+H A   GH +I  LLI++N  + A DKW   P+H A  KG +    LL+ H  D        Q P+ LA
Sbjct:  847 EYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLA 936          

HSP 6 Score: 53.9138 bits (128), Expect = 1.230e-8
Identity = 27/75 (36.00%), Postives = 36/75 (48.00%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL    AD+         P+H AC  GH E+ +LL+ H   +   D W   P+H A  KG     KLL++H  D
Sbjct:  694 EYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGAD 768          

HSP 7 Score: 51.9878 bits (123), Expect = 6.926e-8
Identity = 24/56 (42.86%), Postives = 31/56 (55.36%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GHAE+V LL+    D  A D WN  P+H A  KG      +L++H  D
Sbjct:  245 PLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAD 300          

HSP 8 Score: 51.2174 bits (121), Expect = 1.014e-7
Identity = 21/56 (37.50%), Postives = 30/56 (53.57%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GH E+ +LL++H   + A D W   P+H A +K       LL+ H  D
Sbjct:  398 PLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGAD 453          
BLAST of SMED30006877 vs. UniProt/SwissProt
Match: sp|Q3UES3|TNKS2_MOUSE (Poly [ADP-ribose] polymerase tankyrase-2 OS=Mus musculus OX=10090 GN=Tnks2 PE=2 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 1.589e-13
Identity = 37/116 (31.90%), Postives = 64/116 (55.17%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A ++G  E  +R    E +  +D   R+  P+H A   G  ++V+ L+++  +++A D   + P+H AC+ GH+  V LL++H  D  A   WN  P+H A I+G  +   +LL+H
Sbjct:   31 ACRNGDVERVKRLVTPEKVNSRDTAGRKSTPLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLQHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 146          

HSP 2 Score: 67.781 bits (164), Expect = 1.480e-12
Identity = 36/116 (31.03%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A K+G  E  ++    + +  +D + R+  P+H A       +V+ L++H  D+ A DK  + P+H AC+ GH    +LL++H   +     W   P+H A  +G  E  KLLL+H
Sbjct:  499 AAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQH 614          

HSP 3 Score: 64.6994 bits (156), Expect = 2.041e-11
Identity = 36/116 (31.03%), Postives = 59/116 (50.86%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            + +SG+EE          +    +D R+  P+H A      +IV+LL+ H  D+ A DK ++ P+H AC+ GH    +LL++H   + A+  W   P+H A  +   E   LLL +
Sbjct:  184 SARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLHHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRIEVCSLLLSY 299          

HSP 4 Score: 55.8398 bits (133), Expect = 2.235e-8
Identity = 33/117 (28.21%), Postives = 56/117 (47.86%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +A K G     ++    + +  +D   R   P+H A    + E+ + L++H  D+ A DK  + P+H A + GH     LLI++   + A   W   P+H A  +G ++   LLL H
Sbjct:  651 DAAKKGCLARVKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAH 767          

HSP 5 Score: 53.9138 bits (128), Expect = 1.002e-7
Identity = 27/75 (36.00%), Postives = 38/75 (50.67%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL +  AD+         P+H AC  GH E+ +LL++H   +   D W   P+H A  KG     KLL++H  D
Sbjct:  543 EYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGAD 617          

HSP 6 Score: 52.7582 bits (125), Expect = 2.459e-7
Identity = 30/89 (33.71%), Postives = 42/89 (47.19%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHL 434
            EYL +  AD+         P+H A   GH ++  LLI++N  + A DKW   P+H A  KG +    LL+ H  D        Q P+ L
Sbjct:  696 EYLLQHGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQTPLDL 784          

HSP 7 Score: 52.373 bits (124), Expect = 3.182e-7
Identity = 25/71 (35.21%), Postives = 36/71 (50.70%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            P+H AC  GH E+ +LL++H   + A D W   P+H A +K       LL+ +  D   L   N+  I LA
Sbjct:  247 PLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRIEVCSLLLSYGADPTLLNCHNKSAIDLA 317          
BLAST of SMED30006877 vs. UniProt/SwissProt
Match: sp|Q9H2K2|TNKS2_HUMAN (Poly [ADP-ribose] polymerase tankyrase-2 OS=Homo sapiens OX=9606 GN=TNKS2 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.723e-13
Identity = 37/116 (31.90%), Postives = 63/116 (54.31%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A ++G  E  +R    E +  +D   R+  P+H A   G  ++V+ L+++  +++A D   + P+H AC+ GH+  V LL+ H  D  A   WN  P+H A I+G  +   +LL+H
Sbjct:   31 ACRNGDVERVKRLVTPEKVNSRDTAGRKSTPLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 146          

HSP 2 Score: 67.781 bits (164), Expect = 1.371e-12
Identity = 36/116 (31.03%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A K+G  E  ++    + +  +D + R+  P+H A       +V+ L++H  D+ A DK  + P+H AC+ GH    +LL++H   +     W   P+H A  +G  E  KLLL+H
Sbjct:  499 AAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQH 614          

HSP 3 Score: 65.855 bits (159), Expect = 7.884e-12
Identity = 36/116 (31.03%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            + +SG+EE          +    +D R+  P+H A      +IV+LL++H  D+ A DK ++ P+H AC+ GH    +LL++H   + A+  W   P+H A  +   E   LLL +
Sbjct:  184 SARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSY 299          

HSP 4 Score: 55.8398 bits (133), Expect = 2.130e-8
Identity = 33/117 (28.21%), Postives = 56/117 (47.86%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +A K G     ++    + +  +D   R   P+H A    + E+ + L++H  D+ A DK  + P+H A + GH     LLI++   + A   W   P+H A  +G ++   LLL H
Sbjct:  651 DAAKKGCLARVKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAH 767          

HSP 5 Score: 53.9138 bits (128), Expect = 9.374e-8
Identity = 27/75 (36.00%), Postives = 38/75 (50.67%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL +  AD+         P+H AC  GH E+ +LL++H   +   D W   P+H A  KG     KLL++H  D
Sbjct:  543 EYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGAD 617          

HSP 6 Score: 52.7582 bits (125), Expect = 2.322e-7
Identity = 30/89 (33.71%), Postives = 42/89 (47.19%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHL 434
            EYL +  AD+         P+H A   GH ++  LLI++N  + A DKW   P+H A  KG +    LL+ H  D        Q P+ L
Sbjct:  696 EYLLQHGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQTPLDL 784          

HSP 7 Score: 52.7582 bits (125), Expect = 2.413e-7
Identity = 25/71 (35.21%), Postives = 36/71 (50.70%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            P+H AC  GH E+ +LL++H   + A D W   P+H A +K       LL+ +  D   L   N+  I LA
Sbjct:  247 PLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHNKSAIDLA 317          
BLAST of SMED30006877 vs. UniProt/SwissProt
Match: sp|Q505D1|ANR28_MOUSE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus OX=10090 GN=Ankrd28 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 6.790e-13
Identity = 34/87 (39.08%), Postives = 48/87 (55.17%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            R  +H A F+GH E+VKLL+    +I AFDK + R IH+A   GH   VKLL+ H  ++      +  P+H A   G    +K LL+
Sbjct:  141 RTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLD 227          

HSP 2 Score: 63.929 bits (154), Expect = 3.395e-11
Identity = 31/95 (32.63%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
             ++KD   RR IH A + GH E+VKLL+ H  ++   DK +  P+H A + G  + VK L++   D+     +   P+H+AC  G    +  L++
Sbjct:  169 FDKKD---RRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELID 260          

HSP 3 Score: 57.3806 bits (137), Expect = 5.369e-9
Identity = 35/108 (32.41%), Postives = 56/108 (51.85%), Query Frame = 3
Query:  117 RDFHLFSNAVKSGSEELFRRY-FKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            RD      A+ +G  +  R   FK+E +  +D + R P+H A + G AEI++LLI     + A D   + P+H A       AV++L++H  D+ A     Q P+H+A
Sbjct:    7 RDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIA 114          

HSP 4 Score: 53.1434 bits (126), Expect = 1.956e-7
Identity = 34/115 (29.57%), Postives = 54/115 (46.96%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEY-LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            AV S SEE  +   K    +  +D + + P+H A      +  + L+    ++   D+     +H+A   GH   VKLL+    +I A    ++R IH A   GH E +KLL+ H
Sbjct:   81 AVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSH 195          

HSP 5 Score: 52.373 bits (124), Expect = 3.435e-7
Identity = 29/110 (26.36%), Postives = 49/110 (44.55%), Query Frame = 3
Query:  153 GSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEH-KCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            G+ E+         +   D+  R P+H A F  H E ++LL+  N  + + D     P+  A   G +  V++L+     D+          +HLAC +GH  +  L+LE
Sbjct:  802 GAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILE 911          

HSP 6 Score: 50.447 bits (119), Expect = 1.610e-6
Identity = 30/94 (31.91%), Postives = 49/94 (52.13%), Query Frame = 3
Query:  207 DADLR---RPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLL 476
            D+D R    P+H A + GH + +++L++   D++  +     P+  A  KGH   V +LI     I    +  +R PIH A   GHSE ++LL+
Sbjct:  544 DSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLI 637          

HSP 7 Score: 49.2914 bits (116), Expect = 3.289e-6
Identity = 30/97 (30.93%), Postives = 48/97 (49.48%), Query Frame = 3
Query:  204 KDADLRR-PIHQACFAGHAEIVKLLI---EHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            KD  L+R PIH A   GH+E ++LLI   E    ++  D     P+  +   GH+  V  L+    +++A   W +  +H   + GH E +  LL+H
Sbjct:  612 KDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQH 708          
BLAST of SMED30006877 vs. UniProt/SwissProt
Match: sp|O15084|ANR28_HUMAN (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5)

HSP 1 Score: 68.5514 bits (166), Expect = 7.334e-13
Identity = 34/87 (39.08%), Postives = 48/87 (55.17%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            R  +H A F+GH E+VKLL+    +I AFDK + R IH+A   GH   VKLL+ H  ++      +  P+H A   G    +K LL+
Sbjct:  141 RTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLD 227          

HSP 2 Score: 63.929 bits (154), Expect = 3.562e-11
Identity = 31/95 (32.63%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
             ++KD   RR IH A + GH E+VKLL+ H  ++   DK +  P+H A + G  + VK L++   D+     +   P+H+AC  G    +  L++
Sbjct:  169 FDKKD---RRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELID 260          

HSP 3 Score: 57.3806 bits (137), Expect = 6.953e-9
Identity = 35/108 (32.41%), Postives = 56/108 (51.85%), Query Frame = 3
Query:  117 RDFHLFSNAVKSGSEELFRRY-FKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            RD      A+ +G  +  R   FK+E +  +D + R P+H A + G AEI++LLI     + A D   + P+H A       AV++L++H  D+ A     Q P+H+A
Sbjct:    7 RDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIA 114          

HSP 4 Score: 54.299 bits (129), Expect = 6.276e-8
Identity = 31/111 (27.93%), Postives = 51/111 (45.95%), Query Frame = 3
Query:  153 GSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR--PIHLACIQGHSETIKLLLE 479
            G+ E+         +   D+  R P+H A F  H E ++LL+ HN  + + D     P+  A   G +  V++L+      E     N +   +HLAC +GH  +  L+LE
Sbjct:  802 GAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVS-SASAELTLQDNSKNTALHLACSKGHETSALLILE 911          

HSP 5 Score: 53.5286 bits (127), Expect = 1.261e-7
Identity = 34/115 (29.57%), Postives = 54/115 (46.96%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEY-LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            AV S SEE  +   K    +  +D + + P+H A      +  + L+    ++   D+     +H+A   GH   VKLL+    +I A    ++R IH A   GH E +KLL+ H
Sbjct:   81 AVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSH 195          

HSP 6 Score: 50.447 bits (119), Expect = 1.580e-6
Identity = 30/94 (31.91%), Postives = 49/94 (52.13%), Query Frame = 3
Query:  207 DADLR---RPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLL 476
            D+D R    P+H A + GH + +++L++   D++  +     P+  A  KGH   V +LI     I    +  +R PIH A   GHSE ++LL+
Sbjct:  544 DSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLI 637          

HSP 7 Score: 49.2914 bits (116), Expect = 3.416e-6
Identity = 30/97 (30.93%), Postives = 48/97 (49.48%), Query Frame = 3
Query:  204 KDADLRR-PIHQACFAGHAEIVKLLI---EHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            KD  L+R PIH A   GH+E ++LLI   E    ++  D     P+  +   GH+  V  L+    +++A   W +  +H   + GH E +  LL+H
Sbjct:  612 KDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQH 708          
BLAST of SMED30006877 vs. UniProt/SwissProt
Match: sp|O95271|TNKS1_HUMAN (Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 7.782e-13
Identity = 38/116 (32.76%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A +SG+EE          +    +D R+  P+H A       IV+LL++H  D+ A DK  + P+H AC+ GH    +LL++H   + A+  W   P+H A  +   E   LLL H
Sbjct:  342 AARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSH 457          

HSP 2 Score: 67.781 bits (164), Expect = 1.413e-12
Identity = 38/123 (30.89%), Postives = 60/123 (48.78%), Query Frame = 3
Query:  120 DFHLFSNAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            D+ L   A K+G  E  ++    + +  +D + R   P+H A       +V+ L+ H  D+ A DK  + P+H AC+ GH    +LL+ H   +     W   P+H A  +G  E  KLLL+H
Sbjct:  651 DYRLLE-ASKAGDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKH 772          

HSP 3 Score: 60.077 bits (144), Expect = 7.987e-10
Identity = 35/116 (30.17%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A ++G     +R      +  KD   R+  P+H A   G  ++V+ L++   ++ A D   + P+H AC+ GH+  V LL+    D  A   WN  P+H A I+G  +   +LL+H
Sbjct:  189 ACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 304          

HSP 4 Score: 57.7658 bits (138), Expect = 3.957e-9
Identity = 35/117 (29.91%), Postives = 56/117 (47.86%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +A K G     ++    E +  +D   R   P+H A    + E+ + L+EH  D+ A DK  + P+H A + GH     LLI++   + A   W   P+H A  +G ++   LLL H
Sbjct:  809 DAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAH 925          

HSP 5 Score: 55.0694 bits (131), Expect = 3.473e-8
Identity = 32/90 (35.56%), Postives = 42/90 (46.67%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            EYL    AD+         P+H A   GH +I  LLI++N  + A DKW   P+H A  KG +    LL+ H  D        Q P+ LA
Sbjct:  854 EYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLA 943          

HSP 6 Score: 54.299 bits (129), Expect = 6.589e-8
Identity = 27/75 (36.00%), Postives = 36/75 (48.00%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL    AD+         P+H AC  GH E+ +LL+ H   +   D W   P+H A  KG     KLL++H  D
Sbjct:  701 EYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGAD 775          

HSP 7 Score: 52.373 bits (124), Expect = 3.746e-7
Identity = 24/56 (42.86%), Postives = 31/56 (55.36%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GHAE+V LL+    D  A D WN  P+H A  KG      +L++H  D
Sbjct:  252 PLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAD 307          

HSP 8 Score: 51.6026 bits (122), Expect = 5.592e-7
Identity = 21/56 (37.50%), Postives = 30/56 (53.57%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GH E+ +LL++H   + A D W   P+H A +K       LL+ H  D
Sbjct:  405 PLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGAD 460          
BLAST of SMED30006877 vs. TrEMBL
Match: A0A0C9TTI6 (Unplaced genomic scaffold PAXINscaffold_28, whole genome shotgun sequence (Fragment) OS=Paxillus involutus ATCC 200175 OX=664439 GN=PAXINDRAFT_49201 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.145e-18
Identity = 35/86 (40.70%), Postives = 56/86 (65.12%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            R P+H+AC  GH EIV+LL++   D++A D ++  P+H AC+ GH   V+LL++   D+     +++ P+H + + GH E IKLLL
Sbjct:    1 RTPLHRACDGGHLEIVELLVQKGADVDAQDSYSRTPLHLACSSGHLKIVELLVQKGADVNVQDSYSRTPLHFSSMTGHLEVIKLLL 86          

