CUB domain-containing protein

Overview
NameCUB domain-containing protein
Smed IDSMED30006845
Length (bp)1838
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CUB domain-containing protein (SMED30006845) t-SNE clustered cells

Violin plots show distribution of expression levels for CUB domain-containing protein (SMED30006845) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CUB domain-containing protein (SMED30006845) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CUB domain-containing protein (SMED30006845) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006845

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30006845h1SMcG0009228 dd_Smed_v4_10049_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30006845h1SMcG0009228 dd_Smed_v6_10049_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CUB domain-containing protein vs. TrEMBL
Match: A0A4Z2CLQ4 (Beta-hexosaminidase subunit alpha OS=Schistosoma japonicum OX=6182 GN=EWB00_009563 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 3.167e-35
Identity = 97/256 (37.89%), Postives = 137/256 (53.52%), Query Frame = 3
Query:  285 YPENFFCEIVAQASADHI-IMLSIESFNIPSQNSLCDENYLYVFDYRSSRSKAMTSAGGEKGLCGRNFPKYPIFTTGPFITIVFKSNL-RDFIIPN-DAGFQLTLTQVQQADKNNACKSGHFQCSSINFSTTPNEEETFNGAAAFRKRDESVKKINDSPATMARQIIPSRSITTTIYFYCIPFDVICDGVRNCHDGSDED------------SNARKLCIDVT-SKSIINRFLSLGLSASIAIAVSCTIAITLCIG 1004
            YP NF CE+V     ++  IM+ IE F IPS+ + C ENYLYVFD  +++SKAM  AGGE+GLCG ++PK  IFT+  +I I F ++  R  I+P    GF++ LT +Q+    N C S +F C S       +   T +  ++ R+   S   ++ +   +  +         T+  YCI    +CDG+ NC DG DED            SN   L  D T S + ++ FLSLG+ ASIAIAVS  +  T  IG
Sbjct:   65 YPRNFSCELVVHTPIENAKIMMKIEEFYIPSKTTSCVENYLYVFDSNTAKSKAMPEAGGERGLCGPDYPKNLIFTSKSYICIAFHTSFHRPPILPGMKPGFRVILTAIQETALRNNCASDNFYCGSFPRFMASHPMLTLDSLSSDRQLYRSSLSLSQNMQNLDNERFAFNHNKQTM-GYCITKKSLCDGIVNCEDGKDEDISRCQALIGLKNSNGLLLTDDATDSNNWLSGFLSLGIPASIAIAVSTIVIFTFGIG 319          
BLAST of CUB domain-containing protein vs. TrEMBL
Match: A0A068WK66 (CUB OS=Echinococcus granulosus OX=6210 GN=EgrG_000582400 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 2.413e-34
Identity = 112/341 (32.84%), Postives = 165/341 (48.39%), Query Frame = 3
Query:  132 ASIKSSKIYNLTKSCKSFN------ENSEQTKLTIN--LTGAFIKSH----------SGYLLNSVDNEGYPENFFCEIVAQASADH-IIMLSIESFNIPSQNSLCDENYLYVFDYRSSRSKAMTSAGGEKGLCGRNFPKYPIFTTGPFITIVF-KSNLRDFIIPND----AGFQLTLTQVQQADKNNACKSGHFQCSSINFSTTPNEEETFNGAAAFRKRDESVKKINDSPATMARQIIPSRSITTTIYFYCIPFDVICDGVRNCHDGSDEDSNARKLCIDVTSK-------SIINRFLSLGLSASIAIAVSCTIAITLCIGISVCYCIKLCTSRFEPRQS 1061
