cilia- and flagella-associated protein 57

Overview
Namecilia- and flagella-associated protein 57
Smed IDSMED30006820
Uniprot Best hitCilia- and flagella-associated protein 57 OS=Homo sapiens OX=9606 GN=CFAP57 PE=2 SV=3 (E=0)
Length (bp)4184
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cilia- and flagella-associated protein 57 (SMED30006820) t-SNE clustered cells

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 57 (SMED30006820) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cilia- and flagella-associated protein 57 (SMED30006820) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 57 (SMED30006820) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006820

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006820SMESG000072029.1 SmedASXL_017420SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30006820SMESG000072029.1 dd_Smed_v4_3323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30006820SMESG000072029.1 dd_Smed_v4_3323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30006820SMESG000072029.1 dd_Smed_v4_3323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30006820SMESG000072029.1 dd_Smed_v4_3323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30006820SMESG000072029.1 dd_Smed_v4_3323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30006820SMESG000072029.1 dd_Smed_v4_3323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30006820SMESG000072029.1 dd_Smed_v4_3323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30006820SMESG000072029.1 dd_Smed_v4_3323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30006820SMESG000072029.1 dd_Smed_v6_3323_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30006820SMESG000072029.1 dd_Smed_v4_3323_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30006820SMESG000072029.1 dd_Smed_v4_3323_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30006820SMESG000072029.1 dd_Smed_v4_3323_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Human
Match: CFAP57 (cilia and flagella associated protein 57 [Source:HGNC Symbol;Acc:HGNC:26485])

HSP 1 Score: 1342.02 bits (3472), Expect = 0.000e+0
Identity = 686/1232 (55.68%), Postives = 917/1232 (74.43%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSM--RKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEF--------NLAASL-ILEEAQKL------------------ENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRK-------QGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKI 3618
            M+   A   HVFG R  V   I Y +EQ +++P G++ V YN+DQ+ QKFI G EKS  M A++ISPNRRY+A++ET  E KP I IY+L+S+  RK+K L+  +    +F S++FSPDSKYL  QTS P+  L+YW WEK K +A  R+ +   N  V Q+SF+PQD+TQ+C  GN  FK+ R++E  LK     + E QN+L HTWV+D+++++GTDTGKL L E+G+ R E         N + SL +++E++ L                   ++   ++  QV  I + SKGFA + G G+V  FEK ++K++Y++ REI IPVD  S DP +S  Q +  +C SPSEET+VA T+ +QLYS T+S TEI+K G+ ++FE L Y  H + I GL  C RKP+IATC++DRS+R+WNYETN LEL+KE+ EEAYSI+LHPSG +I+VGF+DKLRLMN+LIDDIR+FKE+S+RGC EC+FS GGH FAAV+ N+I +Y+TT+ E + SLKGH GKIR++VW  DD KLIS G DGAVYEW+ +TGKR  E VLKSCSY  ++V+ D K  +AVG+D TLKEI+DS +LRE+ + DV  T + +S+SGRM+F GT+ G+IR+ K+PL    E+ EY  H+  ITKM +T +D +L+T ++D  +  W+V DK+GR +KR++++G+AEE+L+TK+D+EEK   M EL+TRV+ELKMENEYQLRLKDMNY+EKIKELT+KFIQEMESLKTKNQVL+TEK+K++  H E + ++++K S+ELQD+E  NNQKL+LEYEKYQELQ KSQRMQE+YE+QL++ +  K QALEELTE+YE K  EK+T+LE   +D+R Q  E+EETK+ IEED DREI D K KYE++LR+E+ESN RLKGETGIM+KKF+SLQKEI+++  +I+  + E  KL+ VI++LEKD  GLK+EIQERDETIQDKEKRIYDLKKKNQEL KFKFVLDYKIKELKKQIEPRE EI+  KEQIQEME+ELE FHKQN QL LNI EL QKL++T++E++ ERQ  RD+EA V+RFKTDL+NCV+YIQ+P+ LKE +  L++K++Q            A ++ D+Q+E+TRQREHLER++A+L+KK+ K+ E+HR DYVRIMQENVSLIKEIN+LR+ELK +R+  +DLEAAL L +K       + E +R +++     +       E EE GR++EMQR  I +LRD+I
Sbjct:    1 MSAVVAQTLHVFGLRSHVANNIFYFDEQIIIFPSGNHCVKYNVDQKWQKFIPGSEKSQGMLALSISPNRRYLAISETVQE-KPAITIYELSSIPCRKRKVLNNFDFQVQKFISMAFSPDSKYLLAQTSPPESNLVYWLWEKQKVMAIVRIDT--QNNPVYQVSFSPQDNTQVCVTGNGMFKLLRFAEGTLKQTSFQRGEPQNYLAHTWVADDKIVVGTDTGKLFLFESGDQRWETSIMVKEPTNGSKSLDVIQESESLIEFPPVSSPLPSYEQMVAASSHSQMSMPQVFAIAAYSKGFACSAGPGRVLLFEKMEEKDFYRESREIRIPVDPQSNDPSQSDKQDVLCLCFSPSEETLVASTSKNQLYSITMSLTEISK-GEPAHFEYLMYPLHSAPITGLATCIRKPLIATCSLDRSIRLWNYETNTLELFKEYQEEAYSISLHPSGHFIVVGFADKLRLMNLLIDDIRSFKEYSVRGCGECSFSNGGHLFAAVNGNVIHVYTTTSLENISSLKGHTGKIRSIVWNADDSKLISGGTDGAVYEWNLSTGKRETECVLKSCSYNCVTVSPDAKIIFAVGSDHTLKEIADSLILREISAFDVTYTAIVISHSGRMMFVGTSVGTIRAMKYPLPLQKEFNEYQAHAGPITKMLLTFDDQFLLTAAEDGCLFTWKVFDKDGRGIKREREVGFAEEVLVTKTDMEEKAQVMLELKTRVEELKMENEYQLRLKDMNYSEKIKELTDKFIQEMESLKTKNQVLRTEKEKQDVYHHEHIEDLLDKQSRELQDMECCNNQKLLLEYEKYQELQLKSQRMQEEYEKQLRDNDETKSQALEELTEFYEAKLQEKTTLLEEAQEDVRQQLREFEETKKQIEEDEDREIQDIKTKYEKKLRDEKESNLRLKGETGIMRKKFSSLQKEIEERTNDIETLKGEQMKLQGVIKSLEKDIQGLKREIQERDETIQDKEKRIYDLKKKNQELGKFKFVLDYKIKELKKQIEPRENEIRVMKEQIQEMEAELENFHKQNTQLELNITELWQKLRATDQEMRRERQKERDLEALVKRFKTDLHNCVAYIQEPRLLKEKVRGLFEKYVQR-----ADMVEIAGLNTDLQQEYTRQREHLERNLATLKKKVVKEGELHRTDYVRIMQENVSLIKEINELRRELKFTRSQVYDLEAALKLTKKVRPQEVSETEPSRDMLSTAPTARL-----NEQEETGRIIEMQRLEIQRLRDQI 1218          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Human
Match: CFAP57 (cilia and flagella associated protein 57 [Source:HGNC Symbol;Acc:HGNC:26485])