HSP 2 Score: 55.4546 bits (132), Expect = 4.468e-7
Identity = 26/75 (34.67%), Postives = 42/75 (56.00%), Query Frame = 3
Query:  189 EYLERKDADL-------RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            E L +K AD+       R P+H AC +GH +IV+LL++   D+   D ++  P+H++   GH   +KLL+    D
Sbjct:   17 ELLVQKGADVDAQDSYSRTPLHLACSSGHLKIVELLVQKGADVNVQDSYSRTPLHFSSMTGHLEVIKLLLAEGAD 91          
BLAST of SMED30006877 vs. TrEMBL
Match: A0A182H2I6 (Uncharacterized protein OS=Aedes albopictus OX=7160 GN=RP20_CCG020406 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 9.874e-18
Identity = 36/84 (42.86%), Postives = 59/84 (70.24%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H AC  GH E+V++LI+   +++  D+  + P+H+AC+KGH   V++LI  + +I ALA+ N  P+HLAC+ GH E +K+L+
Sbjct: 1138 PLHLACLNGHKEVVEILIKEKANVDTLDERKLTPLHFACHKGHKEVVEVLIREEANINALAFENFTPLHLACLNGHKEVVKVLI 1221          

HSP 2 Score: 85.1149 bits (209), Expect = 4.140e-16
Identity = 36/84 (42.86%), Postives = 56/84 (66.67%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H ACF GH E+V++L+    +I+A +  N  P+H AC  GH   V++LI  K +++ALA+ N  P+HLAC+ GH E  ++L+
Sbjct: 1534 PLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLI 1617          

HSP 3 Score: 85.1149 bits (209), Expect = 4.140e-16
Identity = 36/84 (42.86%), Postives = 56/84 (66.67%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H ACF GH E+V++L+    +I+A +  N  P+H AC  GH   V++LI  K +++ALA+ N  P+HLAC+ GH E  ++L+
Sbjct: 1666 PLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLI 1749          

HSP 4 Score: 85.1149 bits (209), Expect = 4.140e-16
Identity = 36/84 (42.86%), Postives = 56/84 (66.67%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H ACF GH E+V++L+    +I+A +  N  P+H AC  GH   V++LI  K +++ALA+ N  P+HLAC+ GH E  ++L+
Sbjct: 1930 PLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLI 2013          

HSP 5 Score: 83.5741 bits (205), Expect = 1.383e-15
Identity = 34/84 (40.48%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H AC  GH E+V++L+    +I+A D+    P+H AC  GH   V++LI  K +I+A+A  N  P+HLAC+ G  E +++L+
Sbjct: 1336 PLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLI 1419          

HSP 6 Score: 83.1889 bits (204), Expect = 1.920e-15
Identity = 44/113 (38.94%), Postives = 65/113 (57.52%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            N  K  +E L R+      L+ K A    P+H AC  GH E+V++LI    +I+A D  N  P+H AC  GH   V++L+  K +I+AL + N  P+HLAC  GH E +++L+
Sbjct: 1607 NGHKEVAEVLIRKVANVNALDEKKA---TPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILI 1716          

HSP 7 Score: 83.1889 bits (204), Expect = 1.920e-15
Identity = 44/113 (38.94%), Postives = 65/113 (57.52%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            N  K  +E L R+      L+ K A    P+H AC  GH E+V++LI    +I+A D  N  P+H AC  GH   V++L+  K +I+AL + N  P+HLAC  GH E +++L+
Sbjct: 1871 NGHKEVAEVLIRKVANVNALDEKKA---TPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILI 1980          

HSP 8 Score: 83.1889 bits (204), Expect = 1.996e-15
Identity = 44/113 (38.94%), Postives = 63/113 (55.75%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            N  K  +E L R     + LE K+     P+H AC  GH E+V++LI    +I+A    N  P+H AC  G    VK+L+  K +I ALA  N  P+HLAC+ GH E +++L+
Sbjct: 1244 NGHKEVAEILIREKSNIDALELKNC---TPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILV 1353          

HSP 9 Score: 82.4185 bits (202), Expect = 3.630e-15
Identity = 37/84 (44.05%), Postives = 53/84 (63.10%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H AC  GH E+VK+LI    +IEA    N  P+H AC  GH    ++LI  K +I+AL   N  P+HLAC+ GH+E +++L+
Sbjct: 1204 PLHLACLNGHKEVVKVLIREKANIEALALENCTPLHLACLNGHKEVAEILIREKSNIDALELKNCTPLHLACLNGHNEVVEILI 1287          

HSP 10 Score: 82.4185 bits (202), Expect = 3.921e-15
Identity = 44/110 (40.00%), Postives = 63/110 (57.27%), Query Frame = 3
Query:  150 SGSEELFRRYFKEEY-LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            +G +E+     KE+  ++  D     P+H AC  GH E+V++LI    +I A    N  P+H AC  GH   VK+LI  K +IEALA  N  P+HLAC+ GH E  ++L+
Sbjct: 1145 NGHKEVVEILIKEKANVDTLDERKLTPLHFACHKGHKEVVEVLIREEANINALAFENFTPLHLACLNGHKEVVKVLIREKANIEALALENCTPLHLACLNGHKEVAEILI 1254          

HSP 11 Score: 82.0333 bits (201), Expect = 5.339e-15
Identity = 44/113 (38.94%), Postives = 64/113 (56.64%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            N  K  +E L R+      L+ K A    P+H AC  GH E+V++LI    +I A D  N  P+H AC  GH   V++L+  K +I+AL + N  P+HLAC  GH E +++L+
Sbjct: 1475 NGHKEVAEVLIRKVANVNALDEKKA---TPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILI 1584          

HSP 12 Score: 80.1073 bits (196), Expect = 2.597e-14
Identity = 35/84 (41.67%), Postives = 53/84 (63.10%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H AC  GH E+ ++LI    +I+A +  N  P+H AC  GH+  V++LI  K +I+A+A  N  P+HLAC  G  E +K+L+
Sbjct: 1237 PLHLACLNGHKEVAEILIREKSNIDALELKNCTPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLV 1320          

HSP 13 Score: 79.337 bits (194), Expect = 4.631e-14
Identity = 44/112 (39.29%), Postives = 61/112 (54.46%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLL 473
            N  K  +E L R+      L+ K A    P+H AC  GH E+V++LI     I+A    N  P+H AC  G    V++LI  K +I+ALA  N  PIHLA + GH E +++L
Sbjct: 1739 NGHKEVAEVLIRKVANVNALDEKKA---TPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEIL 1847          

HSP 14 Score: 79.337 bits (194), Expect = 4.631e-14
Identity = 44/112 (39.29%), Postives = 61/112 (54.46%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLL 473
            N  K  +E L R+      L+ K A    P+H AC  GH E+V++LI     I+A    N  P+H AC  G    V++LI  K +I+ALA  N  PIHLA + GH E +++L
Sbjct: 2003 NGHKEVAEVLIRKVANVNALDEKKA---TPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEIL 2111          

HSP 15 Score: 79.337 bits (194), Expect = 4.907e-14
Identity = 33/84 (39.29%), Postives = 51/84 (60.71%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H AC  GH E+ ++LI    ++ A D+    P+H AC  GH   V++LI  K  I+A+A  N  P+HLAC+ G  E +++L+
Sbjct: 1732 PLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLI 1815          

HSP 16 Score: 79.337 bits (194), Expect = 4.907e-14
Identity = 33/84 (39.29%), Postives = 51/84 (60.71%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H AC  GH E+ ++LI    ++ A D+    P+H AC  GH   V++LI  K  I+A+A  N  P+HLAC+ G  E +++L+
Sbjct: 1996 PLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLI 2079          

HSP 17 Score: 78.1814 bits (191), Expect = 1.157e-13
Identity = 33/84 (39.29%), Postives = 51/84 (60.71%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H AC  GH E+ ++LI    ++ A D+    P+H AC  GH   V++LI  K +I+A  + N  P+HLAC  GH E +++L+
Sbjct: 1600 PLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILV 1683          

HSP 18 Score: 78.1814 bits (191), Expect = 1.157e-13
Identity = 33/84 (39.29%), Postives = 51/84 (60.71%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H AC  GH E+ ++LI    ++ A D+    P+H AC  GH   V++LI  K +I+A  + N  P+HLAC  GH E +++L+
Sbjct: 1864 PLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILV 1947          

HSP 19 Score: 77.0258 bits (188), Expect = 3.215e-13
Identity = 33/84 (39.29%), Postives = 50/84 (59.52%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H AC  GH E+ ++LI    ++ A D+    P+H AC  GH   V++LI  K +I A  + N  P+HLAC  GH E +++L+
Sbjct: 1468 PLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILV 1551          

HSP 20 Score: 76.6406 bits (187), Expect = 4.052e-13
Identity = 43/112 (38.39%), Postives = 61/112 (54.46%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLL 473
            N  K   E L R     + L+ K +    P+H AC  GH E+V++LI    +I+A    N  P+H AC  G    V++LI  K +I+ALA  N  PIHLA + GH E +++L
Sbjct: 1343 NGHKEVVEILVREKANIDALDEKKS---TPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEIL 1451          

HSP 21 Score: 73.9442 bits (180), Expect = 3.185e-12
Identity = 33/84 (39.29%), Postives = 51/84 (60.71%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H AC  GH EIV++LI    +I+A    N  P+H AC  GH   V++LI+ K +++ L      P+H AC +GH E +++L+
Sbjct: 1105 PLHLACLNGHKEIVEILIRRKANIDALALENSTPLHLACLNGHKEVVEILIKEKANVDTLDERKLTPLHFACHKGHKEVVEVLI 1188          

HSP 22 Score: 73.1738 bits (178), Expect = 5.567e-12
Identity = 33/84 (39.29%), Postives = 49/84 (58.33%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H AC  G  E+VK+L+    +I A    N  P+H AC  GH   V++L+  K +I+AL      P+HLAC  GH E +++L+
Sbjct: 1303 PLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILI 1386          

HSP 23 Score: 71.2478 bits (173), Expect = 2.916e-11
Identity = 33/84 (39.29%), Postives = 49/84 (58.33%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H AC  G  E+V++LI    +I+A    N  PIH A   GH   V++L   K +I+A  + N  P+HLAC+ GH E  ++L+
Sbjct: 1798 PLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLI 1881          

HSP 24 Score: 70.8626 bits (172), Expect = 4.084e-11
Identity = 33/84 (39.29%), Postives = 49/84 (58.33%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H AC  G  E+V++LI    +I+A    N  PIH A   GH   V++L   K +I+A  + N  P+HLAC+ GH E  ++L+
Sbjct: 1402 PLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLI 1485          

HSP 25 Score: 68.9366 bits (167), Expect = 1.941e-10
Identity = 32/84 (38.10%), Postives = 47/84 (55.95%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            PIH A   GH E+V++L     +I+A D  N  P+H AC  GH    ++LI    ++ AL      P+HLAC  GH E +++L+
Sbjct: 1831 PIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILI 1914          

HSP 26 Score: 68.5514 bits (166), Expect = 2.718e-10
Identity = 32/84 (38.10%), Postives = 47/84 (55.95%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            PIH A   GH E+V++L     +I+A D  N  P+H AC  GH    ++LI    ++ AL      P+HLAC  GH E +++L+
Sbjct: 1435 PIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILI 1518          

HSP 27 Score: 68.1662 bits (165), Expect = 3.326e-10
Identity = 32/86 (37.21%), Postives = 50/86 (58.14%), Query Frame = 3
Query:  222 RPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            +P  Q    G+     ++I+ N +I A    N  P+H AC  GH   V++LI  K +I+ALA  N  P+HLAC+ GH E +++L++
Sbjct: 1071 KPPLQFSLFGNKGAEDIIIKGNVNIGALTHENCTPLHLACLNGHKEIVEILIRRKANIDALALENSTPLHLACLNGHKEVVEILIK 1156          
BLAST of SMED30006877 vs. TrEMBL
Match: A0A1X7T5X6 (Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.574e-17
Identity = 47/118 (39.83%), Postives = 69/118 (58.47%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEY--LERKDADLRRPIHQACFAGHAEIVKLLIEH-NCDIEAFDKWNIRPIHYACNKGHSAAVK-LLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A +SG+ ++      +++  +  K  D   P+H AC  GH EIVK+L  H  C+IEA D WN RP+H AC  G+   V+ L+I+  CD+ A+ W    P+H AC +GH E +K+L  H
Sbjct:  221 ACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNH 338          

HSP 2 Score: 87.4261 bits (215), Expect = 5.793e-17
Identity = 47/118 (39.83%), Postives = 68/118 (57.63%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEY--LERKDADLRRPIHQACFAGHAEIVKLLIEH-NCDIEAFDKWNIRPIHYACNKGHSAAVK-LLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A +SG+ ++ R     ++  +  KD     P+H AC  GH E VK+L  H  C+IEA D WN RP+H AC  G+   V+ L+I+  CD+ A+ W    P+H AC +GH E +K+L  H
Sbjct:  561 ACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNH 678          

HSP 3 Score: 83.5741 bits (205), Expect = 1.587e-15
Identity = 41/96 (42.71%), Postives = 64/96 (66.67%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVK-LLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEH-KCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            LE + +   RP+H+AC +G+ +IV+ L+I+ +CD+ A D+    P+HYAC KGH   VK+L  H +C+IEA   WN RP+H AC  G+ + ++ L+
Sbjct:  683 LEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLV 778          

HSP 4 Score: 83.1889 bits (204), Expect = 2.290e-15
Identity = 41/96 (42.71%), Postives = 63/96 (65.62%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVK-LLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEH-KCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            LE + +   RP+H+AC +G+ +IV+ L+I  +CD+ A D+    P+HYAC KGH   VK+L  H +C+IEA   WN RP+H AC  G+ + ++ L+
Sbjct:  547 LEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLV 642          

HSP 5 Score: 82.8037 bits (203), Expect = 2.777e-15
Identity = 41/96 (42.71%), Postives = 63/96 (65.62%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVK-LLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEH-KCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            LE + +   RP+H+AC +G+ +IV+ L+I  +CD+ A D+    P+HYAC KGH   VK+L  H +C+IEA   WN RP+H AC  G+ + ++ L+
Sbjct:  343 LEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLV 438          

HSP 6 Score: 81.6481 bits (200), Expect = 7.873e-15
Identity = 46/118 (38.98%), Postives = 66/118 (55.93%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEY--LERKDADLRRPIHQACFAGHAEIVKLLIEH-NCDIEAFDKWNIRPIHYACNKGHSAAVK-LLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A +SG+ ++ R    +++  +  KD     P+H AC  GH E VK+L  H  C+IEA D WN RP+H AC  G+   V+ L+I+  CD+ A       P+H AC +GH E +K L  H
Sbjct:  697 ACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNH 814          

HSP 7 Score: 81.2629 bits (199), Expect = 9.828e-15
Identity = 46/118 (38.98%), Postives = 66/118 (55.93%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEY--LERKDADLRRPIHQACFAGHAEIVKLLIEH-NCDIEAFDKWNIRPIHYACNKGHSAAVK-LLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A +SG+ ++ R     ++  +  KD     P+H AC  GH E VK+L  H  C+IEA D WN RP+H AC  G+   V+ L+I+  CD+ A       P+H AC +GH E +K+L  H
Sbjct:  357 ACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTNH 474          