             S  + + + L++ C S        E S+   L I+   +GA I SH          S  +L       YP  F CE+V  A  D+  IML+IESF IPS +  C +++LYVFD  ++RSKAM  AGGE+GLC  ++PK P+F++  +I I F  SN   F  PN      GF++ +T  Q++ + +AC  G F C S+  +         N +    +   SV+             +PS  I       C+   V CDGV NC DG DE ++   LC             S + +FLSLGL+ S++I V+  + I LC+G  +C C +   +RF  R +
Sbjct:   22 GSATNPRKFILSRDCTSMPTSIVGLEESQTKTLRIDDLESGAIIYSHDFESDALPNASSTILGQNYYAQYPLAFSCEVVIHAPLDNGRIMLTIESFFIPSSDQTCKDDFLYVFDSNTARSKAMPEAGGEQGLCLSHYPKIPVFSSKSYICIAFHTSNSPRFQFPNSEAMTPGFKIVVTAFQES-QTSACPEGRFYCGSVKNAALGGIPSVINFSGGVGESRSSVR-------------LPSTGI-------CVSERVCCDGVFNCPDGRDEFAS---LCNHFQDGGPTDQDISFLGQFLSLGLTTSVSIVVAAVLFIILCLGCIICLCRR---NRFNARST 335          
BLAST of CUB domain-containing protein vs. TrEMBL
Match: A0A564Y7C3 (CUB domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS3157 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 5.594e-34
Identity = 104/304 (34.21%), Postives = 156/304 (51.32%), Query Frame = 3
Query:  141 KSSKIYNLTKSCKSFNENSEQTKLTINLTGAFIKSHSGYLLNSVDNEGYPENFFCEIVAQASADH-IIMLSIESFNIPSQNSLCDENYLYVFDYRSSRSKAMTSAGGEKGLCGRNFPKYPIFTTGPFITIVFKS--NLRDFIIPNDA---GFQLTLTQVQQADKNNACKSGHFQCSSINFSTTPNEEETFNGAAAFRKRDESVKKINDSPATMARQIIPSRSITTTIYFYCIPFDVICDGVRNCHDGSDEDSNARKLC--IDVTSKSIINRFLSLGLSASIAIAVSCTIAITLCIGISVCYCIK 1028
            K+ +I +L  S   ++ + E    + N++ A +  H+ Y         YP  F CE+V  A  ++  IMLSIESF IPS +  C +++LYVFD  ++RSKAM  AGGE+GLC   +PK P+ ++  +I I F S  + R  ++ N A   GF++T+T  Q++ +   C    F C S+               AA      +V   N    +  R  +PS  I       C+   V CDGV NC DG DE S+   LC     + K   N FLSLGL+ +++I ++ T+ + LC+G  VCYC +
Sbjct:   52 KTLRIDDLDSSAVIYSHDFESDSGS-NVSSATVLGHNHY-------AQYPLAFACEVVIHAPVENGRIMLSIESFFIPSSDQTCKDDFLYVFDSNTARSKAMPEAGGEQGLCLSRYPKVPVLSSKSYICIAFHSSNSPRSQLLANAAVSPGFKITVTAFQES-QTYTCPEDRFYCGSL-------------ATAAASTGARNVLDYNGGGRSAVR--LPSMGI-------CVSERVRCDGVINCPDGRDEFSS---LCNRFQDSDKGFFNHFLSLGLTTTVSIVIAVTLFVVLCLGCVVCYCCR 321          
BLAST of CUB domain-containing protein vs. TrEMBL
Match: G7YS87 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_109103 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.138e-33
Identity = 101/262 (38.55%), Postives = 136/262 (51.91%), Query Frame = 3
