SMED30006855

Overview
NameSMED30006855
Smed IDSMED30006855
Length (bp)5683
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006855

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30006855SMESG000064700.1 Contig4811_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30006855 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.004274:5375..11057 -28415
Homology
BLAST of SMED30006855 vs. Planmine SMEST
Match: SMESG000064700.1 (SMESG000064700.1)

HSP 1 Score: 3421.71 bits (8871), Expect = 0.000e+0
Identity = 1828/1881 (97.18%), Postives = 1829/1881 (97.24%), Query Frame = 2
Query:   38 TDSNRVKIRYAGSIDIQDSAKQSVLKAKAIFDYSNPLLDLEPKGSLSRAIEKQLNNPHKTFKSKHVKQYKISFAYTCTSGDSGEAINPQITSFQRLDKTTTTSDRQFVSDKLKPVMSRIVQRLIEEYRKSKSTYPLEEKDEKSLTANAYTLSISSSEHFPKEIKTERLSNFSKSVSPXXXXXXXXXXIVDKDSIEYTNNRVNSNFKQIKTNSISKGTKTIFKHNNSRQVKRIQKYHSSYKSDFLNTELGKNESYEIVCCSSKNFIHPKLLKDTFLFKKIKLIYSQNEDIRKLCKKPIISTYKMSSTHEFNNITISDFVFMNSSLTYNNTSKDVFKINLENLISYRRNIHFSQFNVVEKEQFNLAEITPFTNLICILAGLDNWNNFRKRSNIYDNNFSNEXXXXXXXXXXXXXXXXXXXXXXXTFNXXXXXXXXXXXXXXXXVERASILQRLSLNARPXXXXXXXXXXXXXXXXMNSDCPVCHGDPIMCLETEGRKSLIESYVTLLQESKGIHVRRRSNNSIDMQDLKILLYDFMAENNTYPTEEIKQEMLKRQESLIKKKAEEEEHGYIHSDEKPKRNEVPKGEGKNPNLPQQFLKSLTKKVEQTNEHKKTVLNNTPNGYTEVIHTVENSYEEIEITESANERINRLLPKENYANSADLSTKIKETVEYMDSEQRSSIGHYTRNRETIVSKSTGLTRSRTDGKNKISQIDNAANIVKEWLTTIQPILKELEYKDLKQFPSDVLQNTPTTLPISVNELSVNINTDEQDQFASITTPKMVSRRSILIHKVSDSKMSTVHXXXXXXXXXXXXXXDGQESLSKAKHKEDQKSNIGEEDRLKGLEKSKDPSSFLERDLNISSDQILNKESKRISNVNKAESNKDNINSRASINEKEIRKLNSQSEVKPEQRKSLMRSSLTTIEKEIKTVERTTEIKAEPRKSLLNNPVSKSKDNDQRNSKIDAKDSLAVGKNESINLFDDPENLDDKRASNSKKSDIEISAMKENNTTAILNRANDFINDAIYVEIDTKKIIEENQLFDKDAKETVQIMSPISTSSNSGEKRISTFDASISKGLYDAINGTGXXXXXXXXXXXXXXXXXXXAKYTNESPELKKLFNRISWENSQNLLNLLKMNQAQENFDENAAVKNRFSETKSNKSSNLKHVTSSFKGSFDELNKRMGDDINRRKLPEQMPPEYLENNRSKSVNRSTPNDNQFRPISQNVSPHDGHLLPDVRQVTDSLNRNLDIHHMGEPINGLPEQQFTNSLSHPTGSQFVGDSSGNKLNEFNENVPHFSGMNKSSPNNQRLNNFQYLNGKPGQNDTANAQKDWMNNKEQLDNRHKLDSSNFTTANRYQGDPLTPADIYQLTSQRTGLSHQLDPSHIRSDIYQKPDALSPSTDIQHAKDRGNFQRGMYHSSDPSNLQMEIRHLTDPINSNFRSPITHNVEEFSTQRFRNENDDLNVSRFQHATPNKEIDELLDRLKAILSKSEEFLHILSGFFSNIPRTSNILSDTINIPKEFYSLLKSICANKEDDSSNLKKSQLGNEKALNKICKMLGIIDEQENNKKGIDIVNGGVHKKKNSDLNKFLNDLMDEGKSNSEDIESNTYSLDINETFINXXXXXXXXXXXETNPLIFKDENVSSDDNQTRNSFMSPKNENEKLNPTNAKYLEHAIEKEKERKSTNSKSNGDNRFRDYSRSPSLKGRKQINIASIIEDCLPHESKNMINKKPMEKKTLNSLVVCDEIANRMKDLLAEVKQSHKTNLTSSPVEFQTPKTILTKTPNSENLNLISRDSKLIRSLSANCLDSSIVNPNPFASRHTVASIQNMISTPHQKQKMASGTRNIKKEIKDKSTRMFLNSRTRYNMINCNKNENNQIQTKSLNRNCNTRKIFK 5680
            TDSNRVKIRYAGSIDIQDSAKQSVLKAKAIFDYSNPLLDLEPKGSLSRAIEKQLNNPHKTFKSKHVKQYKISFAYTCTSGDSGEAINPQITSFQRLDKTTTTSDRQFVSDKLKPVMSRIVQRLIEEYRKSKSTYPLEEKDEKSLTANAYTLSISSSEHFPKEIKTERLSNFSKSVSPYLLNSYNSNSIVDKDSIEYTNNRVNSNFKQIKTNSISKGTKTIFKHNNSRQVKRIQKYHSSYKSDFLNTELGKNESYEIVCCSSKNFIHPKLLKDTFLFKKIKLIYSQNEDIRKLCKKPIISTYKMSSTHEFNNITISDFVFMNSSLTYNNTSKDVFKINLENLISYRRNIHFSQFNVVEKEQFNLAEITPFTNLICILAGLDNWNNFRKRSNIYDNNFSNEGKDSSNGSENKSKSSSISISKKETFNRSVSQSSRRPSRRISRVERASILQRLSLNARPSLTFLEEEESLLSDLSMNSDCPVCHGDPIMCLETEGRKSLIESYVTLLQESKGIHVRRRSNNSIDMQDLKILLYDFMAENNTYPTEEIKQEMLKRQESLIKKKAEEEEHGYIHSDEKPKRNEVPKGEGKNPNLPQQFLKSLTKKVEQTNEHKKTVLNNTPNGYTEVIHTVENSYEEIEITESANERINRLLPKENYANSADLSTKIKETVEYMDSEQRSSIGHYTRNRETIVSKSTGLTRSRTDGKNKISQIDNAANIVKEWLTTIQPILKELEYKDLKQFPSDVLQNTPTTLPISVNELSVNINTDEQDQFASITTPKMVSRRSILIHKVSDSKMSTVHSKSYKKKKQVKSQKDGQESLSKAKHKEDQKSNIGEEDRLKGLEKSKDPSSFLERDLNISSDQILNKESKRISNVNKAESNKDNINSRASINEKEIRKLNSQSEVKPEQRKSLMRSSLTTIEKEIKTVERTTEIKAEPRKSLLNNPVSKSKDNDQRNSKIDAKDSLAVGKNESINLFDDPENLDDKRASNSKKSDIEISAMKENNTTAILNRANDFINDAIYVEIDTKKIIEENQLFDKDAKETVQIMSPISTSSNSGEKRISTFDASISKGLYDAINGTGSSESSPSSSKSQDTSNDFSAKYTNESPELKKLFNRISWENSQNLLNLLKMNQAQENFDENAAVKNRFSETKSNKSSNLKHVTSSFKGSFDELNKRMGDDINRRKLPEQMPPEYLENNRSKSVNRSTPNDNQFRPISQNVSPHDGHLLPDVRQ   S NR                              F+                  SGMNKSSPNNQRLNNFQYLNGKPGQNDTANAQKDWMNNKEQLDNRHKLDSSNFTTANRYQGDPLTPADIYQLTSQRTGLSHQLDPSHIRSDIYQKPDALSPSTDIQHAKDRGNFQRGMYHSSDPSNLQMEIRHLTDPINSNFRSPITHNVEEFSTQRFRNENDDLNVSRFQHATPNKEIDELLDRLKAILSKSEEFLHILSGFFSNIPRTSNILSDTINIPKEFYSLLKSICANKEDDSSNLKKSQLGNEKALNKICKMLGIIDEQENNKKGIDIVNGGVHKKKNSDLNKFLNDLMDEGKSNSEDIESNTYSLDINETFINKVVKCVLKKLLETNPLIFKDENVSSDDNQTRNSFMSPKNENEKLNPTNAKYLEHAIEKEKERKSTNSKSNGDNRFRDYSRSPSLKGRKQINIASIIEDCLPHESKNMINKKPMEKKTLNSLVVCDEIANRMKDLLAEVKQSHKTNLTSSPVEFQTPKTILTKTPNSENLNLISRDSKLIRSLSANCLDSSIVNPNPFASRHTVASIQNMISTPHQKQKMASGTRNIKKEIKDKSTRMFLNSRTRYNMINCNKNENNQIQTKSLNRNCNTRKIFK