HSP 8 Score: 79.337 bits (194), Expect = 4.340e-14
Identity = 39/88 (44.32%), Postives = 54/88 (61.36%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEH-NCDIEAFDKWNIRPIHYACNKGHSAAVK-LLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H AC  GH EIVK+L  H  C+IE    +N RP+H AC  G+   V+ L+I+  CD+ A+ W    P+H AC +GH E +K+L  H
Sbjct:  115 PLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNH 202          

HSP 9 Score: 78.9518 bits (193), Expect = 5.212e-14
Identity = 39/87 (44.83%), Postives = 58/87 (66.67%), Query Frame = 3
Query:  222 RPIHQACFAGHAEIV-KLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEH-KCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            RP+H+AC +G+ +IV  L+I+ +CD+ A  K    P+HYAC KGH   VK+L  H +C+IEA   WN RP+H AC  G+ + ++ L+
Sbjct:  216 RPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLV 302          

HSP 10 Score: 78.5666 bits (192), Expect = 7.165e-14
Identity = 38/96 (39.58%), Postives = 62/96 (64.58%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVK-LLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEH-KCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            +E +D    RP+H AC +G+ +IV+ L+I+ +CD+ A  +    P+HYAC KGH   VK+L  H +C++EA   +N RP+H AC  G+ + ++ L+
Sbjct:  479 IEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLV 574          

HSP 11 Score: 77.411 bits (189), Expect = 2.171e-13
Identity = 45/119 (37.82%), Postives = 68/119 (57.14%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEY--LERKDADLRRPIHQACFAGHAEIVKLLIEHN-CDIEAFDKWNIRPIHYACNKGHSAAVK-LLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            NA +SG+ ++ R    +++  +  K      P+H AC  GH EIVK+L  H+ C++EA   +N RP+H AC  G+   V+ L+I   CD+ A       P+H AC +GH ET+K+L  H
Sbjct:  492 NACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNH 610          

HSP 12 Score: 75.8702 bits (185), Expect = 7.673e-13
Identity = 47/127 (37.01%), Postives = 69/127 (54.33%), Query Frame = 3
Query:  114 NRDFHLFSNAVKSGSEELFRRYFKEEY--LERKDADLRRPIHQACFAGHAEIVKLLIEH-NCDIEAFDKWNIRPIHYACNKGHSAAVK-LLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            NR  H    A +SG+ ++ R    +++  +  K  +   P+H AC  GH EIVK+L  H  C+IEA D    RP+H AC  G+   V+ L+I+  CD+ A       P+H AC +GH E +K+L  H
Sbjct:  419 NRPLH---KACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKILTNH 542          

HSP 13 Score: 75.8702 bits (185), Expect = 7.975e-13
Identity = 46/127 (36.22%), Postives = 71/127 (55.91%), Query Frame = 3
Query:  114 NRDFHLFSNAVKSGSEELFRRYFKEEYLERKDA--DLRRPIHQACFAGHAEIVKLLIEHN-CDIEAFDKWNIRPIHYACNKGHSAAVK-LLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            NR  H    A +SG+ ++ R    +++ +      +   P+H AC  GH EIVK+L  H+ C++EA   +N RP+H AC  G+   V+ L+I+  CD+ A       P+H AC +GH ET+K+L  H
Sbjct:  623 NRPLH---KACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNH 746          

HSP 14 Score: 75.0998 bits (183), Expect = 1.395e-12
Identity = 46/127 (36.22%), Postives = 70/127 (55.12%), Query Frame = 3
Query:  114 NRDFHLFSNAVKSGSEELFRRYFKEEYLERKDA--DLRRPIHQACFAGHAEIVKLLIEHN-CDIEAFDKWNIRPIHYACNKGHSAAVK-LLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            NR  H    A +SG+ ++ R    +++ +      +   P+H AC  GH EIVK+L  H+ C++EA   +N RP+H AC  G+   V+ L+I   CD+ A       P+H AC +GH ET+K+L  H
Sbjct:  283 NRPLH---KACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNH 406          

HSP 15 Score: 74.7146 bits (182), Expect = 1.521e-12
Identity = 38/96 (39.58%), Postives = 62/96 (64.58%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVK-LLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEH-KCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            +E +D    RP+H+AC +G+ +IV+ L+I+ +CD+ A  +    P+HYAC KGH   VK+L  H +C+IEA  +   RP+H AC  G+ + ++ L+
Sbjct:  411 IEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLV 506          

HSP 16 Score: 74.7146 bits (182), Expect = 1.581e-12
Identity = 37/96 (38.54%), Postives = 61/96 (63.54%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIV-KLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEH-KCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            +E +D    RP+H+AC +G+ +IV  L+I+ +C++ A  +    P+HYAC KGH   VK+L  H +C+IE    +N RP+H AC  G+ + ++ L+
Sbjct:   71 IEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLV 166          

HSP 17 Score: 72.4034 bits (176), Expect = 1.183e-11
Identity = 38/88 (43.18%), Postives = 53/88 (60.23%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHN-CDIEAFDKWNIRPIHYACNKGHSAAV-KLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H AC  GH EIVK+L  H+ C++EA   +N RP+H AC  G+   V  L+I+  CD+ A       P+H AC +GH E +K+L  H
Sbjct:  183 PLHYACEKGHFEIVKILTNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNH 270          

HSP 18 Score: 68.1662 bits (165), Expect = 3.272e-10
Identity = 35/96 (36.46%), Postives = 59/96 (61.46%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVK-LLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEH-KCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            +E +D    RP+H+AC +G+ +IV+ L+I+ +CD+ A  +    P+HYAC KGH   VK L  H +C+ +A    + RP+H AC   + + ++ L+
Sbjct:  751 IEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNHPQCNTKAEDVCDDRPLHKACKSRNVDIVRYLV 846          

HSP 19 Score: 67.0106 bits (162), Expect = 8.642e-10
Identity = 36/88 (40.91%), Postives = 51/88 (57.95%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEH-NCDIEAFDKWNIRPIHYACNKGHSAAV-KLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H AC  G  EIV++L +H  C+IE  D  N RP+H AC  G+   V  L+I+  C++ A       P+H AC +GH E +K+L  H
Sbjct:   47 PLHYACEEGCFEIVRILTDHPQCNIEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNH 134          

HSP 20 Score: 65.0846 bits (157), Expect = 3.833e-9
Identity = 42/118 (35.59%), Postives = 63/118 (53.39%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEY--LERKDADLRRPIHQACFAGHAEIVKLLIEH-NCDIEAFDKWNIRPIHYACNKGHSAAVK-LLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A KS + ++ R    +++  +  K  D   P+H AC  GH EIVK+L  H  C+ EA D ++ R +H AC  G    V+ L+I+   D+ A       P+H AC +GH E +K+L  H
Sbjct:  833 ACKSRNVDIVRYLVIDKHRDVNAKGRDGYTPLHYACEKGHFEIVKILTNHPQCNTEAEDVYDDRSLHKACEFGRLDIVRYLVIDKHRDVNAKGRNGYTPLHYACEKGHFEIVKILTNH 950          

HSP 21 Score: 64.3142 bits (155), Expect = 7.581e-9
Identity = 43/127 (33.86%), Postives = 66/127 (51.97%), Query Frame = 3
Query:  114 NRDFHLFSNAVKSGSEELFRRYFKEEY--LERKDADLRRPIHQACFAGHAEIVKLLIEH-NCDIEAFDKWNIRPIHYACNKGHSAAVK-LLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            NR  H    A +SG+ ++ R    +++  +  K  +   P+H AC  GH EIVK L  H  C+ +A D  + RP+H AC   +   V+ L+I+   D+ A       P+H AC +GH E +K+L  H
Sbjct:  759 NRPLH---KACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNHPQCNTKAEDVCDDRPLHKACKSRNVDIVRYLVIDKHRDVNAKGRDGYTPLHYACEKGHFEIVKILTNH 882          

HSP 22 Score: 60.8474 bits (146), Expect = 1.180e-7
Identity = 32/87 (36.78%), Postives = 54/87 (62.07%), Query Frame = 3
Query:  222 RPIHQACFAGHAEIVK-LLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEH-KCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            RP+H+AC + + +IV+ L+I+ + D+ A  +    P+HYAC KGH   VK+L  H +C+ EA   ++ R +H AC  G  + ++ L+
Sbjct:  828 RPLHKACKSRNVDIVRYLVIDKHRDVNAKGRDGYTPLHYACEKGHFEIVKILTNHPQCNTEAEDVYDDRSLHKACEFGRLDIVRYLV 914          

HSP 23 Score: 56.225 bits (134), Expect = 3.970e-6
Identity = 34/82 (41.46%), Postives = 50/82 (60.98%), Query Frame = 3
Query:  198 ERKDADLRRPIHQACFAGHAEIVK-LLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEH-KCDIEALAWWNQRPIHLA 437
            E +D    R +H+AC  G  +IV+ L+I+ + D+ A  +    P+HYAC KGH   VK+L  H +C+IEA    N+ P+HLA
Sbjct:  888 EAEDVYDDRSLHKACEFGRLDIVRYLVIDKHRDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAENNDNKWPLHLA 969          
BLAST of SMED30006877 vs. TrEMBL
Match: A0A482W0Q4 (Ankryin repeat domain containing protein (Fragment) OS=Asbolus verrucosus OX=1661398 GN=BDFB_008426 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.691e-16
Identity = 43/91 (47.25%), Postives = 54/91 (59.34%), Query Frame = 3
Query:  213 DLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            ++  P H AC  GH E+VKLLIE N ++ A  K    P H+AC +GH   VKLLI    D+ A+A     P   AC QGH E +KLL+EHN
Sbjct: 1226 NVNTPFHIACEQGHYEVVKLLIECNVNVNAVSKNGYTPFHFACGQGHYELVKLLIGCDVDVNAVAEDGFTPFFFACEQGHYEVVKLLIEHN 1316          

HSP 2 Score: 82.4185 bits (202), Expect = 3.368e-15
Identity = 41/87 (47.13%), Postives = 52/87 (59.77%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P   AC  GH E+VKLLIEHN ++ A  K    P + AC +GH A VKLLI+   ++         P H+AC QGHSE +KLL+E N
Sbjct: 1296 PFFFACEQGHYEVVKLLIEHNVNVNAIAKDGCTPFYVACEQGHYAIVKLLIDCNVNVNVANQDGYTPFHIACRQGHSEVVKLLMECN 1382          

HSP 3 Score: 79.337 bits (194), Expect = 3.865e-14
Identity = 38/87 (43.68%), Postives = 54/87 (62.07%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P H AC  GH E+VKLL+E N ++    + ++ P ++AC +GH   VKLLI+   ++ A A     P H+AC QGH E +KLL+E N
Sbjct: 1164 PYHIACRQGHFEVVKLLLECNVNVNPTSENSLTPFYFACEQGHYEVVKLLIDCNVNVNAAAKNVNTPFHIACEQGHYEVVKLLIECN 1250          

HSP 4 Score: 78.9518 bits (193), Expect = 5.314e-14
Identity = 48/126 (38.10%), Postives = 65/126 (51.59%), Query Frame = 3
Query:  114 NRD-FHLFSNAVKSGSEELFRRYFKEEY-LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            N+D +  F  A + G  E+ R        +   + D   P+H AC  GH E+VKLLI++N D+ A  K +  P + AC +G+   VKLL     DI         P H+AC QGH E +KLLLE N
Sbjct: 1059 NKDCYTPFHVACQQGHSEIVRLLIDRNVNVNAANKDGCTPLHLACLKGHYEVVKLLIKNNVDVNAATKDDFTPFYIACERGYYEIVKLLSGCNIDINVANQDGLTPYHIACRQGHFEVVKLLLECN 1184          

HSP 5 Score: 77.7962 bits (190), Expect = 1.421e-13
Identity = 38/90 (42.22%), Postives = 56/90 (62.22%), Query Frame = 3
Query:  204 KDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLL 473
            ++ D   P H AC  GH+EIV+LLI+ N ++ A +K    P+H AC KGH   VKLLI++  D+ A    +  P ++AC +G+ E +KLL
Sbjct: 1058 ENKDCYTPFHVACQQGHSEIVRLLIDRNVNVNAANKDGCTPLHLACLKGHYEVVKLLIKNNVDVNAATKDDFTPFYIACERGYYEIVKLL 1147          

HSP 6 Score: 77.0258 bits (188), Expect = 2.871e-13
Identity = 37/87 (42.53%), Postives = 54/87 (62.07%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P + AC  GH  IVKLLI+ N ++   ++    P H AC +GHS  VKLL+E   ++ +++     P HLAC +GH E I+LL+E+N
Sbjct: 1329 PFYVACEQGHYAIVKLLIDCNVNVNVANQDGYTPFHIACRQGHSEVVKLLMECNVNVNSVSKNGLTPFHLACGEGHCELIELLIEYN 1415          

HSP 7 Score: 77.0258 bits (188), Expect = 3.254e-13
Identity = 38/87 (43.68%), Postives = 52/87 (59.77%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P H AC  GH E+VKLLI  + D+ A  +    P  +AC +GH   VKLLIEH  ++ A+A     P ++AC QGH   +KLL++ N
Sbjct: 1263 PFHFACGQGHYELVKLLIGCDVDVNAVAEDGFTPFFFACEQGHYEVVKLLIEHNVNVNAIAKDGCTPFYVACEQGHYAIVKLLIDCN 1349          

HSP 8 Score: 76.6406 bits (187), Expect = 3.318e-13
Identity = 36/92 (39.13%), Postives = 56/92 (60.87%), Query Frame = 3
Query:  210 ADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            AD   P + AC  GH E+VKLL ++  ++ +  K N    H AC +GH   +KLL+E+  D+ A +     P+H+AC +GH ET+K L+++N
Sbjct:  928 ADGFTPFYIACQQGHYEMVKLLFKYKANVNSTTKDNFTLFHIACQRGHYEIIKLLVEYHSDVNAASNDGYTPLHIACGKGHYETVKFLIDNN 1019          

HSP 9 Score: 76.2554 bits (186), Expect = 4.739e-13
Identity = 37/86 (43.02%), Postives = 50/86 (58.14%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P H AC  G+ +IVKLLI+ N ++ A +K    P H AC KGH   V+LLIEH     +       P ++AC QGH E +KLL ++
Sbjct:  867 PFHVACETGNCDIVKLLIDRNVNVNATNKDGCTPFHLACAKGHFEVVRLLIEHNVSANSTTADGFTPFYIACQQGHYEMVKLLFKY 952          

HSP 10 Score: 75.485 bits (184), Expect = 8.367e-13
Identity = 46/125 (36.80%), Postives = 62/125 (49.60%), Query Frame = 3
Query:  120 DFHLFSNAVKSGSEELFRRYFKEEYLERKDA---DLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            +F LF  A + G  E+ +     EY    +A   D   P+H AC  GH E VK LI++N D+ A  K    P    C +GH    KLL E   D+         P H+AC QGHSE ++LL++ N
Sbjct:  963 NFTLFHIACQRGHYEIIKLLV--EYHSDVNAASNDGYTPLHIACGKGHYETVKFLIDNNADVNAPTKDGFTPFCITCEQGHYEVAKLLTERNVDVNVENKDCYTPFHVACQQGHSEIVRLLIDRN 1085          

HSP 11 Score: 75.485 bits (184), Expect = 8.448e-13
Identity = 40/110 (36.36%), Postives = 59/110 (53.64%), Query Frame = 3
Query:  177 YFKEEYLERKDADLRRPIHQA-------CFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            Y   ++L   +AD+  P           C  GH E+ KLL E N D+   +K    P H AC +GHS  V+LLI+   ++ A       P+HLAC++GH E +KLL+++N
Sbjct: 1009 YETVKFLIDNNADVNAPTKDGFTPFCITCEQGHYEVAKLLTERNVDVNVENKDCYTPFHVACQQGHSEIVRLLIDRNVNVNAANKDGCTPLHLACLKGHYEVVKLLIKNN 1118          