Query:  285 YPENFFCEIVAQASADHI-IMLSIESFNIPSQNSLCDENYLYVFDYRSSRSKAMTSAGGEKGLCGRNFPKYPIFTTGPFITIVFK-SNLRDFIIPND-AGFQLTLTQVQQADKNNACKSGHFQCSSINFSTTPNEEETFNGAAAFRKRDESVKKIND----------SPATMARQIIPSRSITTTIYFYCIPFDVICDGVRNCHDGSDED---------SNARKLCIDVTSKSIINRFLSLGLSASIAIAVSCTIAITLCIG 1004
            YP  F CEI+ Q+S     IML IESF IPS    C +NYLYVFD  ++++KAM  AGGE+GLCG  +P++PIFTT P+I I F  S +R   I N   GF+L LT VQ+     +C SG F C  +  S   N  +   G+A F  R      +            SP  +  Q + ++     +  YCI    +CDGV NC DG DE          ++   +  D  +   ++  LSLG+ ASIAIAVS  +  T+ IG
Sbjct:   87 YPRGFSCEIIVQSSLKSAKIMLRIESFYIPSNTDDCVDNYLYVFDSNTAKAKAMPEAGGERGLCGATYPRFPIFTTNPYICIAFHTSGIRPPTISNQHPGFRLILTAVQET-TTQSCSSGSFYC-GVRPSLVRNTMDA--GSALFTDRRPYSALLGSSSSKQRGSEVSPGLLTEQTVGAQRQQPGL-GYCISLRTVCDGVSNCADGRDETPEHCHRRGLTDTEWIEEDAQAIGGLSGLLSLGIPASIAIAVSTIVTFTIGIG 343          
BLAST of CUB domain-containing protein vs. TrEMBL
Match: A0A3R7D3J9 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_13915s PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 3.120e-33
Identity = 101/262 (38.55%), Postives = 136/262 (51.91%), Query Frame = 3
Query:  285 YPENFFCEIVAQASADHI-IMLSIESFNIPSQNSLCDENYLYVFDYRSSRSKAMTSAGGEKGLCGRNFPKYPIFTTGPFITIVFK-SNLRDFIIPND-AGFQLTLTQVQQADKNNACKSGHFQCSSINFSTTPNEEETFNGAAAFRKRDESVKKIND----------SPATMARQIIPSRSITTTIYFYCIPFDVICDGVRNCHDGSDED---------SNARKLCIDVTSKSIINRFLSLGLSASIAIAVSCTIAITLCIG 1004
            YP  F CEI+ Q+S     IML IESF IPS    C +NYLYVFD  ++++KAM  AGGE+GLCG  +P++PIFTT P+I I F  S +R   I N   GF+L LT VQ+     +C SG F C  +  S   N  +   G+A F  R      +            SP  +  Q + ++     +  YCI    +CDGV NC DG DE          ++   +  D  +   ++  LSLG+ ASIAIAVS  +  T+ IG
Sbjct:   87 YPRGFSCEIIVQSSLKSAKIMLRIESFYIPSNTDDCVDNYLYVFDSNTAKAKAMPEAGGERGLCGATYPRFPIFTTNPYICIAFHTSGIRPPTISNQHPGFRLILTAVQET-TTQSCSSGSFYC-GVRPSLVRNTMDA--GSALFTDRRPYSALLGSSSSKQRGSEVSPGLLTEQTVGAQRQQPGL-GYCISLRTVCDGVSNCADGRDETPEHCHRRGLTDTEWIEEDAQAIGGLSGLLSLGIPASIAIAVSTIVTFTIGIG 343          
BLAST of CUB domain-containing protein vs. Ensembl Medaka
Match: mfrp (membrane frizzled-related protein [Source:NCBI gene;Acc:101159843])

HSP 1 Score: 50.0618 bits (118), Expect = 5.994e-6
Identity = 38/132 (28.79%), Postives = 60/132 (45.45%), Query Frame = 3
Query:  252 GYLLNSVDNEGYPENFFCEIVAQASADHIIMLSIESFNIPSQNSLCDENYLYVFDYRSSRSKAMTSAGGEKGLCGRNFPKYPIFTTGPFITIVFKSNLRDFIIPNDAGFQLTLTQVQQADKNNACKSGHFQC 647