HSP 1 Score: 1323.15 bits (3423), Expect = 0.000e+0
Identity = 686/1265 (54.23%), Postives = 917/1265 (72.49%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSM--RKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEF--------NLAASL-ILEEAQKL------------------ENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQE---------------------------------MESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRK-------QGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKI 3618
            M+   A   HVFG R  V   I Y +EQ +++P G++ V YN+DQ+ QKFI G EKS  M A++ISPNRRY+A++ET  E KP I IY+L+S+  RK+K L+  +    +F S++FSPDSKYL  QTS P+  L+YW WEK K +A  R+ +   N  V Q+SF+PQD+TQ+C  GN  FK+ R++E  LK     + E QN+L HTWV+D+++++GTDTGKL L E+G+ R E         N + SL +++E++ L                   ++   ++  QV  I + SKGFA + G G+V  FEK ++K++Y++ REI IPVD  S DP +S  Q +  +C SPSEET+VA T+ +QLYS T+S TEI+K G+ ++FE L Y  H + I GL  C RKP+IATC++DRS+R+WNYETN LEL+KE+ EEAYSI+LHPSG +I+VGF+DKLRLMN+LIDDIR+FKE+S+RGC EC+FS GGH FAAV+ N+I +Y+TT+ E + SLKGH GKIR++VW  DD KLIS G DGAVYEW+ +TGKR  E VLKSCSY  ++V+ D K  +AVG+D TLKEI+DS +LRE+ + DV  T + +S+SGRM+F GT+ G+IR+ K+PL    E+ EY  H+  ITKM +T +D +L+T ++D  +  W+V DK+GR +KR++++G+AEE+L+TK+D+EEK   M EL+TRV+ELKMENEYQLRLKDMNY+EKIKELT+KFIQEMESLKTKNQVL+TEK+K++  H E + ++++K S+ELQD+E  NNQKL+LEYEKYQELQ KSQRMQE+YE+QL++ +  K QALEELTE+YE K  EK+T+LE   +D+R Q  E+EETK+ IEED DREI D K KYE++LR+E+ESN RLKGETGIM+KKF+SLQKEI+++  +I+  + E  KL+ VI++LEKD  GLK+EIQERDETIQDKEKRIYDLKKKNQEL KFKFVLDYKIKELKKQIEPRE EI+  KEQIQE                                 ME+ELE FHKQN QL LNI EL QKL++T++E++ ERQ  RD+EA V+RFKTDL+NCV+YIQ+P+ LKE +  L++K++Q            A ++ D+Q+E+TRQREHLER++A+L+KK+ K+ E+HR DYVRIMQENVSLIKEIN+LR+ELK +R+  +DLEAAL L +K       + E +R +++     +       E EE GR++EMQR  I +LRD+I
Sbjct:    1 MSAVVAQTLHVFGLRSHVANNIFYFDEQIIIFPSGNHCVKYNVDQKWQKFIPGSEKSQGMLALSISPNRRYLAISETVQE-KPAITIYELSSIPCRKRKVLNNFDFQVQKFISMAFSPDSKYLLAQTSPPESNLVYWLWEKQKVMAIVRIDT--QNNPVYQVSFSPQDNTQVCVTGNGMFKLLRFAEGTLKQTSFQRGEPQNYLAHTWVADDKIVVGTDTGKLFLFESGDQRWETSIMVKEPTNGSKSLDVIQESESLIEFPPVSSPLPSYEQMVAASSHSQMSMPQVFAIAAYSKGFACSAGPGRVLLFEKMEEKDFYRESREIRIPVDPQSNDPSQSDKQDVLCLCFSPSEETLVASTSKNQLYSITMSLTEISK-GEPAHFEYLMYPLHSAPITGLATCIRKPLIATCSLDRSIRLWNYETNTLELFKEYQEEAYSISLHPSGHFIVVGFADKLRLMNLLIDDIRSFKEYSVRGCGECSFSNGGHLFAAVNGNVIHVYTTTSLENISSLKGHTGKIRSIVWNADDSKLISGGTDGAVYEWNLSTGKRETECVLKSCSYNCVTVSPDAKIIFAVGSDHTLKEIADSLILREISAFDVTYTAIVISHSGRMMFVGTSVGTIRAMKYPLPLQKEFNEYQAHAGPITKMLLTFDDQFLLTAAEDGCLFTWKVFDKDGRGIKREREVGFAEEVLVTKTDMEEKAQVMLELKTRVEELKMENEYQLRLKDMNYSEKIKELTDKFIQEMESLKTKNQVLRTEKEKQDVYHHEHIEDLLDKQSRELQDMECCNNQKLLLEYEKYQELQLKSQRMQEEYEKQLRDNDETKSQALEELTEFYEAKLQEKTTLLEEAQEDVRQQLREFEETKKQIEEDEDREIQDIKTKYEKKLRDEKESNLRLKGETGIMRKKFSSLQKEIEERTNDIETLKGEQMKLQGVIKSLEKDIQGLKREIQERDETIQDKEKRIYDLKKKNQELGKFKFVLDYKIKELKKQIEPRENEIRVMKEQIQENDPILKWPQRVEIHLYNFRKQVRKVLLWGTLPQMEAELENFHKQNTQLELNITELWQKLRATDQEMRRERQKERDLEALVKRFKTDLHNCVAYIQEPRLLKEKVRGLFEKYVQR-----ADMVEIAGLNTDLQQEYTRQREHLERNLATLKKKVVKEGELHRTDYVRIMQENVSLIKEINELRRELKFTRSQVYDLEAALKLTKKVRPQEVSETEPSRDMLSTAPTARL-----NEQEETGRIIEMQRLEIQRLRDQI 1251          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Human
Match: CFAP57 (cilia and flagella associated protein 57 [Source:HGNC Symbol;Acc:HGNC:26485])