HSP 12 Score: 75.0998 bits (183), Expect = 1.463e-12
Identity = 45/122 (36.89%), Postives = 60/122 (49.18%), Query Frame = 3
Query:  123 FHLFSNAVKSGSEELFRRYFK-EEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            F  F  A + G  E+ +  FK +  +     D     H AC  GH EI+KLL+E++ D+ A       P+H AC KGH   VK LI++  D+ A       P  + C QGH E  KLL E N
Sbjct:  931 FTPFYIACQQGHYEMVKLLFKYKANVNSTTKDNFTLFHIACQRGHYEIIKLLVEYHSDVNAASNDGYTPLHIACGKGHYETVKFLIDNNADVNAPTKDGFTPFCITCEQGHYEVAKLLTERN 1052          

HSP 13 Score: 74.7146 bits (182), Expect = 1.862e-12
Identity = 36/87 (41.38%), Postives = 51/87 (58.62%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P H AC  GH E+V+LLIEHN    +       P + AC +GH   VKLL ++K ++ +    N    H+AC +GH E IKLL+E++
Sbjct:  900 PFHLACAKGHFEVVRLLIEHNVSANSTTADGFTPFYIACQQGHYEMVKLLFKYKANVNSTTKDNFTLFHIACQRGHYEIIKLLVEYH 986          

HSP 14 Score: 74.7146 bits (182), Expect = 1.991e-12
Identity = 38/84 (45.24%), Postives = 50/84 (59.52%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P + AC  GH E+VKLLI+ N ++ A  K    P H AC +GH   VKLLIE   ++ A++     P H AC QGH E +KLL+
Sbjct: 1197 PFYFACEQGHYEVVKLLIDCNVNVNAAAKNVNTPFHIACEQGHYEVVKLLIECNVNVNAVSKNGYTPFHFACGQGHYELVKLLI 1280          

HSP 15 Score: 74.3294 bits (181), Expect = 2.323e-12
Identity = 35/87 (40.23%), Postives = 51/87 (58.62%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P H AC  GH+E+VKLL+E N ++ +  K  + P H AC +GH   ++LLIE+  ++ A       P   AC QG  E +KLL++ N
Sbjct: 1362 PFHIACRQGHSEVVKLLMECNVNVNSVSKNGLTPFHLACGEGHCELIELLIEYNVNVNAATEDGFTPFFCACEQGRYEVVKLLVKRN 1448          

HSP 16 Score: 72.7886 bits (177), Expect = 8.692e-12
Identity = 37/87 (42.53%), Postives = 51/87 (58.62%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            PI  AC  G  E+VK LI+ N +++A  K  + P H AC  G+   VKLLI+   ++ A       P HLAC +GH E ++LL+EHN
Sbjct:  834 PISVACQNGCYEVVKSLIDCNANVDAAGKNGLTPFHVACETGNCDIVKLLIDRNVNVNATNKDGCTPFHLACAKGHFEVVRLLIEHN 920          

HSP 17 Score: 70.0922 bits (170), Expect = 8.187e-11
Identity = 32/84 (38.10%), Postives = 47/84 (55.95%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P H AC  GH E+++LLIE+N ++ A  +    P   AC +G    VKLL++   D+ A       PIH+AC  GH   ++LL+
Sbjct: 1395 PFHLACGEGHCELIELLIEYNVNVNAATEDGFTPFFCACEQGRYEVVKLLVKRNVDVNAATKSGDTPIHVACFYGHYAVVQLLI 1478          

HSP 18 Score: 67.3958 bits (163), Expect = 5.938e-10
Identity = 35/87 (40.23%), Postives = 50/87 (57.47%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P + AC  G+ EIVKLL   N DI   ++  + P H AC +GH   VKLL+E   ++   +  +  P + AC QGH E +KLL++ N
Sbjct: 1131 PFYIACERGYYEIVKLLSGCNIDINVANQDGLTPYHIACRQGHFEVVKLLLECNVNVNPTSENSLTPFYFACEQGHYEVVKLLIDCN 1217          

HSP 19 Score: 63.929 bits (154), Expect = 1.030e-8
Identity = 36/86 (41.86%), Postives = 45/86 (52.33%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P   AC  G  E+VKLL++ N D+ A  K    PIH AC  GH A V+LLI    ++  L      PIH A    + E IKLL+ H
Sbjct: 1428 PFFCACEQGRYEVVKLLVKRNVDVNAATKSGDTPIHVACFYGHYAVVQLLINSGANVNCLNNHRNTPIHAASASDNLEIIKLLVIH 1513          

HSP 20 Score: 62.003 bits (149), Expect = 5.268e-8
Identity = 30/87 (34.48%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            PIH ACF GH  +V+LLI    ++   +     PIH A    +   +KLL+ H+  I  +      P+H AC +G++E ++ LL+ N
Sbjct: 1461 PIHVACFYGHYAVVQLLINSGANVNCLNNHRNTPIHAASASDNLEIIKLLVIHEGVINTIDEDGNSPLHHACEKGYAEVVQFLLDQN 1547          

HSP 21 Score: 58.9214 bits (141), Expect = 5.789e-7
Identity = 31/83 (37.35%), Postives = 46/83 (55.42%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLL 473
            PIH A  + + EI+KLL+ H   I   D+    P+H+AC KG++  V+ L++   D +      Q P  LA  +GH ET+ LL
Sbjct: 1494 PIHAASASDNLEIIKLLVIHEGVINTIDEDGNSPLHHACEKGYAEVVQFLLDQNADSQIRNKNGQTPSDLARQEGHFETVNLL 1576          
BLAST of SMED30006877 vs. TrEMBL
Match: A0A3B0WFS1 (ANK_REP_REGION domain-containing protein OS=hydrothermal vent metagenome OX=652676 GN=MNBD_GAMMA06-1894 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 5.549e-16
Identity = 34/90 (37.78%), Postives = 61/90 (67.78%), Query Frame = 3
Query:  213 DLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +L+ P+H+A F  +  IVK+L+ +N ++ A D+ N+ P+H    +G++ +VK+L+ +K DI A+  +++ P+H A + G  ETIKLLL +
Sbjct:  154 NLKTPLHKATFKNYTAIVKILLANNANVNARDENNMTPLHQTATQGNNESVKILLANKADINAIDNYDRSPLHYAALGGQDETIKLLLAN 243          

HSP 2 Score: 67.3958 bits (163), Expect = 5.202e-10
Identity = 31/96 (32.29%), Postives = 52/96 (54.17%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +  +D +   P+HQ    G+ E VK+L+ +  DI A D ++  P+HYA   G    +KLL+ +K DI A+       ++LA    H + + LLL++
Sbjct:  181 VNARDENNMTPLHQTATQGNNESVKILLANKADINAIDNYDRSPLHYAALGGQDETIKLLLANKADINAMRSGTTPVLNLAVANNHLKVVTLLLKN 276          
BLAST of SMED30006877 vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 69.3218 bits (168), Expect = 5.104e-14
Identity = 31/87 (35.63%), Postives = 52/87 (59.77%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P+H A  AGH E+ + L+++   ++A  K +  P+H A   GH   VKLL+EHK + ++       P+H+A  +GH+ T ++LL+ N
Sbjct:  415 PLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGN 501          

HSP 2 Score: 64.3142 bits (155), Expect = 3.184e-12
Identity = 32/86 (37.21%), Postives = 46/86 (53.49%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A F GH  IVK L++      A +     P+H A   GH    + L+++   ++A A  +Q P+H A   GH E +KLLLEH
Sbjct:  382 PLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEH 467          

HSP 3 Score: 58.151 bits (139), Expect = 4.003e-10
Identity = 29/95 (30.53%), Postives = 50/95 (52.63%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            ++ K  D + P+H A   GH E+VKLL+EH  + ++       P+H A  +GH+   ++L++       +      P+H+AC  G  +  +LLLE
Sbjct:  438 VDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLE 532          

HSP 4 Score: 57.7658 bits (138), Expect = 4.710e-10
Identity = 27/85 (31.76%), Postives = 43/85 (50.59%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            P+H A   GH  + K+L++      A       P+H AC K H  ++ LL++H   +EA+      P+H+A   GH   +K LL+
Sbjct:  316 PLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQ 400          

HSP 5 Score: 57.3806 bits (137), Expect = 7.603e-10
Identity = 27/87 (31.03%), Postives = 48/87 (55.17%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            PIH A    H + V+ L+++N +I+     ++ P+H A + GH    K+L++      A A     P+H+AC + H  ++ LLL+H+
Sbjct:  283 PIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHS 369          

HSP 6 Score: 53.9138 bits (128), Expect = 1.160e-8
Identity = 26/95 (27.37%), Postives = 50/95 (52.63%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            ++ +  D   P+H A   GH  ++++L++    I+A  K  + PIH A    H   V+ L+++  +I+ +   +  P+H+A   GH    K+LL+
Sbjct:  240 IDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLD 334          

HSP 7 Score: 53.5286 bits (127), Expect = 1.502e-8
Identity = 27/86 (31.40%), Postives = 44/86 (51.16%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H AC   H   + LL++H+  +EA  +  + P+H A   GH   VK L++      A     + P+H+A   GH E  + LL++
Sbjct:  349 PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQN 434          

HSP 8 Score: 52.7582 bits (125), Expect = 2.793e-8
Identity = 26/87 (29.89%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P+H A   G+  +V+LL++    I+A  K  + P+H A   GH   +++L++    I+A       PIH+A    H + ++ LL++N
Sbjct:  217 PLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYN 303          

HSP 9 Score: 51.9878 bits (123), Expect = 4.905e-8
Identity = 23/86 (26.74%), Postives = 42/86 (48.84%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H     GH  I  +L++    + +  +     +H AC+ G+   VK L++ +  +         P+H A  QGH++ + LLL+H
Sbjct:  651 PLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKH 736          

HSP 10 Score: 46.2098 bits (108), Expect = 5.192e-6
Identity = 24/84 (28.57%), Postives = 39/84 (46.43%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            P+H A   GHA   ++L++ N       K    P+H AC  G     +LL+E   +  A       P+H+A    + + +KLL+
Sbjct:  481 PLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV 564          

HSP 11 Score: 46.2098 bits (108), Expect = 5.292e-6
Identity = 24/86 (27.91%), Postives = 42/86 (48.84%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A    +  + +LL+    ++    K  I P+H A  +G+   V+LL++    I+A       P+H A   GH   I++LL+ 
Sbjct:  184 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQ 269          
BLAST of SMED30006877 vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 68.1662 bits (165), Expect = 1.402e-13
Identity = 30/87 (34.48%), Postives = 52/87 (59.77%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P+H A  AGH E+ + L+++   ++A  K +   +H A   GH   VKLL+EHK +  +       P+H+A  +GH++T+++LL+ N
Sbjct:  412 PLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMN 498          

HSP 2 Score: 62.003 bits (149), Expect = 1.553e-11
Identity = 31/86 (36.05%), Postives = 46/86 (53.49%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A F GH  IVK+L++      A +     P+H A   GH    + L+++   ++A A  +Q  +H A   GH E +KLLLEH
Sbjct:  379 PLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEH 464          

HSP 3 Score: 57.7658 bits (138), Expect = 5.288e-10
Identity = 25/86 (29.07%), Postives = 44/86 (51.16%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H     GH  I  +L++    + A  +    P+H AC+ G+   VK L++ + ++         P+H A  QGH++ + LLL+H
Sbjct:  643 PLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKH 728          

HSP 4 Score: 56.6102 bits (135), Expect = 1.404e-9
Identity = 27/86 (31.40%), Postives = 46/86 (53.49%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H AC   H  ++ LL++H+  +EA  +  + P+H A   GH   VK+L++      A     + P+H+A   GH E  + LL++
Sbjct:  346 PLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQN 431          

HSP 5 Score: 55.8398 bits (133), Expect = 2.589e-9
Identity = 28/95 (29.47%), Postives = 50/95 (52.63%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            ++ K  D   P+H A   GH  I+++L++    I+A  K  + PIH A    H   V+ L+++  +I+ +   +  P+H+A   GH    K+LL+
Sbjct:  237 IDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLD 331          

HSP 6 Score: 54.299 bits (129), Expect = 8.312e-9
Identity = 26/87 (29.89%), Postives = 46/87 (52.87%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            PIH A    H + V+ L+++N +I+     ++ P+H A + GH    K+L++        A     P+H+AC + H   + LLL+H+
Sbjct:  280 PIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHS 366          

HSP 7 Score: 53.1434 bits (126), Expect = 1.982e-8
Identity = 24/86 (27.91%), Postives = 43/86 (50.00%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A   G A++V LLI    ++   +K  + P+H    +GH     +L++    + A       P+H+AC  G+ + +K LL+ 
Sbjct:  610 PLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQ 695          

HSP 8 Score: 52.7582 bits (125), Expect = 2.716e-8
Identity = 28/95 (29.47%), Postives = 48/95 (50.53%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            ++ K  D +  +H A   GH E+VKLL+EH  +  +       P+H A  +GH+  V++L++       +      P+H+A   G  +  +LLLE
Sbjct:  435 VDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLE 529          

HSP 9 Score: 51.9878 bits (123), Expect = 5.298e-8
Identity = 26/87 (29.89%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P+H A   G+  +V+LL++    I+A  K  + P+H A   GH   +++L++    I+A       PIH+A    H + ++ LL++N
Sbjct:  214 PLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYN 300          

HSP 10 Score: 45.4394 bits (106), Expect = 9.178e-6
Identity = 24/86 (27.91%), Postives = 42/86 (48.84%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A    +  + +LL+    ++    K  I P+H A  +G+   V+LL++    I+A       P+H A   GH   I++LL+ 
Sbjct:  181 PLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQ 266          
BLAST of SMED30006877 vs. Ensembl Cavefish
Match: tnksa (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase a [Source:ZFIN;Acc:ZDB-GENE-030131-7450])

HSP 1 Score: 67.781 bits (164), Expect = 1.753e-13
Identity = 38/116 (32.76%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A +SG+EE          +    +D R+  P+H A       IV+LL++H  D+ A DK  + P+H AC+ GH    +LL++H   + A+  W   P+H A  +   E   LLL H
Sbjct:  286 AARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSH 401          

HSP 2 Score: 57.7658 bits (138), Expect = 4.472e-10
Identity = 35/122 (28.69%), Postives = 59/122 (48.36%), Query Frame = 3
Query:  123 FHLFSNAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            F     A ++G     +R      +  KD   R+  P+H A   G  ++V+ L++   ++ A D   + P+H AC+ GH+  V LL+    D  +   WN  P+H A I+G  +   +LL+H
Sbjct:  127 FRELFEACRNGDVSRVKRLVDSVNVNAKDMAGRKSTPLHFAAGFGRKDVVEHLLQTGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNSRDNWNYTPLHEAAIKGKIDVCIVLLQH 248          

HSP 3 Score: 50.8322 bits (120), Expect = 9.922e-8
Identity = 21/56 (37.50%), Postives = 30/56 (53.57%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GH E+ +LL++H   + A D W   P+H A +K       LL+ H  D
Sbjct:  349 PLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGAD 404          

HSP 4 Score: 50.447 bits (119), Expect = 1.742e-7
Identity = 23/56 (41.07%), Postives = 31/56 (55.36%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GHAE+V LL+    D  + D WN  P+H A  KG      +L++H  D
Sbjct:  196 PLHNACSFGHAEVVSLLLCQGADPNSRDNWNYTPLHEAAIKGKIDVCIVLLQHGAD 251          
BLAST of SMED30006877 vs. Ensembl Cavefish
Match: tnksb (tankyrase-1 [Source:NCBI gene;Acc:103045612])