            G+L +      YP    C        DHII LS  SF++ +QN +C+ +Y+ V D  S+R+  +         CG   P   + ++GP +T+VF ++        D GF  T   V   D+   C+ G + C
Sbjct:  225 GHLESPNHPSPYPHQQLCVWHISVDEDHIITLSFRSFSLETQN-VCEFDYVEVHDSISTRAGRVLGR-----FCGSTLPPA-LNSSGPHMTVVFVADEGV----ADIGFNATYQAVFILDRT--CEPGQYAC 343          
BLAST of CUB domain-containing protein vs. Planmine SMEST
Match: SMESG000049500.1 (SMESG000049500.1)

HSP 1 Score: 959.903 bits (2480), Expect = 0.000e+0
Identity = 522/541 (96.49%), Postives = 523/541 (96.67%), Query Frame = 3
Query:   57 MDFPCKSQXXXXXXXXXXXXNSMIRASIKSSKIYNLTKSCKSFNENSEQTKLTINLTGAFIKSHSGYLLNSVDNEGYPENFFCEIVAQASADHIIMLSIESFNIPSQNSLCDENYLYVFDYRSSRSKAMTSAGGEKGLCGRNFPKYPIFTTGPFITIVFKSNLRDFIIPNDAGFQLTLTQVQQADKNNACKSGHFQCSSINFSTTPNEEETFNGAAAFRKRDESVKKINDSPATMARQIIPSRSITTTIYFYCIPFDVICDGVRNCHDGSDEDSNARKLCIDVTSKSIINRFLSLGLSASIAIAVSCTIAITLCIGISVCYCIKLCTSRFEPRQSQFTKGVSTGSDYQPSNNYPINLPVNNMDTYCSSYMPSQSSQFVCIKDVSSPSSSNEQDKIYCVYQEPQFHGYANMSALGRPASEKICHWTXXXXXXXXXXXEGHHSHPETPYFKRETTFGDQSPHRNENKCRSSNSRAXXXXXXXXXXXXXXXXXXXXXXXXXHVEKKPLKKNNATQKNHKQFEKFRKYPTDNNRIIVLGPVLGEV 1679
            MDFPCKSQILFLISLHFLLLNSMIRASIKSSKIYNLTKSCKSFNENSEQTKLTINLTGAFIKSHSGYLLNSVDNEGYPENFFCEIVAQASADHIIMLSIESFNIPSQNSLCDENYLYVFDYRSSRSKAMTSAGGEKGLCGRNFPKYPIFTTGPFITIVFKSNLRDFIIPNDAGFQLTLTQVQQADKNNACKSGHFQCSSINFSTTPNEEETFNGAAAFRKRDESVKKINDSPATMARQIIPSRSITTTIYFYCIPFDVICDGVRNCHDGSDEDSNARKLCIDVTSKSIINRFLS+GLSASIAIAVSCTIAITLCIGISVCYCIKLCTSRFEPRQSQFTKGVST SDYQPSNNYPINLPVNNMDTYCSSYMPSQSSQFVCIKDVSSPSSSNEQDKIYC                 RPASEKICHWTSSSLASYPSTSEGHHSHPETPYFKRETTFGDQSPHRNENKCRSSNSRAHTSSYSHHTPTSSRSAKSTRSTKSSHVEKKPLKKNNATQKNHKQFEKFRKYPTDNNRIIVLGPVLGEV
Sbjct:    1 MDFPCKSQILFLISLHFLLLNSMIRASIKSSKIYNLTKSCKSFNENSEQTKLTINLTGAFIKSHSGYLLNSVDNEGYPENFFCEIVAQASADHIIMLSIESFNIPSQNSLCDENYLYVFDYRSSRSKAMTSAGGEKGLCGRNFPKYPIFTTGPFITIVFKSNLRDFIIPNDAGFQLTLTQVQQADKNNACKSGHFQCSSINFSTTPNEEETFNGAAAFRKRDESVKKINDSPATMARQIIPSRSITTTIYFYCIPFDVICDGVRNCHDGSDEDSNARKLCIDVTSKSIINRFLSIGLSASIAIAVSCTIAITLCIGISVCYCIKLCTSRFEPRQSQFTKGVSTKSDYQPSNNYPINLPVNNMDTYCSSYMPSQSSQFVCIKDVSSPSSSNEQDKIYC-----------------RPASEKICHWTSSSLASYPSTSEGHHSHPETPYFKRETTFGDQSPHRNENKCRSSNSRAHTSSYSHHTPTSSRSAKSTRSTKSSHVEKKPLKKNNATQKNHKQFEKFRKYPTDNNRIIVLGPVLGEV 524          
BLAST of CUB domain-containing protein vs. Planmine SMEST
Match: SMESG000049500.1 (SMESG000049500.1)

HSP 1 Score: 944.495 bits (2440), Expect = 0.000e+0