Sbjct:    5 TDSNRVKIRYAGSIDIQDSAKQSVLKAKAIFDYSNPLLDLEPKGSLSRAIEKQLNNPHKTFKSKHVKQYKISFAYTCTSGDSGEAINPQITSFQRLDKTTTTSDRQFVSDKLKPVMSRIVQRLIEEYRKSKSTYPLEEKDEKSLTANAYTLSISSSEHFPKEIKTERLSNFSKSVSPYLLNSYNSNSIVDKDSIEYTNNRVNSNFKQIKTNSISKGTKTIFKHNNSRQVKRIQKYHSSYKSDFLNTELGKNESYEIVCCSSKNFIHPKLLKDTFLFKKIKLIYSQNEDIRKLCKKPIISTYKMSSTHEFNNITISDFVFMNSSLTYNNTSKDVFKINLENLISYRRNIHFSQFNVVEKEQFNLAEITPFTNLICILAGLDNWNNFRKRSNIYDNNFSNEGKDSSNGSENKSKSSSISISKKETFNRSVSQSSRRPSRRISRVERASILQRLSLNARPSLTFLEEEESLLSDLSMNSDCPVCHGDPIMCLETEGRKSLIESYVTLLQESKGIHVRRRSNNSIDMQDLKILLYDFMAENNTYPTEEIKQEMLKRQESLIKKKAEEEEHGYIHSDEKPKRNEVPKGEGKNPNLPQQFLKSLTKKVEQTNEHKKTVLNNTPNGYTEVIHTVENSYEEIEITESANERINRLLPKENYANSADLSTKIKETVEYMDSEQRSSIGHYTRNRETIVSKSTGLTRSRTDGKNKISQIDNAANIVKEWLTTIQPILKELEYKDLKQFPSDVLQNTPTTLPISVNELSVNINTDEQDQFASITTPKMVSRRSILIHKVSDSKMSTVHSKSYKKKKQVKSQKDGQESLSKAKHKEDQKSNIGEEDRLKGLEKSKDPSSFLERDLNISSDQILNKESKRISNVNKAESNKDNINSRASINEKEIRKLNSQSEVKPEQRKSLMRSSLTTIEKEIKTVERTTEIKAEPRKSLLNNPVSKSKDNDQRNSKIDAKDSLAVGKNESINLFDDPENLDDKRASNSKKSDIEISAMKENNTTAILNRANDFINDAIYVEIDTKKIIEENQLFDKDAKETVQIMSPISTSSNSGEKRISTFDASISKGLYDAINGTGSSESSPSSSKSQDTSNDFSAKYTNESPELKKLFNRISWENSQNLLNLLKMNQAQENFDENAAVKNRFSETKSNKSSNLKHVTSSFKGSFDELNKRMGDDINRRKLPEQMPPEYLENNRSKSVNRSTPNDNQFRPISQNVSPHDGHLLPDVRQ---SSNR------------------------QSICWGFI------------------SGMNKSSPNNQRLNNFQYLNGKPGQNDTANAQKDWMNNKEQLDNRHKLDSSNFTTANRYQGDPLTPADIYQLTSQRTGLSHQLDPSHIRSDIYQKPDALSPSTDIQHAKDRGNFQRGMYHSSDPSNLQMEIRHLTDPINSNFRSPITHNVEEFSTQRFRNENDDLNVSRFQHATPNKEIDELLDRLKAILSKSEEFLHILSGFFSNIPRTSNILSDTINIPKEFYSLLKSICANKEDDSSNLKKSQLGNEKALNKICKMLGIIDEQENNKKGIDIVNGGVHKKKNSDLNKFLNDLMDEGKSNSEDIESNTYSLDINETFINKVVKCVLKKLLETNPLIFKDENVSSDDNQTRNSFMSPKNENEKLNPTNAKYLEHAIEKEKERKSTNSKSNGDNRFRDYSRSPSLKGRKQINIASIIEDCLPHESKNMINKKPMEKKTLNSLVVCDEIANRMKDLLAEVKQSHKTNLTSSPVEFQTPKTILTKTPNSENLNLISRDSKLIRSLSANCLDSSIVNPNPFASRHTVASIQNMISTPHQKQKMASGTRNIKKEIKDKSTRMFLNSRTRYNMINCNKNENNQIQTKSLNRNCNTRKIFK 1840          