HSP 1 Score: 67.0106 bits (162), Expect = 3.063e-13
Identity = 36/119 (30.25%), Postives = 58/119 (48.74%), Query Frame = 3
Query:  132 FSNAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            F  A K+G  +  ++    + +  +D + R   P+H A       +V+ L+ H  D+ A DK  + P+H AC+ GH    +LL+ H   +     W   P+H A  +G  E  KLLL+H
Sbjct:  570 FLEAAKAGDLDTVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKH 688          

HSP 2 Score: 63.929 bits (154), Expect = 3.352e-12
Identity = 31/89 (34.83%), Postives = 47/89 (52.81%), Query Frame = 3
Query:  216 LRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            L  P+H A       IV+LL+++  D+ A DK  + P+H AC+ GH    +LL++H   + A+  W   P+H A  +   E   LLL H
Sbjct:  274 LSTPLHLAAGYNRVRIVQLLLQYGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSH 362          

HSP 3 Score: 58.9214 bits (141), Expect = 2.239e-10
Identity = 35/122 (28.69%), Postives = 59/122 (48.36%), Query Frame = 3
Query:  123 FHLFSNAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            F     A ++G     +R      +  KD   R+  P+H A   G  ++V+ L++   ++ + D   + P+H AC+ GH+  V LL+    D  A   WN  P+H A I+G  +   +LL+H
Sbjct:   81 FRELFEACRNGDVSRVKRLVDAANVNAKDMAGRKSTPLHFAAGFGRKDVVEHLLQTGANVHSRDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 202          

HSP 4 Score: 55.4546 bits (132), Expect = 2.884e-9
Identity = 29/86 (33.72%), Postives = 44/86 (51.16%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A    + E+ + L+EH  D+ A DK  + P+H A + GH     LLI+    + A   W   P+H A  +G ++   LLL H
Sbjct:  756 PLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKFNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAH 841          

HSP 5 Score: 54.299 bits (129), Expect = 8.742e-9
Identity = 27/75 (36.00%), Postives = 36/75 (48.00%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL    AD+         P+H AC  GH E+ +LL+ H   +   D W   P+H A  KG     KLL++H  D
Sbjct:  617 EYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGAD 691          

HSP 6 Score: 52.7582 bits (125), Expect = 2.361e-8
Identity = 25/71 (35.21%), Postives = 36/71 (50.70%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            P+H AC  GH E+ +LL++H   + A D W   P+H A +K       LL+ H  D   L   ++  I LA
Sbjct:  310 PLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLLNCHSKSAIDLA 380          

HSP 7 Score: 51.9878 bits (123), Expect = 5.017e-8
Identity = 24/56 (42.86%), Postives = 31/56 (55.36%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GHAE+V LL+    D  A D WN  P+H A  KG      +L++H  D
Sbjct:  150 PLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAD 205          

HSP 8 Score: 51.2174 bits (121), Expect = 8.238e-8
Identity = 28/75 (37.33%), Postives = 36/75 (48.00%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL    AD+         P+H A   GH +I  LLI+ N  + A DKW   P+H A  KG +    LL+ H  D
Sbjct:  770 EYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKFNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGAD 844          
BLAST of SMED30006877 vs. Ensembl Cavefish
Match: ENSAMXT00000005100.2 (tankyrase-2 [Source:NCBI gene;Acc:103036789])

HSP 1 Score: 67.0106 bits (162), Expect = 3.147e-13
Identity = 40/126 (31.75%), Postives = 63/126 (50.00%), Query Frame = 3
Query:  114 NRDFHLFSNAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            ++D HL   A KSG  E  ++    + +  +D + ++  P+H A       +V  L++H  D+ A DK  + P+H AC+ GH    +LL+ H   I     W   P+H A  +G  E  KLLL+H 
Sbjct:  496 DKDRHLLE-ASKSGDLETVKKLCTLQNVNCRDLEGQQSTPLHFASGYNRVTVVDYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVIHGAVINVADLWKFMPLHEAAAKGKYEICKLLLQHG 620          

HSP 2 Score: 66.2402 bits (160), Expect = 6.109e-13
Identity = 36/117 (30.77%), Postives = 58/117 (49.57%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            + +SG+EE          +    +D R+  P+H A        V+LL++H  D+ A DK ++ P+H AC+ GH    +LL++H   + A+  W   P+H A  +   E   LLL H 
Sbjct:  187 SARSGNEEKLMSLLTPLNVNCHASDGRKSTPLHLAAGYNRVRTVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKHGACVNAVDLWRFTPLHEAASKNRVEVCSLLLSHG 303          

HSP 3 Score: 64.3142 bits (155), Expect = 2.581e-12
Identity = 36/117 (30.77%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            A +SG  E  R+      +  +D   R+  P+H A   G  ++V  L++H  D+ A D   +  +H AC+ GH   V  L+ H  D  +   WN  P+H A I+G  +   +LL+H 
Sbjct:   34 ACRSGDLERVRKLLNAANVNSRDTAGRKSTPLHFAAGFGRRDVVDHLLKHGADVHARDDGGLVSLHNACSFGHVEVVSHLLRHGADANSRDNWNYTPLHEAAIKGKIDVCIVLLQHG 150          

HSP 4 Score: 54.299 bits (129), Expect = 7.491e-9
Identity = 28/78 (35.90%), Postives = 38/78 (48.72%), Query Frame = 3
Query:  204 KDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            KD     P+H AC  GH E+ +LL++H   + A D W   P+H A +K       LL+ H  D   L   N+  I LA
Sbjct:  243 KDKGDLVPLHNACSYGHYEVTELLVKHGACVNAVDLWRFTPLHEAASKNRVEVCSLLLSHGADPTFLNCHNKSAIDLA 320          

HSP 5 Score: 51.2174 bits (121), Expect = 9.136e-8
Identity = 27/77 (35.06%), Postives = 35/77 (45.45%), Query Frame = 3
Query:  204 KDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHL 434
            KD     P+H AC  GH E+ +LL+ H   I   D W   P+H A  KG     KLL++H  D          P+ L
Sbjct:  560 KDKGGLVPLHNACSYGHYEVAELLVIHGAVINVADLWKFMPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDL 636          

HSP 6 Score: 46.2098 bits (108), Expect = 5.305e-6
Identity = 23/65 (35.38%), Postives = 33/65 (50.77%), Query Frame = 3
Query:  201 RKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDI 395
            R D  L   +H AC  GH E+V  L+ H  D  + D WN  P+H A  KG      +L++H  ++
Sbjct:   90 RDDGGLVS-LHNACSFGHVEVVSHLLRHGADANSRDNWNYTPLHEAAIKGKIDVCIVLLQHGAEL 153          
BLAST of SMED30006877 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 2.976e-14
Identity = 37/116 (31.90%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A +SG+EE          +    +D R+  P+H A       IV+LL++H  D+ A DK  + P+H AC+ GH    +LL++H   + A+  W   P+H A  +   E   LLL +
Sbjct:  307 AARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSY 422          

HSP 2 Score: 64.6994 bits (156), Expect = 4.347e-13
Identity = 35/121 (28.93%), Postives = 59/121 (48.76%), Query Frame = 3
Query:  126 HLFSNAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            H    A K+G  +  ++    + +  +D + R   P+H A       +V+ L++H  D+ A DK  + P+H AC+ GH    +LL++    +     W   P+H A  +G  E  KLLL+H
Sbjct:  618 HQLLEAAKAGDLDTVKQLCTTQTVNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKH 738          

HSP 3 Score: 60.4622 bits (145), Expect = 1.262e-11
Identity = 34/116 (29.31%), Postives = 59/116 (50.86%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A ++G     +R      +  +D   R+  P+H A   G  ++V+ L+++  ++ A D   + P+H AC+ GH+  V LL+    D  A   WN  P+H A I+G  +   +LL+H
Sbjct:  154 ACRNGDVGRVKRLVSPLNVNARDTTGRKSTPLHFAAGFGRKDVVEHLLQNGANVHARDDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 269          

HSP 4 Score: 58.151 bits (139), Expect = 8.024e-11
Identity = 35/117 (29.91%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +A K G     ++    E +  +D+  R   P+H A    + E+ + L+EH  D+ A DK  + P+H A + GH     LLI++   + A   W   P+H A  +G ++   LLL H
Sbjct:  775 DAAKKGCLARVQKLCSGENVNCRDSQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYSACVNATDKWAFTPLHEAAQKGRTQLCALLLAH 891          

HSP 5 Score: 53.5286 bits (127), Expect = 2.763e-9
Identity = 24/56 (42.86%), Postives = 31/56 (55.36%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GHAE+V LL+    D  A D WN  P+H A  KG      +L++H  D
Sbjct:  217 PLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAD 272          

HSP 6 Score: 53.5286 bits (127), Expect = 2.789e-9
Identity = 31/90 (34.44%), Postives = 42/90 (46.67%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            EYL    AD+         P+H A   GH +I  LLI+++  + A DKW   P+H A  KG +    LL+ H  D        Q P+ LA
Sbjct:  820 EYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYSACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPSMKNQEGQTPLDLA 909          

HSP 7 Score: 52.373 bits (124), Expect = 6.974e-9
Identity = 24/71 (33.80%), Postives = 36/71 (50.70%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            P+H AC  GH E+ +LL++H   + A D W   P+H A +K       LL+ +  D   L   ++  I LA
Sbjct:  370 PLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHSKSAIDLA 440          

HSP 8 Score: 50.8322 bits (120), Expect = 2.364e-8
Identity = 26/75 (34.67%), Postives = 37/75 (49.33%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL +  AD+         P+H AC  GH E+ +LL++    +   D W   P+H A  KG     KLL++H  D
Sbjct:  667 EYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGAD 741          

HSP 9 Score: 46.595 bits (109), Expect = 6.989e-7
Identity = 26/82 (31.71%), Postives = 38/82 (46.34%), Query Frame = 3
Query:  147 KSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            K  SE L R   K   +  K  DL  P+H A    H +++ +L++H   I   D      +H A + GH    +LL+ H CD
Sbjct:  503 KQVSELLLR---KGANVNEKTKDLLTPLHVASDKAHNDVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCD 581          
BLAST of SMED30006877 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 3.938e-14
Identity = 33/87 (37.93%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            R  +H A F GH+E+V  L+    +I AFDK + R IH+A   GH+  VK+L+ H  D+         P+H A   G    +KLLL+
Sbjct:  139 RTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLD 225          

HSP 2 Score: 63.929 bits (154), Expect = 7.971e-13
Identity = 32/95 (33.68%), Postives = 50/95 (52.63%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
             ++KD   RR IH A + GH E+VK+L+ H  D+   DK    P+H A + G    VKLL++   DI+    +    +H+AC  G    +  L++
Sbjct:  167 FDKKD---RRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELID 258          

HSP 3 Score: 58.151 bits (139), Expect = 6.510e-11
Identity = 30/93 (32.26%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  159 EELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            +E+    +K+E +   D + R P+H A + G AEI++LL+     + + D   + P+H AC     AAV+ L++H  D+ A     Q P+H+A
Sbjct:   20 DEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVA 112          

HSP 4 Score: 54.299 bits (129), Expect = 1.700e-9
Identity = 30/98 (30.61%), Postives = 47/98 (47.96%), Query Frame = 3
Query:  162 ELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEH-KCDIEALAWWNQRPIHLACIQGH 452
            E+    F  + +   DA  R P+H A F  H E ++LL+ HN  +   D     P+  AC  G + AV++L+   K D++         +HLAC + H
Sbjct:  838 EMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLACSRSH 935          

HSP 5 Score: 53.9138 bits (128), Expect = 1.871e-9
Identity = 33/107 (30.84%), Postives = 56/107 (52.34%), Query Frame = 3
Query:  189 EYLERKDADL-------RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWN--IRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            E+L RKDAD          P+H A   GH   ++LL+E     ++  K    I P+H A   GH  A+++LI    D++        P+ LA ++GH++ +++L++H
Sbjct:  532 EHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQH 638          

HSP 6 Score: 50.0618 bits (118), Expect = 4.197e-8
Identity = 35/126 (27.78%), Postives = 53/126 (42.06%), Query Frame = 3
Query:  204 KDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDK-WN-----------------IRP---------------IHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            KD     P+H+AC +     V+ L++H+ D+ A DK W                  I P               +H+A   GHS  V  L+    +I A    ++R IH A   GH+E +K+L+ H
Sbjct:   68 KDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAH 193          

HSP 7 Score: 45.4394 bits (106), Expect = 1.511e-6
Identity = 25/87 (28.74%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR-PIHLACIQGHSETIKLLLEH 482
            P+H A + GH   +++LI    D++  +     P+  A  +GH+  V++LI+H   +      ++R  +H A   GH E ++LL+E+
Sbjct:  586 PLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVEN 672          

HSP 8 Score: 45.4394 bits (106), Expect = 1.646e-6
Identity = 25/97 (25.77%), Postives = 42/97 (43.30%), Query Frame = 3
Query:  189 EYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            E ++  DA+ + P+  A   GH +   LL+     I A D      +H     GH   V LL++   D+       + P+H+A   GH   +  L++
Sbjct:  677 EAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQ 773          

HSP 9 Score: 45.4394 bits (106), Expect = 1.952e-6
Identity = 29/100 (29.00%), Postives = 45/100 (45.00%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEH---NCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            L ++  D R  +H A   GH E ++LL+E+   N  ++A D     P+  A   GH+    LL+     I A        +H     GH E + LLL+ +
Sbjct:  643 LLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRS 742          
BLAST of SMED30006877 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007071.1 (pep scaffold:Pmarinus_7.0:GL486086:7043:13224:-1 gene:ENSPMAG00000006394.1 transcript:ENSPMAT00000007071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 7.176e-13
Identity = 28/86 (32.56%), Postives = 53/86 (61.63%), Query Frame = 3
Query:  228 IHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            +HQA + GH E+++LL+E    +EA D + I P+  A   G +  +++L++H  D+ A +     P+ +A  +GH+E ++LLL++ 
Sbjct:   85 LHQATWKGHVELLQLLLERGARVEARDDYGITPLFLAAQYGQAPCLRILLQHGPDVNAKSKDWATPLFIAAQEGHTECLRLLLDNG 170          

HSP 2 Score: 48.1358 bits (113), Expect = 1.459e-7
Identity = 30/111 (27.03%), Postives = 50/111 (45.05%), Query Frame = 3
Query:  156 SEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNI-RPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            S +L  R   E    R  ++   P+  A   GH  +VK L+ +   +     W     +H A  KGH   ++LL+E    +EA   +   P+ LA   G +  +++LL+H 
Sbjct:   29 SVDLLLRAGAEP--SRASSEEETPVFAAIGGGHVAVVKALLRNGAKVNGPQYWTGWTSLHQATWKGHVELLQLLLERGARVEARDDYGITPLFLAAQYGQAPCLRILLQHG 137          
BLAST of SMED30006877 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007954.1 (pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gene:ENSPMAG00000007165.1 transcript:ENSPMAT00000007954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 1.168e-11
Identity = 29/91 (31.87%), Postives = 46/91 (50.55%), Query Frame = 3
Query:  207 DADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            D   RR +H A + GH E+VK+L+ +  D+   DK    P+H A   GH   V+LL+  K ++     +    +H+AC  G    +  LL+
Sbjct:   77 DKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLD 167          

HSP 2 Score: 60.077 bits (144), Expect = 1.573e-11
Identity = 31/89 (34.83%), Postives = 49/89 (55.06%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQR---PIHLACIQGHSETIKLLL 476
            R  +H A F G+ E+V LLI    ++ A DK   R +H+A   GH+  VK+L+ +  D+    W +++   P+H A   GH   ++LLL
Sbjct:   48 RTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVN---WKDKKGYTPLHAAAASGHVTVVRLLL 133          