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 328/648 (50.62%), Postives = 452/648 (69.75%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSM--RKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNL--------AASL-ILEEAQKL------------------ENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKM 1887
            M+   A   HVFG R  V   I Y +EQ +++P G++ V YN+DQ+ QKFI G EKS  M A++ISPNRRY+A++ET  E KP I IY+L+S+  RK+K L+  +    +F S++FSPDSKYL  QTS P+  L+YW WEK K +A  R+ +   N  V Q+SF+PQD+TQ+C  GN  FK+ R++E  LK     + E QN+L HTWV+D+++++GTDTGKL L E+G+ R E ++        + SL +++E++ L                   ++   ++  QV  I + SKGFA + G G+V  FEK ++K++Y++ REI IPVD  S DP +S  Q +  +C SPSEET+VA T+ +QLYS T+S TEI+K G+ ++FE L Y  H + I GL  C RKP+IATC++DRS+R+WNYETN LEL+KE+ EEAYSI+LHPSG +I+VGF+DKLRLMN+LIDDIR+FKE+S+RGC EC+FS GGH FAAV+ N+I +Y+TT+ E + SLKGH GKIR++VW  DD KLIS G DGAVYEW+ +TGKR  E VLKSCSY  ++V+ D K  +AVG+D TLKEI+DS +LRE+ + DV  T + +S+SGRM+F GT+ G+IR+ K+PL    E+ EY  H+  ITK+
Sbjct:    1 MSAVVAQTLHVFGLRSHVANNIFYFDEQIIIFPSGNHCVKYNVDQKWQKFIPGSEKSQGMLALSISPNRRYLAISETVQE-KPAITIYELSSIPCRKRKVLNNFDFQVQKFISMAFSPDSKYLLAQTSPPESNLVYWLWEKQKVMAIVRIDT--QNNPVYQVSFSPQDNTQVCVTGNGMFKLLRFAEGTLKQTSFQRGEPQNYLAHTWVADDKIVVGTDTGKLFLFESGDQRWETSIMVKEPTNGSKSLDVIQESESLIEFPPVSSPLPSYEQMVAASSHSQMSMPQVFAIAAYSKGFACSAGPGRVLLFEKMEEKDFYRESREIRIPVDPQSNDPSQSDKQDVLCLCFSPSEETLVASTSKNQLYSITMSLTEISK-GEPAHFEYLMYPLHSAPITGLATCIRKPLIATCSLDRSIRLWNYETNTLELFKEYQEEAYSISLHPSGHFIVVGFADKLRLMNLLIDDIRSFKEYSVRGCGECSFSNGGHLFAAVNGNVIHVYTTTSLENISSLKGHTGKIRSIVWNADDSKLISGGTDGAVYEWNLSTGKRETECVLKSCSYNCVTVSPDAKIIFAVGSDHTLKEIADSLILREISAFDVTYTAIVISHSGRMMFVGTSVGTIRAMKYPLPLQKEFNEYQAHAGPITKV 644          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Human
Match: CFAP57 (cilia and flagella associated protein 57 [Source:HGNC Symbol;Acc:HGNC:26485])