Identity = 500/519 (96.34%), Postives = 501/519 (96.53%), Query Frame = 3
Query:  123 MIRASIKSSKIYNLTKSCKSFNENSEQTKLTINLTGAFIKSHSGYLLNSVDNEGYPENFFCEIVAQASADHIIMLSIESFNIPSQNSLCDENYLYVFDYRSSRSKAMTSAGGEKGLCGRNFPKYPIFTTGPFITIVFKSNLRDFIIPNDAGFQLTLTQVQQADKNNACKSGHFQCSSINFSTTPNEEETFNGAAAFRKRDESVKKINDSPATMARQIIPSRSITTTIYFYCIPFDVICDGVRNCHDGSDEDSNARKLCIDVTSKSIINRFLSLGLSASIAIAVSCTIAITLCIGISVCYCIKLCTSRFEPRQSQFTKGVSTGSDYQPSNNYPINLPVNNMDTYCSSYMPSQSSQFVCIKDVSSPSSSNEQDKIYCVYQEPQFHGYANMSALGRPASEKICHWTXXXXXXXXXXXEGHHSHPETPYFKRETTFGDQSPHRNENKCRSSNSRAXXXXXXXXXXXXXXXXXXXXXXXXXHVEKKPLKKNNATQKNHKQFEKFRKYPTDNNRIIVLGPVLGEV 1679
            MIRASIKSSKIYNLTKSCKSFNENSEQTKLTINLTGAFIKSHSGYLLNSVDNEGYPENFFCEIVAQASADHIIMLSIESFNIPSQNSLCDENYLYVFDYRSSRSKAMTSAGGEKGLCGRNFPKYPIFTTGPFITIVFKSNLRDFIIPNDAGFQLTLTQVQQADKNNACKSGHFQCSSINFSTTPNEEETFNGAAAFRKRDESVKKINDSPATMARQIIPSRSITTTIYFYCIPFDVICDGVRNCHDGSDEDSNARKLCIDVTSKSIINRFLS+GLSASIAIAVSCTIAITLCIGISVCYCIKLCTSRFEPRQSQFTKGVST SDYQPSNNYPINLPVNNMDTYCSSYMPSQSSQFVCIKDVSSPSSSNEQDKIYC                 RPASEKICHWTSSSLASYPSTSEGHHSHPETPYFKRETTFGDQSPHRNENKCRSSNSRAHTSSYSHHTPTSSRSAKSTRSTKSSHVEKKPLKKNNATQKNHKQFEKFRKYPTDNNRIIVLGPVLGEV
Sbjct:    1 MIRASIKSSKIYNLTKSCKSFNENSEQTKLTINLTGAFIKSHSGYLLNSVDNEGYPENFFCEIVAQASADHIIMLSIESFNIPSQNSLCDENYLYVFDYRSSRSKAMTSAGGEKGLCGRNFPKYPIFTTGPFITIVFKSNLRDFIIPNDAGFQLTLTQVQQADKNNACKSGHFQCSSINFSTTPNEEETFNGAAAFRKRDESVKKINDSPATMARQIIPSRSITTTIYFYCIPFDVICDGVRNCHDGSDEDSNARKLCIDVTSKSIINRFLSIGLSASIAIAVSCTIAITLCIGISVCYCIKLCTSRFEPRQSQFTKGVSTKSDYQPSNNYPINLPVNNMDTYCSSYMPSQSSQFVCIKDVSSPSSSNEQDKIYC-----------------RPASEKICHWTSSSLASYPSTSEGHHSHPETPYFKRETTFGDQSPHRNENKCRSSNSRAHTSSYSHHTPTSSRSAKSTRSTKSSHVEKKPLKKNNATQKNHKQFEKFRKYPTDNNRIIVLGPVLGEV 502          
The following BLAST results are available for this feature:
BLAST of CUB domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CUB domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CUB domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CUB domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CUB domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CUB domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CUB domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CUB domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2CLQ43.167e-3537.89Beta-hexosaminidase subunit alpha OS=Schistosoma j... [more]
A0A068WK662.413e-3432.84CUB OS=Echinococcus granulosus OX=6210 GN=EgrG_000... [more]