The following BLAST results are available for this feature:
BLAST of SMED30006855 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006855 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006855 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006855 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006855 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006855 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006855 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006855 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006855 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006855 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006855 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006855 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006855 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006855 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000064700.10.000e+097.18SMESG000064700.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006855 ID=SMED30006855|Name=SMED30006855|organism=Schmidtea mediterranea sexual|type=transcript|length=5683bp
GTTTTGCAATAATATTTTTATATTTATGAATAATAATACTGACTCTAATA
GAGTAAAAATTAGATATGCCGGATCTATAGACATCCAAGATTCTGCAAAA
CAATCTGTGCTGAAAGCCAAAGCGATATTTGATTACTCAAATCCATTGTT
AGATCTCGAACCAAAAGGATCTTTATCTCGTGCCATTGAAAAACAATTAA
ATAATCCACATAAAACTTTTAAATCTAAGCATGTAAAGCAGTACAAAATC
AGTTTTGCTTATACATGCACTTCGGGTGATAGTGGGGAGGCCATTAACCC
CCAAATCACCAGTTTTCAACGGCTTGATAAAACAACAACCACATCAGATC
GTCAATTTGTCTCGGACAAACTGAAACCGGTAATGTCTCGCATTGTTCAG
CGTTTAATAGAAGAATATAGAAAATCTAAGTCGACTTATCCACTTGAAGA
GAAAGACGAAAAGTCTTTAACAGCAAATGCATACACTCTGTCGATTTCAA
GTAGTGAACATTTTCCAAAGGAAATAAAAACAGAACGGTTGTCAAATTTT
AGTAAATCGGTCTCTCCATATTTACTTAATTCCTACAATTCAAATTCAAT
TGTAGATAAAGATTCGATTGAGTATACGAATAACAGAGTAAATAGCAATT
TCAAACAGATTAAAACAAACTCCATTTCAAAAGGAACCAAGACGATTTTC
AAGCACAATAATTCTCGTCAAGTGAAACGCATTCAAAAGTACCATTCTTC
GTACAAGTCAGATTTTCTGAATACAGAACTCGGAAAAAATGAATCCTACG