HSP 1 Score: 159.073 bits (401), Expect = 5.003e-44
Identity = 82/169 (48.52%), Postives = 113/169 (66.86%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSM--RKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDS 531
            M+   A   HVFG R  V   I Y +EQ +++P G++ V YN+DQ+ QKFI G EKS  M A++ISPNRRY+A++ET  E KP I IY+L+S+  RK+K L+  +    +F S++FSPDSKYL  QTS P+  L+YW WEK K +A  R+ +   N  V Q+SF+PQD+
Sbjct:    1 MSAVVAQTLHVFGLRSHVANNIFYFDEQIIIFPSGNHCVKYNVDQKWQKFIPGSEKSQGMLALSISPNRRYLAISETVQE-KPAITIYELSSIPCRKRKVLNNFDFQVQKFISMAFSPDSKYLLAQTSPPESNLVYWLWEKQKVMAIVRIDT--QNNPVYQVSFSPQDN 166          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Human
Match: CFAP57 (cilia and flagella associated protein 57 [Source:HGNC Symbol;Acc:HGNC:26485])

HSP 1 Score: 117.472 bits (293), Expect = 9.648e-31
Identity = 56/73 (76.71%), Postives = 69/73 (94.52%), Query Frame = 1
Query: 1987 DKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQV 2205
            ++++G+AEE+L+TK+D+EEK   M EL+TRV+ELKMENEYQLRLKDMNY+EKIKELT+KFIQEMESLKTKNQV
Sbjct:    2 EREVGFAEEVLVTKTDMEEKAQVMLELKTRVEELKMENEYQLRLKDMNYSEKIKELTDKFIQEMESLKTKNQV 74          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Celegans
Match: snrp-40.1 (Small Nuclear RibonucleoProtein homolog [Source:UniProtKB/TrEMBL;Acc:Q19211])

HSP 1 Score: 53.5286 bits (127), Expect = 6.194e-7
Identity = 41/172 (23.84%), Postives = 77/172 (44.77%), Query Frame = 1
Query: 1474 SLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYT-GISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVD--VQLTTVTLSNSGRMLFCGTNNGSIRSF-------KFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQ 1959
            ++KGH+G + ++ +TTD   L+SCG D +V  WD  TG  C         +   +  ++ G    A  +D     + D +    V++     Q T VT ++S   +  G  +  ++ +        + LT         GH   IT + ++P+  ++++ S DC V  W ++
Sbjct:   76 TIKGHSGAVMDLKFTTDSSSLVSCGTDKSVRVWDMETGT-CARRFRTHTDFVNAVHPSRRGVTLVASASDDGTCRVHDMRTKEPVKTYTNRYQQTAVTFNDSSDQVISGGIDNVLKVWDMRRDEITYTLT---------GHRDTITGISLSPSGKFIISNSMDCTVRQWDIR 237          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Celegans
Match: prp-4 (Yeast PRP (Splicing factor) related [Source:UniProtKB/TrEMBL;Acc:Q93339])

HSP 1 Score: 52.7582 bits (125), Expect = 1.684e-6
Identity = 43/225 (19.11%), Postives = 95/225 (42.22%), Query Frame = 1
Query: 1165 IATCAVDRSVRIWNY-ETNQLELYKEFAEEAYSIALHPSGLYILVG-FSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHY-FAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDS--QVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKF 1824
            + +C+ D +V +W+  + + +   ++  +    +A HP+G ++    F    R+ ++       ++E   +   + AF   G       H    +++       +M L GH  +I +V W  +  ++I+   D ++  WD    +        +   T +     G+   +   D TLK  S +  Q LR+++  D ++  V +S  G+ +    ++   R+FK 
Sbjct:  269 VVSCSYDGTVLLWSLSQESPIGELEQHPQRVSKVAFHPNGHHLATACFDSTWRMYDLTTKKELLYQEGHSKSVADVAFHPDGSVALTGGHDCYGRVWDMRTGRCIMFLDGHTKEIHSVEWMPNGYEMITGSSDNSMKVWDLRMRRNTYTMPAHTSVVTRVRADAAGQYLVSASFDCTLKMWSTTGWQPLRQLQGHDTRILCVDISPDGQWM---CSSAFDRTFKL 490          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Celegans
Match: snrp-40.2 (Small Nuclear RibonucleoProtein homolog [Source:UniProtKB/TrEMBL;Acc:O02097])

HSP 1 Score: 51.6026 bits (122), Expect = 2.546e-6
Identity = 44/173 (25.43%), Postives = 72/173 (41.62%), Query Frame = 1
Query: 1456 NFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESV-----DVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQ 1959
            NF V   LKGH G I  V +  D   L+S G D  V  WD  TG         +     + V + G       +D     + D   +R  E+        Q T VT +++   + CG  +  I+ +   + +        GH   IT + ++ N ++L++ S DC +M W ++
Sbjct:   71 NFAV---LKGHKGAIMEVKFNADSSHLVSAGTDKTVRVWDMETGSCIRNFKSHTDIVNSVDVNRRGPQMICSASDDGTVMVHD---MRSKEAAKKFICKYQQTAVTFNDAADNVICGGIDNQIKVWD--MLRNDVRYVLSGHRDTITSLSVSHNGNFLLSNSMDCSLMSWDIR 235          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Celegans
Match: gpb-2 (Guanine nucleotide-binding protein subunit beta-2 [Source:UniProtKB/Swiss-Prot;Acc:Q20636])