HSP 3 Score: 50.8322 bits (120), Expect = 2.578e-8
Identity = 30/93 (32.26%), Postives = 46/93 (49.46%), Query Frame = 3
Query:  204 KDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEH-KCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            +D   R P+H A FA + E  +LL+ H   ++A D+    P+     +G S  V+ L+ + K D+          +HLAC +GH     LLLE
Sbjct:  716 QDGKGRTPLHAAAFADNVECAQLLLSHGARVDATDRRGRTPLMTGALQGQSGIVEYLVNNTKGDLSLTDDKKNTALHLACGKGHETCALLLLE 808          

HSP 4 Score: 43.1282 bits (100), Expect = 9.848e-6
Identity = 27/127 (21.26%), Postives = 50/127 (39.37%), Query Frame = 3
Query:  204 KDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAV----------------------------------KLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            KD     P+H A  +GH  +V+LL+    ++  F+ +    +H AC+ G  A V                                  +LL+ H  D+ A ++  + P+H+  I G     + L+++
Sbjct:  109 KDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELLVNHHADVNAQSYDGKSPLHMTAIHGRFTRSQTLIQN 235          
BLAST of SMED30006877 vs. Ensembl Sea Lamprey
Match: fem1c (fem-1 homolog c [Source:NCBI gene;Acc:378965])

HSP 1 Score: 58.9214 bits (141), Expect = 3.712e-11
Identity = 32/85 (37.65%), Postives = 42/85 (49.41%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            P+  A  AGH  +VK L+ H   +      N  P+  AC  GH   VK LIEH+ D+E         + +AC +GH E  K LLE
Sbjct:   86 PLWAASAAGHLAVVKSLLAHGASVNNTTLTNSTPLRAACFDGHLDIVKYLIEHQADLEVANRHGHTCLMIACYKGHKEIAKYLLE 170          

HSP 2 Score: 58.151 bits (139), Expect = 6.790e-11
Identity = 30/87 (34.48%), Postives = 45/87 (51.72%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            P+  ACF GH +IVK LIEH  D+E  ++     +  AC KGH    K L+E   D+   +      +H     G  E +K+LL+++
Sbjct:  119 PLRAACFDGHLDIVKYLIEHQADLEVANRHGHTCLMIACYKGHKEIAKYLLERGADVNRKSVKGNTALHDCAESGSLEIMKMLLKYS 205          

HSP 3 Score: 50.8322 bits (120), Expect = 2.523e-8
Identity = 38/130 (29.23%), Postives = 55/130 (42.31%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLER------KDADLRRPIHQACFAGHAEIVKLLIEH-NCDIEA-----FDKWNIR---PIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            NA + G     +R  + +  E       +      P+  A   GH ++V  L+EH N +IE      FD   I    P+  A   GH A VK L+ H   +      N  P+  AC  GH + +K L+EH
Sbjct:    9 NAARDGKLRFLQRLLRHKAPEELRGLVTEKTGGSTPLLIAARYGHLDVVLYLVEHCNANIELGGSVNFDGETIEGAPPLWAASAAGHLAVVKSLLAHGASVNNTTLTNSTPLRAACFDGHLDIVKYLIEH 138          
BLAST of SMED30006877 vs. Ensembl Nematostella
Match: EDO34034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQH2])

HSP 1 Score: 60.077 bits (144), Expect = 4.758e-12
Identity = 34/94 (36.17%), Postives = 54/94 (57.45%), Query Frame = 3
Query:  207 DADLRRPIHQACFAGHAEIVKLLIEHNCDIEAF--DKWNIRPIHYACNKGHSA-AVKLLIEHKCDIEALAWWNQRPIHLACIQ-GHSETIKLLL 476
            DAD    +H+A + GH ++ K+L+ +  ++ A   D W+  P+H AC  G    A  LL+++  +I AL    Q P+HLA +  G + T+KLLL
Sbjct:   28 DADGYSALHRASYEGHVDVAKVLLTYGANVMATTHDGWH--PLHSACRWGKGVEAASLLLQNGANINALTNGKQTPLHLAALGIGGTATLKLLL 119          
BLAST of SMED30006877 vs. Ensembl Nematostella
Match: EDO46099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR35])

HSP 1 Score: 56.9954 bits (136), Expect = 6.186e-11
Identity = 33/90 (36.67%), Postives = 48/90 (53.33%), Query Frame = 3
Query:  222 RPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIR---PIHYACNKGH-SAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            RPIH+A   GH E V++L+ +     A     IR   P+HYA   GH   AV++L+E   D+EA+     R IH+A   G  + +  LL+
Sbjct:   32 RPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLD 121          
BLAST of SMED30006877 vs. Ensembl Nematostella
Match: EDO35987 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJZ9])

HSP 1 Score: 52.7582 bits (125), Expect = 9.753e-10
Identity = 30/93 (32.26%), Postives = 43/93 (46.24%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLI------EHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
             +H A   G A+I +LLI      E   D++A D +    +HYA  +GH   +KLL+    DI       Q P+  A I    E + +LL H 
Sbjct:    2 ALHYAVREGFADIARLLIKKGSNLEATTDMDAHDMFGRTALHYAAQQGHMEMIKLLVTRGADIHTRDSEGQTPLFQATIFDQKEAVNVLLLHG 94          
BLAST of SMED30006877 vs. Ensembl Nematostella
Match: EDO34161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ63])

HSP 1 Score: 51.6026 bits (122), Expect = 2.091e-9
Identity = 21/56 (37.50%), Postives = 34/56 (60.71%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H+AC  G  E+VK+L+++  D+ A     IRP+H A   GH   ++LL+ +  D
Sbjct:   23 PLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYGAD 78          

HSP 2 Score: 51.2174 bits (121), Expect = 2.956e-9
Identity = 27/76 (35.53%), Postives = 40/76 (52.63%), Query Frame = 3
Query:  258 EIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            E+VK  I    D  A D     P+H AC +G    VK+L+++  D+ A +    RP+H A   GH E ++LLL + 
Sbjct:    1 EVVKQCILQGADPTAKDNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYG 76          
BLAST of SMED30006877 vs. Ensembl Nematostella
Match: EDO47759 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKX6])

HSP 1 Score: 53.9138 bits (128), Expect = 2.525e-9
Identity = 27/82 (32.93%), Postives = 41/82 (50.00%), Query Frame = 3
Query:  204 KDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQG 449
            +D +    +H +C  G  EIV+LL+EH  D+E  D      +H+A N G      LL+    D  AL++  Q  I +A  +G
Sbjct:   43 QDENRMTALHHSCLYGRIEIVRLLLEHGADLEVRDSKGWTALHFAANGGFLDVTSLLLSSCADAAALSYDGQLSIDVATGEG 124          
BLAST of SMED30006877 vs. Ensembl Medaka
Match: ENSORLT00000036264.1 (ankyrin repeat and SOCS box protein 13 [Source:NCBI gene;Acc:101166519])

HSP 1 Score: 67.3958 bits (163), Expect = 9.256e-14
Identity = 34/95 (35.79%), Postives = 52/95 (54.74%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIE-AFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            ++ ++ D   P+  AC AG  E VKLL+EH      +       P+H AC  G+SA  KLLI     +EA   +   P+H+AC+  H++ +K+LL
Sbjct:   78 VDARNVDGSTPLCDACSAGSVECVKLLLEHGAQANPSLTSRTASPLHEACMGGNSACAKLLITVGAHLEAYDLYYGTPLHVACVNEHTDCVKVLL 172          

HSP 2 Score: 53.9138 bits (128), Expect = 6.558e-9
Identity = 29/85 (34.12%), Postives = 47/85 (55.29%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            P+H+AC  G++   KLLI     +EA+D +   P+H AC   H+  VK+L+     + A A  ++ P+H A      E I++L+E
Sbjct:  122 PLHEACMGGNSACAKLLITVGAHLEAYDLYYGTPLHVACVNEHTDCVKVLLNAGAKVNA-ARLHETPLHHAAKNMQVEMIEVLVE 205          

HSP 3 Score: 52.373 bits (124), Expect = 2.486e-8
Identity = 28/89 (31.46%), Postives = 44/89 (49.44%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            R  +H+A   G    ++ LI+    +      +I P+H AC +G +  VKLL++    ++A       P+  AC  G  E +KLLLEH 
Sbjct:   20 RTELHKAAALGQTSQLRHLIQGGASVNVVAVDSITPLHEACLRGEAQCVKLLLDAGAQVDARNVDGSTPLCDACSAGSVECVKLLLEHG 108          
BLAST of SMED30006877 vs. Ensembl Medaka
Match: tnksb (tankyrase-1-like [Source:NCBI gene;Acc:105353570])

HSP 1 Score: 68.1662 bits (165), Expect = 1.199e-13
Identity = 38/116 (32.76%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A +SG+EE          +    +D R+  P+H A       IV+LL++H  D+ A DK  + P+H AC+ GH    +LL++H   + A+  W   P+H A  +   E   LLL H
Sbjct:  272 AARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRMEVCSLLLSH 387          

HSP 2 Score: 66.2402 bits (160), Expect = 6.146e-13
Identity = 36/119 (30.25%), Postives = 58/119 (48.74%), Query Frame = 3
Query:  132 FSNAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            F  A K+G  +  ++    + +  +D + R   P+H A       +V+ L+ H  D+ A DK  + P+H AC+ GH    +LL+ H   +     W   P+H A  +G  E  KLLL+H
Sbjct:  584 FLEAAKAGDLDTVQQLCTPQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKH 702          

HSP 3 Score: 60.4622 bits (145), Expect = 5.547e-11
Identity = 36/117 (30.77%), Postives = 58/117 (49.57%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +A K G     ++   +E +  +DA  R   P+H A    + E+ + L+EH  D+ A DK  + P+H A + GH     LLI++   + A   W   P+H A  +G ++   LLL H
Sbjct:  739 DAAKKGCLARVQKLCSQENINCRDAQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAH 855          

HSP 4 Score: 57.7658 bits (138), Expect = 5.639e-10
Identity = 34/116 (29.31%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A ++G     +R      +  KD   R+  P+H A   G  ++V+ L++   ++ A D   + P+H AC+ GH+  V LL+    D  A   WN  P+H + I+G  +   +LL+H
Sbjct:  119 ACRNGDVSRVKRLVDTVNVNAKDMAGRKSTPLHFAAGFGRKDVVEHLLQTGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHESAIKGKIDVCIVLLQH 234          

HSP 5 Score: 53.9138 bits (128), Expect = 9.751e-9
Identity = 27/75 (36.00%), Postives = 36/75 (48.00%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL    AD+         P+H AC  GH E+ +LL+ H   +   D W   P+H A  KG     KLL++H  D
Sbjct:  631 EYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGAD 705          

HSP 6 Score: 52.373 bits (124), Expect = 3.607e-8
Identity = 28/75 (37.33%), Postives = 37/75 (49.33%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL    AD+         P+H A   GH +I  LLI++N  + A DKW   P+H A  KG +    LL+ H  D
Sbjct:  784 EYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGAD 858          

HSP 7 Score: 51.6026 bits (122), Expect = 7.101e-8
Identity = 23/71 (32.39%), Postives = 36/71 (50.70%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            P+H AC  GH E+ +LL++H   + A D W   P+H A +K       LL+ H  D   L   ++  + +A
Sbjct:  335 PLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRMEVCSLLLSHGADPTLLNCHSKSAVDMA 405          

HSP 8 Score: 50.8322 bits (120), Expect = 1.371e-7
Identity = 23/56 (41.07%), Postives = 31/56 (55.36%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GHAE+V LL+    D  A D WN  P+H +  KG      +L++H  D
Sbjct:  182 PLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHESAIKGKIDVCIVLLQHGAD 237          
BLAST of SMED30006877 vs. Ensembl Medaka
Match: ENSORLT00000015051.2 (ankyrin repeat and SOCS box protein 13 [Source:NCBI gene;Acc:101166519])

HSP 1 Score: 67.0106 bits (162), Expect = 1.258e-13
Identity = 34/95 (35.79%), Postives = 52/95 (54.74%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIE-AFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLL 476
            ++ ++ D   P+  AC AG  E VKLL+EH      +       P+H AC  G+SA  KLLI     +EA   +   P+H+AC+  H++ +K+LL
Sbjct:   75 VDARNVDGSTPLCDACSAGSVECVKLLLEHGAQANPSLTSRTASPLHEACMGGNSACAKLLITVGAHLEAYDLYYGTPLHVACVNEHTDCVKVLL 169          

HSP 2 Score: 53.5286 bits (127), Expect = 8.937e-9
Identity = 34/116 (29.31%), Postives = 56/116 (48.28%), Query Frame = 3
Query:  138 NAVKSGSEELFRRYFKEEYLERKDADLR--RPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            +A  +GS E  +   +           R   P+H+AC  G++   KLLI     +EA+D +   P+H AC   H+  VK+L+     + A A  ++ P+H A      E I++L+E
Sbjct:   88 DACSAGSVECVKLLLEHGAQANPSLTSRTASPLHEACMGGNSACAKLLITVGAHLEAYDLYYGTPLHVACVNEHTDCVKVLLNAGAKVNA-ARLHETPLHHAAKNMQVEMIEVLVE 202          

HSP 3 Score: 51.9878 bits (123), Expect = 3.421e-8
Identity = 28/89 (31.46%), Postives = 44/89 (49.44%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            R  +H+A   G    ++ LI+    +      +I P+H AC +G +  VKLL++    ++A       P+  AC  G  E +KLLLEH 
Sbjct:   17 RTELHKAAALGQTSQLRHLIQGGASVNVVAVDSITPLHEACLRGEAQCVKLLLDAGAQVDARNVDGSTPLCDACSAGSVECVKLLLEHG 105          
BLAST of SMED30006877 vs. Ensembl Medaka
Match: ENSORLT00000038944.1 (tankyrase-1 [Source:NCBI gene;Acc:101158122])

HSP 1 Score: 68.1662 bits (165), Expect = 1.260e-13
Identity = 38/116 (32.76%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A +SG+EE          +    +D R+  P+H A       IV+LL++H  D+ A DK  + P+H AC+ GH    +LL++H   + A+  W   P+H A  +   E   LLL H
Sbjct:  289 AARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSH 404          

HSP 2 Score: 65.4698 bits (158), Expect = 9.486e-13
Identity = 37/123 (30.08%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  120 DFHLFSNAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            D+ L   A K+G  +  +     + +  +D + R   P+H A       +V+ L+ H  D+ A DK  + P+H AC+ GH    +LL+ H   +     W   P+H A  +G  E  KLLL+H
Sbjct:  598 DYRLLE-AAKAGDLDTIKSLCTPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKH 719          

HSP 3 Score: 56.6102 bits (135), Expect = 1.158e-9
Identity = 35/122 (28.69%), Postives = 58/122 (47.54%), Query Frame = 3
Query:  123 FHLFSNAVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            F     A ++G     ++      +  KD   R+  P+H A   G  ++V  L++   ++ A D   + P+H AC+ GHS  V LL+    +  A   WN  P+H A I+G  +   +LL+H
Sbjct:  130 FRELFEACRNGDVSRVKKLVDAMNVNAKDMAGRKSTPLHFAAGFGRKDVVDHLLQMGANVHARDDGGLIPLHNACSFGHSEVVSLLLCQGAEPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 251          

HSP 4 Score: 56.6102 bits (135), Expect = 1.311e-9
Identity = 29/86 (33.72%), Postives = 45/86 (52.33%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            P+H A    + E+ + L+EH  D+ A DK  + P+H A + GH     LLI++   + A   W   P+H A  +G ++   LLL H
Sbjct:  787 PLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAH 872          

HSP 5 Score: 54.6842 bits (130), Expect = 5.400e-9
Identity = 32/90 (35.56%), Postives = 42/90 (46.67%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            EYL    AD+         P+H A   GH +I  LLI++N  + A DKW   P+H A  KG +    LL+ H  D        Q P+ LA
Sbjct:  801 EYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLA 890          