AAATTGTTTGTTGCAGCTCTAAAAATTTCATCCATCCAAAATTGCTAAAA
GATACTTTTTTATTTAAAAAAATCAAACTTATTTATTCTCAAAATGAAGA
CATCAGAAAATTATGTAAAAAGCCCATTATATCTACTTATAAAATGTCAT
CGACTCACGAATTTAATAACATTACTATTTCCGATTTCGTATTCATGAAT
TCGTCTTTAACATACAACAATACATCTAAAGACGTTTTTAAAATTAATTT
GGAAAATTTAATATCATACCGACGAAATATTCATTTTTCACAGTTCAATG
TTGTGGAAAAAGAACAGTTTAATCTTGCAGAAATTACTCCTTTTACCAAT
TTAATTTGCATTCTAGCTGGATTAGATAATTGGAATAATTTTAGAAAAAG
ATCCAATATTTACGACAATAACTTCAGCAATGAAGGAAAAGATTCATCAA
ATGGATCGGAAAATAAATCGAAATCGAGCTCAATTAGCATATCTAAAAAA
GAAACTTTTAATCGAAGTGTATCTCAAAGTAGTAGACGTCCATCCAGACG
AATCTCTAGGGTAGAACGAGCTAGCATTCTTCAAAGACTGTCATTAAATG
CGAGACCATCATTGACGTTTTTAGAAGAAGAAGAGTCTTTGCTTTCAGAT
CTAAGTATGAATTCTGATTGCCCCGTATGTCATGGAGATCCAATTATGTG
CTTAGAAACTGAGGGTAGAAAGTCTTTAATTGAAAGTTATGTGACACTAT
TACAGGAATCTAAAGGAATTCATGTTAGGCGACGTTCTAACAACTCAATT
GACATGCAAGACTTGAAAATTTTATTATATGACTTTATGGCAGAAAACAA
CACATATCCTACAGAAGAAATTAAACAGGAAATGTTAAAACGACAAGAAT
CGTTAATTAAAAAGAAAGCCGAAGAAGAGGAACATGGCTATATTCATAGT
GATGAAAAGCCCAAACGTAACGAAGTTCCAAAAGGCGAAGGTAAAAATCC
AAATTTACCTCAGCAATTTTTAAAATCATTGACGAAAAAAGTTGAACAGA
CCAATGAACACAAAAAGACGGTTTTAAACAATACCCCTAATGGTTACACT
GAAGTCATACATACAGTTGAAAATTCATATGAGGAAATTGAAATAACAGA
ATCTGCTAATGAAAGAATTAACAGACTTTTACCCAAGGAAAACTACGCTA
ACAGTGCAGACCTATCGACAAAAATTAAAGAGACTGTAGAGTATATGGAC
TCAGAACAGAGATCAAGTATTGGCCATTATACGCGCAATAGAGAAACTAT
AGTTTCTAAATCAACTGGCTTAACTCGTTCAAGAACAGATGGAAAGAATA
AAATTTCTCAAATTGATAATGCTGCAAACATTGTGAAAGAATGGTTGACA
ACTATTCAACCAATTTTGAAAGAACTAGAATATAAGGATCTAAAACAGTT
CCCTTCAGATGTTTTGCAAAATACCCCAACCACTCTTCCGATTTCGGTAA
ATGAATTGAGTGTGAATATCAATACCGATGAACAAGACCAGTTTGCTTCA
ATAACTACACCGAAAATGGTTTCAAGACGTTCGATATTAATTCATAAAGT
TTCCGATTCTAAAATGTCAACTGTTCACTCAAAGAGTTACAAAAAGAAAA
AACAGGTGAAATCACAGAAAGATGGCCAAGAATCTCTTTCTAAGGCTAAA
CACAAAGAGGATCAAAAGTCTAATATTGGTGAAGAGGATCGTTTAAAAGG
ATTGGAAAAAAGCAAGGATCCAAGCAGTTTTCTCGAACGTGATTTGAACA
TTTCCAGTGATCAAATTCTAAATAAAGAAAGCAAAAGGATAAGTAATGTG
AATAAAGCTGAATCAAACAAGGATAACATAAATAGCCGTGCATCAATTAA
TGAAAAGGAAATTCGAAAACTAAATTCTCAGAGTGAAGTCAAACCAGAAC
AGAGGAAATCTTTAATGAGGAGTTCTTTAACTACCATTGAAAAAGAAATA