HSP 1 Score: 50.447 bits (119), Expect = 7.357e-6
Identity = 65/294 (22.11%), Postives = 113/294 (38.44%), Query Frame = 1
Query: 1117 HYSQILGLDLCRRKPIIATCAVDRSVRIWN-YETNQLELYKEFAEEAYSIALHPSGLYILVG-FSDKLRLMNILI-DDI-----RTFKEFSIRGCKECAFSYGGHY-FAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDD--KKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREV-----ESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIW 1950
            H  ++L +D    K  I + + D  V +W+ + TN+            + A  PS   I  G   +K  ++ +   DDI     +     S   C  C F    +        +   I+   + +++ +  GH G +  +     D     IS G D     WD  +G+ C +S     +           + +A G+D     + D +  R+V     ES+   +  V  S SGR+LF G   G  R   +   K        GH  +I+ ++ +P+   + + S DC + IW
Sbjct:   80 HVGKVLCMDWSLDKRHIVSSSQDGKVIVWDGFTTNKEHALTMPTTWVMACAFSPSSQMIACGGLDNKCSVVPLSFEDDIIQKKRQVATHTSYMSC--CTFLRSDNLILTGSGDSTCAIWDVESGQLIQNFHGHTGDVFAIDVPKCDTGNTFISAGADKHSLVWDIRSGQ-CVQSFEGHEADINTVRFHPNGDAFATGSDDATCRLFDLRADRQVCVYEKESILFPVNGVDFSLSGRILFAGY--GDYRVGVWDSLKCARHSVLYGHENRISCLRTSPDGTAVCSASWDCTIRIW 368          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Fly
Match: CG4329 (gene:FBgn0034745 transcript:FBtr0071940)

HSP 1 Score: 461.07 bits (1185), Expect = 1.915e-140
Identity = 336/1139 (29.50%), Postives = 591/1139 (51.89%), Query Frame = 1
Query:   61 VFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILAN-EFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIR-----TEFNLAASLILEEA---------QKLENNQGV-LNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISV-TQDGKNTYAVGTDKTLKEISDSQVLREV---ESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPG--EWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDL 3411
            ++G R  V G I +   + ++YP    L  ++  Q  Q+F+  L +  +   ++IS +R+ +A+ E  S++   I IY+L +++K++ L  P    N E   + F+ DS+ +A  T  P+  LI    +K+  +   R T P ++     I+ NP D   +   G     +   SE        LKV+ +      ++S + +++GT   +LILVENGE +     ++ +    +I +E          Q+    Q V L + +V  + +  KGFA      +   FE+      +K  R+ ++ V +N     +   QI+N + I   +ET++  T+  Q+Y   L   E  K      FE L    H  +I+ + +C  KPII T + D+++RIWNYET  +EL ++F  +   + L  +G    +GFSD+LR+  I +DD+   K ++   C    +S  GH  AA + N I I S    +V+++LKGHNG + +V W+  DK LIS G +GA+Y WD  TG R  E V K   Y  IS  T D    YA  +  T++E  DS ++RE+         ++ V L+ S  ++F   + G++ + + P  + G   +  +      + K++ + +   L  IS+   + IW + + EG+    D+D+  ++E+LI +S L +K   +A L  R+ +   E +YQL   ++   ++++E+   +   +E LK  N  ++    +E      +++ + E+H  +L  + +  ++++++EY+K+  L+     ++E YE +L+      +  +E L   Y+ +  E+  ++ +L K+M+D+  E+ E  R +E + DR ++ T+ +YE +L  ER      +G+ G+++KKF S  +EID+  EE++  + E  K +  I+   ++   L+K+I +RD  I  KEKRI DL  KNQELDK+K VL +KI ELK QIEPRE +I   ++ I EME+ELE  ++ N QL L + E++ K  S   EL+TER   +     +    +D+Y     I   + LK+++  L++KH  +D     +     ++DA+++ EF RQR  +E +V    K +++D  + +  Y ++ +ENV LI+EI  L
Sbjct:   26 IYGLRSDVIGNIHFNLTKEVIYPVEGVLAFHDYVQNKQRFLR-LPEDTRPEVISISSHRKLLAVVERHSKNGRYISIYELATLKKRRHLELPSNHRNAEIQQMIFTNDSRSVALITRPPEETLIMLVLDKTSTVIEGRATIPGSHGGAECIAGNPNDCNFMAVGGERTLLLMSKSERGFSISNNLKVKYR-VTSMAFLSLDLLMIGTSDDQLILVENGEQKLAQKASDADTVDLMIDQEVFDRDKELQEQRFLPTQAVSLPDRRVLCMTAFPKGFAYII-FNRAFVFERVSK---FKFERKTILTVPTNLY--AEHMYQILN-LAIDHKQETVIVTTSHCQIYVGILIVPETLKT-KQLKFEPLGVLIHTGEIIAMSVCAWKPIIMTASRDQTIRIWNYETALVELVRKFQVDVNIVELSLTGQMAAIGFSDQLRITQIFMDDLNIVKTYNFPHCNAVRYSNFGHMMAAAYDNNIAITSVYKLDVLINLKGHNGIVLSVAWSRTDKFLISGGAEGAIYLWDIETGARLQEIVQKGTEYVTISCSTNDPLTIYAGTSIGTIREFQDSTLMREITIPSRTKGSVSDVCLARSDLIMFVADHEGNLFNMQLPFLEAGGGTFTNFRFFDGPVNKLRFSYDGTLLFAISNKGTLAIWAMDNIEGKVPYMDQDLMRSQEVLIPRSQLNDKIEQIANLELRLKQQAEEFQYQLSQNEIFDGQQLQEVHRSYCSALEELKELNNEIEARHTEEMNHITFQINSIREEHRIQLDTLATQYSERMLIEYQKFTNLRENMLELRESYEDKLKNSTGTLQDTVEALENNYKQQLNERKELIRDLMKEMQDKKAEFIEYCREVELENDRNMVSTQTEYENKLTTERNETQMWRGKAGVLQKKFESQSREIDNLLEEVEILKEEHHKSQRNIQKQMRNIEDLQKDIADRDYAINGKEKRIQDLLHKNQELDKYKQVLGHKIAELKAQIEPREFQINDKRKHIIEMEAELEGLNQNNVQLELQLKEMRDKYLSNVAELRTERHRAKASRECLHSICSDIYYVAGEINSAEALKKAVKELFRKHASDD-----ELKRFVTLDAEVRDEFMRQRRQIE-NVLDRYKSVAEDKSVQKK-YDKLFKENVILIEEIEKL 1147          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Fly
Match: CG3436 (gene:FBgn0031229 transcript:FBtr0078119)