HSP 6 Score: 53.9138 bits (128), Expect = 9.766e-9
Identity = 27/75 (36.00%), Postives = 36/75 (48.00%), Query Frame = 3
Query:  189 EYLERKDADLRR-------PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            EYL    AD+         P+H AC  GH E+ +LL+ H   +   D W   P+H A  KG     KLL++H  D
Sbjct:  648 EYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGAD 722          

HSP 7 Score: 51.6026 bits (122), Expect = 7.459e-8
Identity = 23/71 (32.39%), Postives = 36/71 (50.70%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            P+H AC  GH E+ +LL++H   + A D W   P+H A +K       LL+ H  D   L   ++  + +A
Sbjct:  352 PLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLLNCHSKSSVDMA 422          

HSP 8 Score: 48.9062 bits (115), Expect = 5.409e-7
Identity = 22/56 (39.29%), Postives = 31/56 (55.36%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GH+E+V LL+    +  A D WN  P+H A  KG      +L++H  D
Sbjct:  199 PLHNACSFGHSEVVSLLLCQGAEPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAD 254          
BLAST of SMED30006877 vs. Ensembl Medaka
Match: ENSORLT00000014209.3 (tankyrase-1 [Source:NCBI gene;Acc:101158122])

HSP 1 Score: 67.781 bits (164), Expect = 1.585e-13
Identity = 38/116 (32.76%), Postives = 58/116 (50.00%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRR--PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            A +SG+EE          +    +D R+  P+H A       IV+LL++H  D+ A DK  + P+H AC+ GH    +LL++H   + A+  W   P+H A  +   E   LLL H
Sbjct:  105 AARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSH 220          

HSP 2 Score: 60.8474 bits (146), Expect = 3.967e-11
Identity = 29/85 (34.12%), Postives = 43/85 (50.59%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            P+H A       +V+ L+ H  D+ A DK  + P+H AC+ GH    +LL+ H   +     W   P+H A  +G  E  KLLL+
Sbjct:  437 PLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLK 521          

HSP 3 Score: 51.2174 bits (121), Expect = 8.601e-8
Identity = 23/71 (32.39%), Postives = 36/71 (50.70%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLA 437
            P+H AC  GH E+ +LL++H   + A D W   P+H A +K       LL+ H  D   L   ++  + +A
Sbjct:  168 PLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLLNCHSKSSVDMA 238          

HSP 4 Score: 48.9062 bits (115), Expect = 6.297e-7
Identity = 22/56 (39.29%), Postives = 31/56 (55.36%), Query Frame = 3
Query:  225 PIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCD 392
            P+H AC  GH+E+V LL+    +  A D WN  P+H A  KG      +L++H  D
Sbjct:   15 PLHNACSFGHSEVVSLLLCQGAEPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAD 70          

HSP 5 Score: 45.8246 bits (107), Expect = 6.099e-6
Identity = 23/64 (35.94%), Postives = 35/64 (54.69%), Query Frame = 3
Query:  291 DIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            ++ A D   + P+H AC+ GHS  V LL+    +  A   WN  P+H A I+G  +   +LL+H
Sbjct:    4 NVHARDDGGLIPLHNACSFGHSEVVSLLLCQGAEPNARDNWNYTPLHEAAIKGKIDVCIVLLQH 67          
BLAST of SMED30006877 vs. Planmine SMEST
Match: SMESG000017261.1 (SMESG000017261.1)

HSP 1 Score: 213.772 bits (543), Expect = 4.551e-67
Identity = 100/124 (80.65%), Postives = 107/124 (86.29%), Query Frame = 3
Query:  111 MNRDFHLFSNAVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            M+ +F LF NA+KSGS  LFRRYFKEEYLERKDADL  PIH ACFAGHAEIVKLLIEHNCDIEA DKWN+RPIHYAC +GHS AVKLLIEHKCDIEA  WWNQRPIH AC QG SE +KLL+EH
Sbjct:    1 MDEEFKLFINAIKSGSAVLFRRYFKEEYLERKDADLWSPIHHACFAGHAEIVKLLIEHNCDIEALDKWNLRPIHYACYQGHSEAVKLLIEHKCDIEAFDWWNQRPIHYACYQGRSEAVKLLIEH 124          

HSP 2 Score: 107.457 bits (267), Expect = 1.622e-27
Identity = 51/82 (62.20%), Postives = 64/82 (78.05%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETI 464
            +RPIH AC+ G +E VKLLIEH CDIEA D+WN RPIH+AC++GHS AVKLLIE+KCDIEAL      P+ +A ++ H+E I
Sbjct:  103 QRPIHYACYQGRSEAVKLLIEHKCDIEAIDEWNQRPIHHACDQGHSEAVKLLIENKCDIEALDESGDSPMEIA-VKSHNERI 183          

HSP 3 Score: 58.151 bits (139), Expect = 2.114e-10
Identity = 42/137 (30.66%), Postives = 54/137 (39.42%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRP----------------------------------------------------IHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLL 473
            +RPIH AC  GH+E VKLLIE+ CDIEA D+    P                                                    IH+AC  G+   VK LI+ KCDI A    N  P+ +A    + E ++LL
Sbjct:  136 QRPIHHACDQGHSEAVKLLIENKCDIEALDESGDSPMEIAVKSHNERIIHILNGPCLLRACKNGDLKKVSTYLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKSNLSPLDIAIKNQNKELVELL 272          

HSP 4 Score: 57.3806 bits (137), Expect = 5.152e-10
Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLL 374
            A K+G  +    Y     +E  D D RRPIH AC +G+ ++VK LI+  CDI A DK N+ P+  A    +   V+LL
Sbjct:  195 ACKNGDLKKVSTYLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKSNLSPLDIAIKNQNKELVELL 272          
BLAST of SMED30006877 vs. Planmine SMEST
Match: SMESG000017261.1 (SMESG000017261.1)

HSP 1 Score: 199.519 bits (506), Expect = 4.248e-61
Identity = 98/125 (78.40%), Postives = 106/125 (84.80%), Query Frame = 3
Query:  111 MNRDFHLFSNAVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            M+ +F LF NA+KSGS  LFRRYFKEEYLERKDADL  PIH ACFAGHAEIVKLLIEHNCDIEA DK N RPIH AC++G S AVKLLIEHKCDIEAL   N+RPIHLAC QGHSE +KLL+EHN
Sbjct:    1 MDEEFKLFINAIKSGSAVLFRRYFKEEYLERKDADLWSPIHHACFAGHAEIVKLLIEHNCDIEALDKRNQRPIHLACDQGRSEAVKLLIEHKCDIEALDKRNRRPIHLACYQGHSEAVKLLIEHN 125          

HSP 2 Score: 154.836 bits (390), Expect = 1.823e-44
Identity = 71/96 (73.96%), Postives = 78/96 (81.25%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +E  D   RRPIH AC+ GH+E VKLLIEHNCDIEA D WN+RPIHYAC +GHS AVKLLIEHKCDIEA  WWNQRPIH AC QG SE +KLL+EH
Sbjct:   95 IEALDKRNRRPIHLACYQGHSEAVKLLIEHNCDIEALDVWNLRPIHYACYQGHSEAVKLLIEHKCDIEAFDWWNQRPIHYACYQGRSEAVKLLIEH 190          

HSP 3 Score: 140.969 bits (354), Expect = 1.818e-39
Identity = 66/87 (75.86%), Postives = 73/87 (83.91%), Query Frame = 3
Query:  222 RPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            RPIH AC+ GH+E VKLLIEH CDIEAFD WN RPIHYAC +G S AVKLLIEHKCDIEA+  WNQRPIH AC QGHSE +KLL+E+
Sbjct:  137 RPIHYACYQGHSEAVKLLIEHKCDIEAFDWWNQRPIHYACYQGRSEAVKLLIEHKCDIEAIDEWNQRPIHHACDQGHSEAVKLLIEN 223          

HSP 4 Score: 107.457 bits (267), Expect = 1.900e-27
Identity = 51/82 (62.20%), Postives = 64/82 (78.05%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETI 464
            +RPIH AC+ G +E VKLLIEH CDIEA D+WN RPIH+AC++GHS AVKLLIE+KCDIEAL      P+ +A ++ H+E I
Sbjct:  169 QRPIHYACYQGRSEAVKLLIEHKCDIEAIDEWNQRPIHHACDQGHSEAVKLLIENKCDIEALDESGDSPMEIA-VKSHNERI 249          

HSP 5 Score: 58.151 bits (139), Expect = 2.307e-10
Identity = 42/137 (30.66%), Postives = 54/137 (39.42%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRP----------------------------------------------------IHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLL 473
            +RPIH AC  GH+E VKLLIE+ CDIEA D+    P                                                    IH+AC  G+   VK LI+ KCDI A    N  P+ +A    + E ++LL
Sbjct:  202 QRPIHHACDQGHSEAVKLLIENKCDIEALDESGDSPMEIAVKSHNERIIHILNGPCLLRACKNGDLKKVSTYLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKSNLSPLDIAIKNQNKELVELL 338          

HSP 6 Score: 56.9954 bits (136), Expect = 5.623e-10
Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLL 374
            A K+G  +    Y     +E  D D RRPIH AC +G+ ++VK LI+  CDI A DK N+ P+  A    +   V+LL
Sbjct:  261 ACKNGDLKKVSTYLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKSNLSPLDIAIKNQNKELVELL 338          
BLAST of SMED30006877 vs. Planmine SMEST
Match: SMESG000017261.1 (SMESG000017261.1)

HSP 1 Score: 194.897 bits (494), Expect = 7.763e-59
Identity = 97/124 (78.23%), Postives = 105/124 (84.68%), Query Frame = 3
Query:  111 MNRDFHLFSNAVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            M+ +F LF NA+KSGS  LFRRYFKEEYLERKDADL  PIH ACFAGHAEIVKLLIEHNCDIEA DK N RPIH AC++G S AVKLLIEHKCDIEAL   NQRPIHLAC QGHSE +KLL+E+
Sbjct:    1 MDEEFKLFINAIKSGSAVLFRRYFKEEYLERKDADLWSPIHHACFAGHAEIVKLLIEHNCDIEALDKRNQRPIHLACDQGRSEAVKLLIEHKCDIEALDKRNQRPIHLACDQGHSEAVKLLIEN 124          

HSP 2 Score: 153.295 bits (386), Expect = 1.298e-43
Identity = 69/88 (78.41%), Postives = 75/88 (85.23%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            RRPIH AC+ GH+E VKLLIEHNCDIEA D WN+RPIHYAC +GHS AVKLLIEHKCDIEA  WWNQRPIH AC QG SE +KLL+EH
Sbjct:  202 RRPIHLACYQGHSEAVKLLIEHNCDIEALDVWNLRPIHYACYQGHSEAVKLLIEHKCDIEAFDWWNQRPIHYACYQGRSEAVKLLIEH 289          

HSP 3 Score: 140.198 bits (352), Expect = 5.532e-39
Identity = 66/87 (75.86%), Postives = 73/87 (83.91%), Query Frame = 3
Query:  222 RPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            RPIH AC+ GH+E VKLLIEH CDIEAFD WN RPIHYAC +G S AVKLLIEHKCDIEA+  WNQRPIH AC QGHSE +KLL+E+
Sbjct:  236 RPIHYACYQGHSEAVKLLIEHKCDIEAFDWWNQRPIHYACYQGRSEAVKLLIEHKCDIEAIDEWNQRPIHHACDQGHSEAVKLLIEN 322          

HSP 4 Score: 139.043 bits (349), Expect = 1.664e-38
Identity = 67/97 (69.07%), Postives = 77/97 (79.38%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            +E  D   +RPIH AC+ GH++ VKLLI+H CDIEA D WN RPIH AC  GHS AVKLLIE+KCDIEAL W N+RPIHLAC QGHSE +KLL+EHN
Sbjct:  128 IEALDWGNQRPIHLACYYGHSKAVKLLIDHKCDIEALDWWNQRPIHLACYHGHSEAVKLLIENKCDIEALDWRNRRPIHLACYQGHSEAVKLLIEHN 224          

HSP 5 Score: 134.42 bits (337), Expect = 6.146e-37
Identity = 66/96 (68.75%), Postives = 74/96 (77.08%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +E  D   +RPIH AC  GH+E VKLLIE+ CDIEA D  N RPIH AC  GHS AVKLLI+HKCDIEAL WWNQRPIHLAC  GHSE +KLL+E+
Sbjct:   95 IEALDKRNQRPIHLACDQGHSEAVKLLIENKCDIEALDWGNQRPIHLACYYGHSKAVKLLIDHKCDIEALDWWNQRPIHLACYHGHSEAVKLLIEN 190          

HSP 6 Score: 130.183 bits (326), Expect = 1.902e-35
Identity = 63/88 (71.59%), Postives = 70/88 (79.55%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +RPIH AC+ GH+E VKLLIE+ CDIEA D  N RPIH AC +GHS AVKLLIEH CDIEAL  WN RPIH AC QGHSE +KLL+EH
Sbjct:  169 QRPIHLACYHGHSEAVKLLIENKCDIEALDWRNRRPIHLACYQGHSEAVKLLIEHNCDIEALDVWNLRPIHYACYQGHSEAVKLLIEH 256          

HSP 7 Score: 106.301 bits (264), Expect = 3.937e-27
Identity = 51/82 (62.20%), Postives = 64/82 (78.05%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETI 464
            +RPIH AC+ G +E VKLLIEH CDIEA D+WN RPIH+AC++GHS AVKLLIE+KCDIEAL      P+ +A ++ H+E I
Sbjct:  268 QRPIHYACYQGRSEAVKLLIEHKCDIEAIDEWNQRPIHHACDQGHSEAVKLLIENKCDIEALDESGDSPMEIA-VKSHNERI 348          

HSP 8 Score: 57.3806 bits (137), Expect = 4.319e-10
Identity = 42/137 (30.66%), Postives = 54/137 (39.42%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRP----------------------------------------------------IHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLL 473
            +RPIH AC  GH+E VKLLIE+ CDIEA D+    P                                                    IH+AC  G+   VK LI+ KCDI A    N  P+ +A    + E ++LL
Sbjct:  301 QRPIHHACDQGHSEAVKLLIENKCDIEALDESGDSPMEIAVKSHNERIIHILNGPCLLRACKNGDLKKVSTYLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKSNLSPLDIAIKNQNKELVELL 437          

HSP 9 Score: 56.9954 bits (136), Expect = 5.867e-10
Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  141 AVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLL 374
            A K+G  +    Y     +E  D D RRPIH AC +G+ ++VK LI+  CDI A DK N+ P+  A    +   V+LL
Sbjct:  360 ACKNGDLKKVSTYLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKSNLSPLDIAIKNQNKELVELL 437          
BLAST of SMED30006877 vs. Planmine SMEST
Match: SMESG000017274.1 (SMESG000017274.1)

HSP 1 Score: 191.045 bits (484), Expect = 4.263e-58
Identity = 95/125 (76.00%), Postives = 102/125 (81.60%), Query Frame = 3
Query:  108 LMNRDFHLFSNAVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            + N +F LF NA+KSGS ELFRRYFKEE+LERKDA LRRPIH AC AGHAEIVKLLIEH CDIEA D  N RPIH AC  GHS AVKLLIEHKCDIEAL W N RPIH ACI GH+E +KLL+EH
Sbjct:   67 IRNEEFKLFINAIKSGSAELFRRYFKEEFLERKDAGLRRPIHHACIAGHAEIVKLLIEHKCDIEALDWRNRRPIHLACYHGHSEAVKLLIEHKCDIEALDWDNWRPIHHACIAGHAEIVKLLIEH 191          