A0A564Y7C35.594e-3434.21CUB domain-containing protein OS=Hymenolepis dimin... [more]
G7YS871.138e-3338.55Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A3R7D3J93.120e-3338.55Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
back to top
BLAST of CUB domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CUB domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CUB domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CUB domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CUB domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mfrp5.994e-628.79membrane frizzled-related protein [Source:NCBI gen... [more]
back to top
BLAST of CUB domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000049500.10.000e+096.49SMESG000049500.1[more]
SMESG000049500.10.000e+096.34SMESG000049500.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006845 ID=SMED30006845|Name=CUB domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1838bp
GTAATGCACTCTGTGTGAAATTCATTTAAATTTTATTCAGATGGCCAATA
TTTTGGATGGATTTTCCTTGTAAATCTCAGATTCTTTTCCTTATATCTTT
GCATTTTCTATTACTCAATAGCATGATTCGAGCAAGCATAAAGTCTTCCA
AAATATATAATCTAACGAAAAGTTGTAAATCTTTCAATGAAAACTCAGAG
CAAACGAAATTGACAATAAATCTCACAGGTGCATTTATCAAATCTCACAG
TGGCTACCTATTGAATTCTGTGGATAATGAAGGTTATCCTGAAAATTTCT
TTTGCGAAATCGTTGCCCAAGCCTCTGCAGATCATATTATAATGCTGTCA
ATTGAATCGTTTAACATTCCTTCCCAGAACTCTCTTTGCGATGAAAATTA
TCTCTACGTGTTCGATTATCGCAGTTCAAGGTCGAAAGCAATGACATCTG
CCGGAGGCGAAAAAGGTCTTTGTGGGAGAAATTTTCCCAAATATCCTATT
TTTACTACAGGTCCTTTCATTACCATAGTCTTCAAATCAAATCTCAGGGA
TTTTATAATACCAAATGACGCAGGGTTTCAATTGACTTTAACGCAGGTTC
AACAAGCCGATAAAAACAATGCTTGCAAGTCAGGCCATTTTCAGTGTTCC
AGCATCAACTTCTCAACAACACCCAATGAAGAAGAAACATTCAATGGAGC
CGCTGCGTTTCGAAAGCGAGATGAGTCTGTGAAAAAGATTAATGATTCTC
CTGCAACAATGGCTCGTCAAATCATTCCTTCACGATCCATTACTACGACA
ATTTATTTTTATTGCATTCCTTTTGATGTTATCTGTGATGGTGTGAGAAA
TTGTCATGACGGCTCAGACGAGGATTCCAACGCCAGGAAACTCTGCATCG
ATGTCACAAGTAAAAGTATTATAAACCGATTTTTGTCGCTTGGGCTGTCT
GCGTCTATTGCGATCGCGGTGAGTTGCACGATTGCCATTACGCTTTGCAT
AGGGATTAGTGTATGTTATTGTATAAAGCTTTGCACGTCTAGATTCGAAC
CTCGACAGTCTCAGTTTACAAAAGGTGTCAGTACTGGATCCGATTATCAG
CCATCAAATAATTATCCAATCAACCTTCCTGTCAATAATATGGACACCTA
TTGTAGTTCATACATGCCCAGTCAATCGTCTCAATTTGTTTGTATTAAAG
ATGTCAGTTCTCCGTCTTCTTCAAATGAACAAGATAAAATTTATTGTGTG
TATCAAGAACCTCAATTTCATGGATATGCTAACATGTCAGCTTTAGGTCG
TCCGGCTTCTGAGAAAATCTGTCACTGGACCAGCTCTTCTTTGGCTAGTT
ATCCAAGTACTTCGGAAGGTCATCACAGCCATCCTGAAACTCCATATTTT
AAAAGGGAAACAACATTTGGAGACCAAAGTCCTCATCGAAATGAAAACAA