HSP 1 Score: 60.4622 bits (145), Expect = 4.492e-9
Identity = 38/168 (22.62%), Postives = 76/168 (45.24%), Query Frame = 1
Query: 1462 EVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVD--VQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQ 1959
            E VM++ GH+G +    +T D   + +C  D  +  WD  TG+R             +  ++ G+     G+D    +I D++      +++   Q+T V   ++G  +  G  +  ++ +   + K        GHS  IT M ++P  D+++T + D  + +W V+
Sbjct:   89 ENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHTLESPFQVTAVCFGDTGEQVISGGIDNEVKIWD--IRKQAVLHHLRGHSDTITGMSLSPEGDFILTNAMDNTLRVWDVR 254          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Fly
Match: CG3436 (gene:FBgn0031229 transcript:FBtr0340650)

HSP 1 Score: 60.4622 bits (145), Expect = 4.492e-9
Identity = 38/168 (22.62%), Postives = 76/168 (45.24%), Query Frame = 1
Query: 1462 EVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVD--VQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQ 1959
            E VM++ GH+G +    +T D   + +C  D  +  WD  TG+R             +  ++ G+     G+D    +I D++      +++   Q+T V   ++G  +  G  +  ++ +   + K        GHS  IT M ++P  D+++T + D  + +W V+
Sbjct:   89 ENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHTLESPFQVTAVCFGDTGEQVISGGIDNEVKIWD--IRKQAVLHHLRGHSDTITGMSLSPEGDFILTNAMDNTLRVWDVR 254          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Fly
Match: Prp19 (gene:FBgn0261119 transcript:FBtr0086723)

HSP 1 Score: 56.9954 bits (136), Expect = 8.993e-8
Identity = 43/171 (25.15%), Postives = 78/171 (45.61%), Query Frame = 1
Query: 1462 EVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGK-----RCGESVLKSCSYTGISVTQDGKNTYAVGTDK--TLKEISDSQVLREV-ESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIW 1950
            ++V  LKGH  KI  V++  ++  +I+   D  +  W   T +     RC E  +     TG+S+   G    +  +DK     +I   ++L +V ++ +V LTT      G +   GT +  ++ +   L +      + GH+  I+ +  + N  YL T +DD  V +W
Sbjct:  256 QMVAILKGHTKKITKVIYHPNEDTVITGSPDMNIRIWHVPTSQTQLLLRCHEGPV-----TGLSLHPTGDYLLSTSSDKHWAFSDIRTGRLLTKVIDTAEVGLTTAQFHPDGLIFGTGTVDSQVKIWD--LKEQSNVANFPGHTGPISAISFSENGYYLATAADDACVKLW 419          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Fly
Match: Wdr62 (gene:FBgn0031374 transcript:FBtr0110882)

HSP 1 Score: 53.5286 bits (127), Expect = 1.857e-6
Identity = 46/180 (25.56%), Postives = 80/180 (44.44%), Query Frame = 1
Query:   52 LKHVFGFRVGVNGAIAYQN-EQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEF-------TSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFK 567
            LK V G  V  N A+        L YP G  +V++N  +++Q ++    +    T++A S   RYVA  E      P I +++L +        +   +  EF       T ++FSP  KYL    S  D ++  + W  + ++AS +++S  A      + F+ +D +    +GN   K
Sbjct:   25 LKKVLGLTVCSNAALDVSPVSGLLAYPAGCTVVLFNAKRQTQAYLVNTSRK-AFTSVAFSRCGRYVATGECGI--NPAIKVWELETPNGSLEHCSGGSVVAEFVDHKYAVTCVAFSPTGKYLVSVGSQHDMIVNVFDWRANLKMASNKISSKVA-----AVCFS-EDGSYFVTVGNRHVK 195          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Zebrafish
Match: cfap57 (cilia and flagella associated protein 57 [Source:ZFIN;Acc:ZDB-GENE-110411-266])