AAAACTGTTGAAAGGACTACCGAAATAAAGGCTGAACCGAGGAAATCTTT
ATTAAATAATCCTGTATCTAAATCCAAAGACAATGACCAGAGAAATTCAA
AGATTGATGCCAAAGATTCTCTGGCAGTTGGAAAAAATGAAAGTATAAAT
TTATTTGATGATCCGGAAAATCTGGATGACAAAAGAGCGAGTAACTCAAA
GAAATCCGATATAGAAATCTCAGCTATGAAAGAAAATAACACAACCGCCA
TCCTTAATAGAGCCAATGATTTTATAAATGATGCAATATATGTAGAAATA
GATACAAAAAAGATTATTGAAGAAAATCAGCTATTTGACAAAGATGCCAA
AGAAACTGTTCAAATTATGTCGCCAATTTCGACATCTTCAAACAGCGGGG
AAAAGCGAATATCAACATTTGACGCATCGATATCAAAAGGGCTGTATGAT
GCGATAAATGGAACTGGTTCTTCGGAGAGTTCTCCTAGTTCGTCAAAGTC
TCAAGACACTTCTAATGATTTCAGTGCCAAGTATACCAATGAAAGTCCGG
AATTGAAAAAATTATTCAATCGAATTTCGTGGGAAAACAGTCAAAATCTA
CTCAATCTTCTAAAAATGAATCAAGCTCAAGAAAACTTTGACGAGAATGC
TGCTGTCAAAAATCGTTTTTCCGAAACTAAATCAAACAAAAGTTCAAATC
TTAAACACGTAACCTCCTCGTTCAAAGGCTCATTTGACGAACTTAACAAA
AGAATGGGTGATGACATAAACCGAAGAAAACTACCTGAACAAATGCCACC
CGAGTATTTGGAAAACAATAGATCAAAAAGTGTAAACAGATCAACACCAA
ATGACAATCAATTTCGTCCGATTTCACAAAATGTTTCTCCTCACGATGGT
CACCTTCTTCCCGATGTTCGTCAAGTTACAGATTCATTGAACCGAAACTT
GGACATCCATCATATGGGTGAACCAATAAATGGCTTACCGGAACAACAAT
TCACAAACTCTTTAAGTCATCCAACAGGCAGTCAATTTGTTGGGGATTCA
TCAGGTAATAAATTAAACGAATTTAATGAAAACGTTCCTCATTTCAGTGG
CATGAACAAATCATCACCAAATAATCAAAGATTAAATAATTTCCAATATC
TAAATGGGAAACCTGGACAGAATGATACAGCGAATGCTCAAAAGGATTGG
ATGAACAATAAAGAACAACTTGATAATAGACATAAATTGGATTCGTCAAA
TTTCACAACAGCAAATCGTTACCAAGGGGACCCTTTAACCCCAGCCGATA
TTTATCAACTTACAAGTCAAAGAACCGGCTTATCTCACCAATTAGATCCA
TCGCACATTAGATCAGACATTTATCAAAAACCAGATGCATTGAGCCCGTC
AACTGATATTCAGCATGCAAAAGACAGAGGTAATTTTCAAAGAGGAATGT
ATCACTCTTCTGATCCATCTAATCTACAAATGGAAATTCGTCATTTGACT
GATCCTATTAATTCCAATTTCAGAAGTCCAATAACGCACAACGTTGAAGA
GTTCAGCACACAAAGATTTAGAAATGAAAACGACGATTTGAATGTTAGCC
GATTTCAGCATGCGACTCCAAATAAAGAAATTGACGAACTATTAGATCGC
CTCAAAGCGATATTATCAAAAAGTGAAGAGTTTCTTCATATTTTGTCCGG
TTTCTTTTCCAATATCCCTCGAACGTCTAATATTTTATCTGATACTATAA
ATATTCCAAAGGAATTTTATTCACTACTCAAGAGCATTTGCGCGAACAAA
GAAGACGATAGTTCCAATCTAAAAAAATCCCAGTTAGGAAATGAAAAAGC
TTTGAATAAAATTTGTAAAATGCTCGGAATAATTGATGAACAAGAAAATA
ATAAAAAAGGAATTGATATTGTGAATGGTGGAGTTCATAAAAAGAAGAAC
TCTGATTTAAACAAATTTCTTAACGATTTAATGGACGAAGGCAAAAGTAA