ATGCAGATCATCTAATAGCAGGGCTCATACAAGTTCGTATTCTCACCATA
CTCCAACGAGTTCCCGGTCAGCGAAATCCACACGATCGACTAAATCCTCA
CATGTTGAAAAGAAACCTTTAAAGAAAAACAACGCAACTCAAAAGAACCA
CAAGCAGTTCGAGAAATTTCGTAAATATCCCACGGATAATAATCGGATCA
TAGTTCTTGGACCGGTGTTGGGAGAGGTTTAGAGAACCATAGATTTGTCC
TGGACATTTGTGCAAATGTACATTGATAAGTGTATTCGTGAATCTAGCTG
AACTTGATCTTACCTTTAGTGATTATATGCAATATCTCGATTCTACGGGG
AATTTCTTCAATCTCTCTTGTTTTACCTCAAGTTGAAA
back to top

protein sequence of SMED30006845-orf-1

>SMED30006845-orf-1 ID=SMED30006845-orf-1|Name=SMED30006845-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=542bp
MDFPCKSQILFLISLHFLLLNSMIRASIKSSKIYNLTKSCKSFNENSEQT
KLTINLTGAFIKSHSGYLLNSVDNEGYPENFFCEIVAQASADHIIMLSIE
SFNIPSQNSLCDENYLYVFDYRSSRSKAMTSAGGEKGLCGRNFPKYPIFT
TGPFITIVFKSNLRDFIIPNDAGFQLTLTQVQQADKNNACKSGHFQCSSI
NFSTTPNEEETFNGAAAFRKRDESVKKINDSPATMARQIIPSRSITTTIY
FYCIPFDVICDGVRNCHDGSDEDSNARKLCIDVTSKSIINRFLSLGLSAS
IAIAVSCTIAITLCIGISVCYCIKLCTSRFEPRQSQFTKGVSTGSDYQPS
NNYPINLPVNNMDTYCSSYMPSQSSQFVCIKDVSSPSSSNEQDKIYCVYQ
EPQFHGYANMSALGRPASEKICHWTSSSLASYPSTSEGHHSHPETPYFKR
ETTFGDQSPHRNENKCRSSNSRAHTSSYSHHTPTSSRSAKSTRSTKSSHV
EKKPLKKNNATQKNHKQFEKFRKYPTDNNRIIVLGPVLGEV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035914Sperma_CUB_dom_sf
IPR036055LDL_receptor-like_sf
IPR000859CUB_dom
IPR002172LDrepeatLR_classA_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000859CUB domainPFAMPF00431CUBcoord: 62..162
e-value: 3.2E-5
score: 24.2
IPR000859CUB domainPROSITEPS01180CUBcoord: 57..181
score: 10.962
IPR000859CUB domainCDDcd00041CUBcoord: 75..177
e-value: 8.764E-10
score: 54.3406
IPR035914Spermadhesin, CUB domain superfamilyGENE3DG3DSA:2.60.120.290coord: 58..184
e-value: 8.4E-13
score: 50.7
IPR035914Spermadhesin, CUB domain superfamilySUPERFAMILYSSF49854Spermadhesin, CUB domaincoord: 73..177
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 494..522
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 454..522
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 454..468
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 469..493
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..26
score: 0.691
NoneNo IPR availableTMHMMTMhelixcoord: 301..323
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 189..281
score: 9.2
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 253..273
e-value: 5.37067E-5
score: 38.3418
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 252..274