HSP 1 Score: 975.311 bits (2520), Expect = 0.000e+0
Identity = 491/981 (50.05%), Postives = 689/981 (70.23%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNS--MRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNV-QVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQE 2964
            MA  AA   HVFG R GV   + Y +EQT+++PCG+N V YNIDQ+ Q+FI G E+S  M A+AIS NRRY+A++E    +K  I ++DL     R++K L+  E++ +EF  ++FSPDSKYL GQ  GPDW L  W WEK K +A+  +++   N  +NQ+SFNPQD+++IC  G   FK+F Y+   LK     K +S NFLCHTW++ E+V+ GT+TG+L++ E+G +R E N+ +    E   K + +    + + QVT IVS S GFA + G G V  FEKT+  + YKK R I IP    S D   ++ Q I+ +CISPSEET+VA T++ QLYS  LS  E+ K G+ + FE LS+SFH + I GL  C RKP+IAT ++DRSVRIWN+ETN LELYKEF EEAYS+ALHP+GLYILVGFSDKLRLM +L+DDI+ FKEF+IR C+EC FS+GGH FAAV+ N+I IYST  FE +++LKGHN K++ V ++ +D  L+SCGMDGAVYEW+T +G R  ES+LK+CSYTG++++ D K  +AVGTD +LKEI +SQ+L+E+ S DV  TTV LS SGR +F GT+ G++R  K+PL    +W EY  H+  ITKM IT +D +L+T+S+D  + IW++ DKEG+ +KR+K++ ++EEIL  K D +EK+  + EL  +V+EL+ +N+ QL LKD  YN+KI EL+EK +Q++ SL  + +VLK EKD ++  H + + +++E+H KEL D+ES+NNQKLMLEYEKYQELQ K   +Q++YE+QL  +E  K QALE++ + YE K  EK  ++     + + +  E+EE  R  EED D EI D ++KYE+ LREE++++++LK E    KK+F  LQ+EI++   EI+K + E Q+L+ VI++LE D  GLK  IQ RD  IQDKEK I+ LKKKN  L+K   V++++ + +++QIEP+E EIQ  K+Q+ E
Sbjct:    1 MATVAAP-SHVFGLRAGVKNNLLYLDEQTIIFPCGNNCVRYNIDQKFQRFIPGTERSQGMHALAISTNRRYLAVSE--CREKATITVFDLEQEQNRRRKVLTGGEMVVDEFVCMAFSPDSKYLIGQAGGPDWTLFLWMWEKKKVMATVNISN---NGPINQVSFNPQDNSKICVSGKGVFKIFHYAGETLKQTNAFKTDSHNFLCHTWMTTEQVLAGTETGQLMMFESGRLRWEINVTSVQKTESESKQQYSDEPFSALPQVTAIVSYSNGFACSMGQGTVCLFEKTEKADLYKKTRVIKIPPKRFSNDLSLTEKQKISTLCISPSEETLVASTDLGQLYSIHLSIAELQK-GECAYFEYLSHSFHNNIITGLSTCIRKPLIATSSLDRSVRIWNFETNVLELYKEFQEEAYSVALHPTGLYILVGFSDKLRLMTLLMDDIKIFKEFTIRNCRECTFSHGGHLFAAVNGNVINIYSTITFEEILNLKGHNEKVQAVAFSLNDSCLVSCGMDGAVYEWNTLSGTRESESILKTCSYTGVAISPDAKTFFAVGTDCSLKEIHNSQILKEMSSRDVVCTTVALSRSGRTIFIGTSTGTLRVIKYPLMIQNDWIEYQAHAGPITKMVITFDDQFLITVSEDGCLFIWKIIDKEGQGLKREKELIYSEEILTNKLDFDEKSKMLLELNAKVEELQEDNKCQLSLKDTEYNKKINELSEKCMQQIISLNAEKEVLKKEKDNQQEAHNKAISDILERHDKELHDMESSNNQKLMLEYEKYQELQLKLHNVQQEYEQQLHSMEESKTQALEDMMQSYEAKMEEKMILVNQYQDESQQRFKEFEEHIRQEEEDTDAEIHDIRMKYEQNLREEKKAHSKLKVELDTTKKRFHDLQREIENGNLEIEKLKQEVQRLQAVIKSLENDITGLKTAIQNRDGIIQDKEKNIFQLKKKNDTLNKTLEVMEFRAEYMQEQIEPKENEIQQQKDQMVE 974          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Zebrafish
Match: cfap57 (cilia and flagella associated protein 57 [Source:ZFIN;Acc:ZDB-GENE-110411-266])