CAGTGAAGACATTGAAAGCAATACGTATTCTTTGGATATTAACGAGACTT
TTATTAATAAAGTTGTAAAATGCGTGCTGAAAAAGCTACTGGAAACCAAT
CCGTTGATATTCAAAGATGAAAACGTCTCTAGTGATGATAACCAAACGCG
TAATTCTTTCATGTCTCCAAAAAATGAGAATGAAAAATTAAACCCCACTA
ATGCAAAATATTTAGAACACGCAATAGAAAAAGAAAAAGAAAGAAAATCA
ACGAATTCTAAATCAAATGGAGATAACAGATTCAGAGACTACAGTAGAAG
CCCATCTTTAAAAGGTCGAAAACAAATAAATATCGCTTCGATAATTGAAG
ACTGTTTACCGCACGAATCAAAGAATATGATAAATAAAAAACCAATGGAA
AAGAAAACTTTGAACAGTTTAGTTGTCTGTGACGAGATTGCAAATCGGAT
GAAAGATTTACTAGCGGAAGTCAAGCAATCCCATAAAACAAATCTCACAT
CATCGCCAGTTGAGTTTCAAACTCCGAAAACCATTCTAACAAAAACTCCG
AATTCAGAGAATTTGAATCTCATTTCGAGAGATTCTAAATTAATTCGAAG
CTTGTCAGCGAACTGTCTGGATTCGAGCATCGTCAATCCAAATCCGTTCG
CGAGTCGGCATACGGTAGCATCGATACAGAACATGATTTCCACGCCTCAT
CAAAAACAGAAAATGGCGTCTGGTACTAGGAATATAAAGAAAGAGATTAA
AGACAAATCAACTAGAATGTTTCTAAACTCAAGAACTCGTTACAACATGA
TTAATTGTAATAAAAATGAAAACAATCAAATTCAAACAAAATCCTTAAAT
AGAAATTGTAACACTAGAAAAATTTTCAAATGA
back to top

protein sequence of SMED30006855-orf-1

>SMED30006855-orf-1 ID=SMED30006855-orf-1|Name=SMED30006855-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1894bp
FCNNIFIFMNNNTDSNRVKIRYAGSIDIQDSAKQSVLKAKAIFDYSNPLL
DLEPKGSLSRAIEKQLNNPHKTFKSKHVKQYKISFAYTCTSGDSGEAINP
QITSFQRLDKTTTTSDRQFVSDKLKPVMSRIVQRLIEEYRKSKSTYPLEE
KDEKSLTANAYTLSISSSEHFPKEIKTERLSNFSKSVSPYLLNSYNSNSI
VDKDSIEYTNNRVNSNFKQIKTNSISKGTKTIFKHNNSRQVKRIQKYHSS
YKSDFLNTELGKNESYEIVCCSSKNFIHPKLLKDTFLFKKIKLIYSQNED
IRKLCKKPIISTYKMSSTHEFNNITISDFVFMNSSLTYNNTSKDVFKINL
ENLISYRRNIHFSQFNVVEKEQFNLAEITPFTNLICILAGLDNWNNFRKR
SNIYDNNFSNEGKDSSNGSENKSKSSSISISKKETFNRSVSQSSRRPSRR
ISRVERASILQRLSLNARPSLTFLEEEESLLSDLSMNSDCPVCHGDPIMC
LETEGRKSLIESYVTLLQESKGIHVRRRSNNSIDMQDLKILLYDFMAENN
TYPTEEIKQEMLKRQESLIKKKAEEEEHGYIHSDEKPKRNEVPKGEGKNP
NLPQQFLKSLTKKVEQTNEHKKTVLNNTPNGYTEVIHTVENSYEEIEITE
SANERINRLLPKENYANSADLSTKIKETVEYMDSEQRSSIGHYTRNRETI
VSKSTGLTRSRTDGKNKISQIDNAANIVKEWLTTIQPILKELEYKDLKQF
PSDVLQNTPTTLPISVNELSVNINTDEQDQFASITTPKMVSRRSILIHKV
SDSKMSTVHSKSYKKKKQVKSQKDGQESLSKAKHKEDQKSNIGEEDRLKG
LEKSKDPSSFLERDLNISSDQILNKESKRISNVNKAESNKDNINSRASIN
EKEIRKLNSQSEVKPEQRKSLMRSSLTTIEKEIKTVERTTEIKAEPRKSL