HSP 2 Score: 139.428 bits (350), Expect = 6.613e-39
Identity = 65/88 (73.86%), Postives = 73/88 (82.95%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            RRPIH AC+ GH+E VKLLIE+ CDIEA D+   RPIH AC +GHS AVKLLIEH CDIEAL WWNQRPIH ACIQGHSE +KLL+E+
Sbjct:  203 RRPIHLACYHGHSEAVKLLIENKCDIEALDEQKRRPIHLACYQGHSEAVKLLIEHNCDIEALDWWNQRPIHHACIQGHSEAVKLLIEN 290          

HSP 3 Score: 136.346 bits (342), Expect = 9.535e-38
Identity = 70/97 (72.16%), Postives = 75/97 (77.32%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            +E  D D  RPIH AC AGHAEIVKLLIEH CDIEA D  N RPIH AC  GHS AVKLLIE+KCDIEAL    +RPIHLAC QGHSE +KLL+EHN
Sbjct:  162 IEALDWDNWRPIHHACIAGHAEIVKLLIEHKCDIEALDWRNRRPIHLACYHGHSEAVKLLIENKCDIEALDEQKRRPIHLACYQGHSEAVKLLIEHN 258          

HSP 4 Score: 115.161 bits (287), Expect = 3.721e-30
Identity = 57/95 (60.00%), Postives = 68/95 (71.58%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            +E  D   RRPIH AC+ GH+E VKLLIEHNCDIEA D WN RPIH+AC +GHS AVKLLIE+KCDI+A       P+  A   G++E IK+L E
Sbjct:  228 IEALDEQKRRPIHLACYQGHSEAVKLLIEHNCDIEALDWWNQRPIHHACIQGHSEAVKLLIENKCDIDARDESGNSPMEFAMKSGNTEIIKILNE 322          
BLAST of SMED30006877 vs. Planmine SMEST
Match: SMESG000017277.1 (SMESG000017277.1)

HSP 1 Score: 194.126 bits (492), Expect = 6.779e-58
Identity = 95/124 (76.61%), Postives = 104/124 (83.87%), Query Frame = 3
Query:  111 MNRDFHLFSNAVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            M+ +F LF NA+KSGS ELFRRYFKEE+LERKD+DLRRPIH AC  GHAEIVKLLIEH CDIEA DK N RPIH AC +GHS AVKLLIE+KCDIEAL    QRPIHLAC QGHSE +KLL+EH
Sbjct:    1 MDEEFKLFINAIKSGSAELFRRYFKEEFLERKDSDLRRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEH 124          

HSP 2 Score: 139.813 bits (351), Expect = 8.200e-39
Identity = 66/87 (75.86%), Postives = 73/87 (83.91%), Query Frame = 3
Query:  222 RPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            RPIH +C  GH+E VKLLIEHNCDIEA D  N RPIH AC +GHS AVKLLIE+KCDIEAL WWN+RPIHLAC QGHSE +KLL+EH
Sbjct:  170 RPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEH 256          

HSP 3 Score: 139.813 bits (351), Expect = 1.065e-38
Identity = 74/122 (60.66%), Postives = 86/122 (70.49%), Query Frame = 3
Query:  117 RDFHLFSNAVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            R  HL  +   SG+ +L      +  +E  D   RRPIH AC  GH+E VKLLIE+ CDIEA DKWN RPIH AC +GHS AVKLLIE+KCDIEAL   NQRPIHLAC QGHSE +KLL+E+
Sbjct:  368 RPIHLACDQGHSGAVKLLIENKCD--IEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIEN 487          

HSP 4 Score: 139.043 bits (349), Expect = 1.696e-38
Identity = 68/97 (70.10%), Postives = 77/97 (79.38%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEHN 485
            +E  D   +RPIH AC  GH+E VKLLIEH CDIEA DKWN RPIH +C +GHS AVKLLIE+KCDIEAL   N RPIHL+CIQGHSE +KLL+EHN
Sbjct:   95 IEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHN 191          

HSP 5 Score: 138.658 bits (348), Expect = 2.161e-38
Identity = 66/88 (75.00%), Postives = 73/88 (82.95%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            RRPIH AC+ GH+E VKLLIE+ CDIEA D WN RPIH AC++GHS AVKLLIEHKCDIEAL    QRPIHLAC QGHSE +KLL+EH
Sbjct:  202 RRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEH 289          

HSP 6 Score: 138.272 bits (347), Expect = 3.152e-38
Identity = 65/96 (67.71%), Postives = 77/96 (80.21%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +E  D   +RPIH AC+ GH+E VKLLIE+ CDIE  D+WN RPIH AC++GHS AVKLLIE+KCDIEAL  WNQRPIHLAC QGHS  +KLL+E+
Sbjct:  293 IEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIEN 388          

HSP 7 Score: 134.806 bits (338), Expect = 5.705e-37
Identity = 65/96 (67.71%), Postives = 75/96 (78.12%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +E  D   +RPIH AC+ GH+E VKLLIEH CDIEA DK   RPIH AC +GHS AVKLLIE+KCDIE L  WN+RPIHLAC QGHSE +KLL+E+
Sbjct:  260 IEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIEN 355          

HSP 8 Score: 133.65 bits (335), Expect = 1.299e-36
Identity = 64/88 (72.73%), Postives = 73/88 (82.95%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            RRPIH AC  GH+E VKLLIE+ CDIEA DKWN RPIH AC++GHS AVKLLIE+KCDIEAL    +RPIH ACIQGHSE +KLL+E+
Sbjct:  334 RRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIEN 421          

HSP 9 Score: 132.109 bits (331), Expect = 5.038e-36
Identity = 65/88 (73.86%), Postives = 70/88 (79.55%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            RRPIH AC  GH+E VKLLIEH CDIEA DK   RPIH AC +GHS AVKLLIEHKCDIEAL    QRPIHLAC QGHSE +KLL+E+
Sbjct:  235 RRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEN 322          

HSP 10 Score: 130.954 bits (328), Expect = 1.193e-35
Identity = 63/88 (71.59%), Postives = 74/88 (84.09%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +RPIH AC+ GH+E VKLLIE+ CDIEA D+ N RPIH AC++GHS AVKLLIE+KCDIEAL   NQRPIHLAC QGHSE +KLL+E+
Sbjct:  433 QRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIEN 520          

HSP 11 Score: 130.568 bits (327), Expect = 1.534e-35
Identity = 61/88 (69.32%), Postives = 72/88 (81.82%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +RPIH +C  GH+E VKLLIE+ CDIEA DK N RPIH +C +GHS AVKLLIEH CDIEAL W N+RPIH+AC QGHSE +KLL+E+
Sbjct:  136 QRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIEN 223          

HSP 12 Score: 128.642 bits (322), Expect = 7.798e-35
Identity = 62/88 (70.45%), Postives = 72/88 (81.82%), Query Frame = 3
Query:  219 RRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +RPIH AC  GH+  VKLLIE+ CDIEA D+   RPIH+AC +GHS AVKLLIE+KCDIEAL  WNQRPIHLAC QGHSE +KLL+E+
Sbjct:  367 QRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIEN 454          

HSP 13 Score: 124.02 bits (310), Expect = 3.084e-33
Identity = 63/96 (65.62%), Postives = 73/96 (76.04%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +E  D   +RPIH AC  GH+E VKLLIE+ CDIEA D  N RPIH AC++GHS AVKLLIE+KCDIEAL   NQRPIHLAC  G SE +KLL+E+
Sbjct:  458 IEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIEN 553          

HSP 14 Score: 117.472 bits (293), Expect = 6.953e-31
Identity = 62/96 (64.58%), Postives = 70/96 (72.92%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLEH 482
            +E  D   +RPIH AC  GH+E VKLLIE+ CDIEA D+ N RPIH AC  G S AVKLLIE+KC IEAL   NQRPIHLAC  GHS+  KLL+EH
Sbjct:  491 IEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKRNQRPIHLACYYGHSKAFKLLIEH 586          

HSP 15 Score: 93.5893 bits (231), Expect = 1.191e-22
Identity = 51/95 (53.68%), Postives = 62/95 (65.26%), Query Frame = 3
Query:  195 LERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAWWNQRPIHLACIQGHSETIKLLLE 479
            +E  D   +RPIH AC+ G +E VKLLIE+ C IEA DK N RPIH AC  GHS A KLLIEHKC+I+A       P+  A   G++E IK+L E
Sbjct:  524 IEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKILNE 618          

HSP 16 Score: 56.6102 bits (135), Expect = 1.023e-9
Identity = 27/63 (42.86%), Postives = 41/63 (65.08%), Query Frame = 3
Query:  192 YLERKDADLRRPIHQACFAGHAEIVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIE 380
            Y+E  D   +RPIH AC+ GH++  KLLIEH C+I+A D+    P+ +A   G++  +K+L E
Sbjct:  556 YIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKILNE 618          
The following BLAST results are available for this feature:
BLAST of SMED30006877 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNKS25.670e-1431.90tankyrase 2 [Source:HGNC Symbol;Acc:HGNC:15677][more]
ANKRD281.527e-1339.08ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
ANKRD281.527e-1339.08ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
TNKS1.620e-1332.76tankyrase [Source:HGNC Symbol;Acc:HGNC:11941][more]
ANKRD282.223e-1339.08ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of SMED30006877 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp-41.189e-1130.59TRP (Transient receptor potential) channel family ... [more]
unc-441.920e-929.90AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.920e-929.90AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.176e-929.90AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.176e-929.90AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of SMED30006877 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mask5.418e-1334.17gene:FBgn0043884 transcript:FBtr0345261[more]
mask5.419e-1334.17gene:FBgn0043884 transcript:FBtr0334942[more]
mask5.432e-1334.17gene:FBgn0043884 transcript:FBtr0334943[more]
mask5.432e-1334.17gene:FBgn0043884 transcript:FBtr0084562[more]
mask5.432e-1334.17gene:FBgn0043884 transcript:FBtr0084563[more]
back to top
BLAST of SMED30006877 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX640476.13.188e-1634.31ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
BX640476.13.189e-1634.31ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
ank1b3.193e-1634.31ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b3.253e-1634.31ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b5.854e-1636.78ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30006877 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnks26.439e-1431.90tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
tnks26.700e-1431.90tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
tnks27.299e-1431.90tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
tnks27.782e-1431.90tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
tnks27.987e-1431.90tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
back to top
BLAST of SMED30006877 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tnks22.271e-1431.90tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
Ankrd652.532e-1434.04ankyrin repeat domain 65 [Source:MGI Symbol;Acc:MG... [more]
Ankrd289.708e-1439.08ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
Ankrd289.829e-1439.08ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
Tnks1.527e-1332.76tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
back to top
BLAST of SMED30006877 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3UES3|TNKS2_MOUSE1.589e-1331.90Poly [ADP-ribose] polymerase tankyrase-2 OS=Mus mu... [more]
sp|Q9H2K2|TNKS2_HUMAN2.723e-1331.90Poly [ADP-ribose] polymerase tankyrase-2 OS=Homo s... [more]
sp|Q505D1|ANR28_MOUSE6.790e-1339.08Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|O15084|ANR28_HUMAN7.334e-1339.08Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|O95271|TNKS1_HUMAN7.782e-1332.76Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo s... [more]
back to top
BLAST of SMED30006877 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0C9TTI62.145e-1840.70Unplaced genomic scaffold PAXINscaffold_28, whole ... [more]
A0A182H2I69.874e-1842.86Uncharacterized protein OS=Aedes albopictus OX=716... [more]
A0A1X7T5X62.574e-1739.83Uncharacterized protein OS=Amphimedon queenslandic... [more]
A0A482W0Q41.691e-1647.25Ankryin repeat domain containing protein (Fragment... [more]
A0A3B0WFS15.549e-1637.78ANK_REP_REGION domain-containing protein OS=hydrot... [more]
back to top
BLAST of SMED30006877 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b5.104e-1435.63ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1a1.402e-1334.48ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
tnksa1.753e-1332.76tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
tnksb3.063e-1330.25tankyrase-1 [Source:NCBI gene;Acc:103045612][more]
ENSAMXT00000005100.23.147e-1331.75tankyrase-2 [Source:NCBI gene;Acc:103036789][more]
back to top
BLAST of SMED30006877 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009608.12.976e-1431.90pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
ENSPMAT00000003991.13.938e-1437.93pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000007071.17.176e-1332.56pep scaffold:Pmarinus_7.0:GL486086:7043:13224:-1 g... [more]
ENSPMAT00000007954.11.168e-1131.87pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gen... [more]
fem1c3.712e-1137.65fem-1 homolog c [Source:NCBI gene;Acc:378965][more]
back to top
BLAST of SMED30006877 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006877 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO340344.758e-1236.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460996.186e-1136.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359879.753e-1032.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341612.091e-937.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477592.525e-932.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30006877 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000036264.19.256e-1435.79ankyrin repeat and SOCS box protein 13 [Source:NCB... [more]
tnksb1.199e-1332.76tankyrase-1-like [Source:NCBI gene;Acc:105353570][more]
ENSORLT00000015051.21.258e-1335.79ankyrin repeat and SOCS box protein 13 [Source:NCB... [more]
ENSORLT00000038944.11.260e-1332.76tankyrase-1 [Source:NCBI gene;Acc:101158122][more]
ENSORLT00000014209.31.585e-1332.76tankyrase-1 [Source:NCBI gene;Acc:101158122][more]
back to top
BLAST of SMED30006877 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017261.14.551e-6780.65SMESG000017261.1[more]
SMESG000017261.14.248e-6178.40SMESG000017261.1[more]
SMESG000017261.17.763e-5978.23SMESG000017261.1[more]
SMESG000017274.14.263e-5876.00SMESG000017274.1[more]
SMESG000017277.16.779e-5876.61SMESG000017277.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006877 ID=SMED30006877|Name=SMED30006877|organism=Schmidtea mediterranea sexual|type=transcript|length=486bp
ATTAAATTGAAATTAATTAATTTACTTTTTATAATGGTTGAAATTTTATT
TTAAATGTTTATAAGCAAAATTTGTAATCAATTCTCATTGGATAAATATT
TACATAATTGATGAATCGGGATTTCCATTTATTTAGCAACGCAGTCAAAT
CTGGATCAGAAGAATTATTCCGCAGATATTTCAAGGAGGAATATTTGGAG
CGAAAGGATGCCGATTTGAGGCGACCGATTCATCAAGCATGCTTTGCAGG
ACACGCTGAAATTGTAAAGCTGCTGATTGAGCACAATTGCGATATCGAGG
CGTTTGATAAGTGGAATATACGGCCGATTCATTACGCATGCAATAAAGGG
CACTCAGCAGCAGTCAAACTGCTGATTGAGCATAAATGTGATATCGAGGC
TCTCGCATGGTGGAATCAGCGGCCGATTCATCTCGCTTGCATTCAAGGGC
ACTCAGAGACAATCAAACTGCTGCTTGAGCACAATT
back to top

protein sequence of SMED30006877-orf-1

>SMED30006877-orf-1 ID=SMED30006877-orf-1|Name=SMED30006877-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
MNRDFHLFSNAVKSGSEELFRRYFKEEYLERKDADLRRPIHQACFAGHAE
IVKLLIEHNCDIEAFDKWNIRPIHYACNKGHSAAVKLLIEHKCDIEALAW
WNQRPIHLACIQGHSETIKLLLEHN
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003824catalytic activity
Vocabulary: biological process
TermDefinition
GO:0009116nucleoside metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 35..64
e-value: 1.5E-4
score: 31.1
coord: 68..97
e-value: 0.021
score: 24.0
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 101..123
score: 9.297
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 35..67
score: 10.179
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 68..100
score: 8.977
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 4..123
e-value: 3.5E-31
score: 110.0
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 4..122
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 11..96
e-value: 5.6E-15
score: 55.7
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 35..123
score: 25.488
NoneNo IPR availablePANTHERPTHR18953FAMILY NOT NAMEDcoord: 72..122
coord: 36..94