LNNPVSKSKDNDQRNSKIDAKDSLAVGKNESINLFDDPENLDDKRASNSK
KSDIEISAMKENNTTAILNRANDFINDAIYVEIDTKKIIEENQLFDKDAK
ETVQIMSPISTSSNSGEKRISTFDASISKGLYDAINGTGSSESSPSSSKS
QDTSNDFSAKYTNESPELKKLFNRISWENSQNLLNLLKMNQAQENFDENA
AVKNRFSETKSNKSSNLKHVTSSFKGSFDELNKRMGDDINRRKLPEQMPP
EYLENNRSKSVNRSTPNDNQFRPISQNVSPHDGHLLPDVRQVTDSLNRNL
DIHHMGEPINGLPEQQFTNSLSHPTGSQFVGDSSGNKLNEFNENVPHFSG
MNKSSPNNQRLNNFQYLNGKPGQNDTANAQKDWMNNKEQLDNRHKLDSSN
FTTANRYQGDPLTPADIYQLTSQRTGLSHQLDPSHIRSDIYQKPDALSPS
TDIQHAKDRGNFQRGMYHSSDPSNLQMEIRHLTDPINSNFRSPITHNVEE
FSTQRFRNENDDLNVSRFQHATPNKEIDELLDRLKAILSKSEEFLHILSG
FFSNIPRTSNILSDTINIPKEFYSLLKSICANKEDDSSNLKKSQLGNEKA
LNKICKMLGIIDEQENNKKGIDIVNGGVHKKKNSDLNKFLNDLMDEGKSN
SEDIESNTYSLDINETFINKVVKCVLKKLLETNPLIFKDENVSSDDNQTR
NSFMSPKNENEKLNPTNAKYLEHAIEKEKERKSTNSKSNGDNRFRDYSRS
PSLKGRKQINIASIIEDCLPHESKNMINKKPMEKKTLNSLVVCDEIANRM
KDLLAEVKQSHKTNLTSSPVEFQTPKTILTKTPNSENLNLISRDSKLIRS
LSANCLDSSIVNPNPFASRHTVASIQNMISTPHQKQKMASGTRNIKKEIK
DKSTRMFLNSRTRYNMINCNKNENNQIQTKSLNRNCNTRKIFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR003133T_Ag_DNA-bd
Vocabulary: molecular function
TermDefinition
GO:0003688DNA replication origin binding
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 607..627
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1087..1111
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 412..451
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 883..925
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1677..1702
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 896..919
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1188..1215
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1677..1704
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 412..447
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1641..1661
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 819..860
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 573..605
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 801..863
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 573..595
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 940..970