HSP 1 Score: 719.539 bits (1856), Expect = 0.000e+0
Identity = 349/675 (51.70%), Postives = 477/675 (70.67%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNS--MRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNV-QVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEK 2046
            MA  AA   HVFG R GV   + Y +EQT+++PCG+N V YNIDQ+ Q+FI G E+S  M A+AIS NRRY+A++E    +K  I ++DL     R++K L+  E++ +EF  ++FSPDSKYL GQ  GPDW L  W WEK K +A+  +++   N  +NQ+SFNPQD+++IC  G   FK+F Y+   LK     K +S NFLCHTW++ E+V+ GT+TG+L++ E+G +R E N+ +    E   K + +    + + QVT IVS S GFA + G G V  FEKT+  + YKK R I IP    S D   ++ Q I+ +CISPSEET+VA T++ QLYS  LS  E+ K G+ + FE LS+SFH + I GL  C RKP+IAT ++DRSVRIWN+ETN LELYKEF EEAYS+ALHP+GLYILVGFSDKLRLM +L+DDI+ FKEF+IR C+EC FS+GGH FAAV+ N+I IYST  FE +++LKGHN K++ V ++ +D  L+SCGMDGAVYEW+T +G R  ES+LK+CSYTG++++ D K  +AVGTD +LKEI +SQ+L+E+ S DV  TTV LS SGR +F GT+ G++R  K+PL    +W EY  H+  ITKM IT +D +L+T+S+D  + IW++ DKEG+ +KR+K++ ++EEIL  K D +EK
Sbjct:    1 MATVAAP-SHVFGLRAGVKNNLLYLDEQTIIFPCGNNCVRYNIDQKFQRFIPGTERSQGMHALAISTNRRYLAVSE--CREKATITVFDLEQEQNRRRKVLTGGEMVVDEFVCMAFSPDSKYLIGQAGGPDWTLFLWMWEKKKVMATVNISN---NGPINQVSFNPQDNSKICVSGKGVFKIFHYAGETLKQTNAFKTDSHNFLCHTWMTTEQVLAGTETGQLMMFESGRLRWEINVTSVQKTESESKQQYSDEPFSALPQVTAIVSYSNGFACSMGQGTVCLFEKTEKADLYKKTRVIKIPPKRFSNDLSLTEKQKISTLCISPSEETLVASTDLGQLYSIHLSIAELQK-GECAYFEYLSHSFHNNIITGLSTCIRKPLIATSSLDRSVRIWNFETNVLELYKEFQEEAYSVALHPTGLYILVGFSDKLRLMTLLMDDIKIFKEFTIRNCRECTFSHGGHLFAAVNGNVINIYSTITFEEILNLKGHNEKVQAVAFSLNDSCLVSCGMDGAVYEWNTLSGTRESESILKTCSYTGVAISPDAKTFFAVGTDCSLKEIHNSQILKEMSSRDVVCTTVALSRSGRTIFIGTSTGTLRVIKYPLMIQNDWIEYQAHAGPITKMVITFDDQFLITVSEDGCLFIWKIIDKEGQGLKREKELIYSEEILTNKLDFDEK 668          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 100.908 bits (250), Expect = 6.193e-21
Identity = 142/637 (22.29%), Postives = 261/637 (40.97%), Query Frame = 1
Query:  121 VYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVA---LAETTSEDK---PVIVIYDLNSMRKKKTLSAPEILANEF-------TSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNL-KNFGIL-KVESQNF-LCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGF-SDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFA-AVHSNLIQIYSTT----NFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKR-CGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKP-GEWQEYLGHSAQITKMKITPNDDYLV-TISDDCVVMIWRV 1956
            VY   S +V+YN+D++ Q+  +G   +  +  +A+ P++  +A   +A T+S+ K   P + ++D        +L+   IL N F        S S S    +L       D +L  W W++  +LA  +     +N SV    F+P D+  I   G +    +   + +L K  G+  K E   F LC T+  +   I G  +G +++   G  R       SL ++ A   E +   L  ++  T+VS  K   +      + W       E ++K++ + +P       P ++ A+           ET++  T  + +   +L+   I     H++           ++ GL +   K    TC  D+ + +W+ +++Q    K   + A S   HPSG  + VG  + +  +++    D+ T             FS  G++ A   H N I IY+       +  V    GH+  I ++ W+ D + L+S   D  +  W  +  K+       +   +   + T  G + + +  D +             +  D+    V  S + R+L  G + G +  F FP ++       Y GHS+ +T +    +D +LV T   D  +M WRV
Sbjct:  250 VYFIASVVVLYNVDEQLQRHYTG--HTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWD------SVSLNTLHILGNGFFDRALVCLSFSKSNGGSWLCVVDDSNDHMLSVWDWQREDRLAEVK----CSNESVFAADFHPTDANIIVTCGKSHLCFWSLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRI------SLAIQGAH--EASVFALCMLRNGTLVSGGKDRKL------ISW------DENFQKIQTVEVP---ELYGPVRTVAE--------GRGETVLIGTTKNYVLQGSLNGEFIPITQGHTD-----------ELWGLTIHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVGMQTGRWLVLDTESKDLVTVHTDGNEQLSVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTL-GFHVFGLWPDGS-------------DGTDIN--AVCSSYAKRLLVTGDDFGKVHLFSFPCSQSRAPSHIYSGHSSHVTNVNFLFDDSHLVSTGGKDMSIMQWRV 816          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 100.523 bits (249), Expect = 6.361e-21
Identity = 142/637 (22.29%), Postives = 261/637 (40.97%), Query Frame = 1
Query:  121 VYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVA---LAETTSEDK---PVIVIYDLNSMRKKKTLSAPEILANEF-------TSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNL-KNFGIL-KVESQNF-LCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGF-SDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFA-AVHSNLIQIYSTT----NFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKR-CGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKP-GEWQEYLGHSAQITKMKITPNDDYLV-TISDDCVVMIWRV 1956
            VY   S +V+YN+D++ Q+  +G   +  +  +A+ P++  +A   +A T+S+ K   P + ++D        +L+   IL N F        S S S    +L       D +L  W W++  +LA  +     +N SV    F+P D+  I   G +    +   + +L K  G+  K E   F LC T+  +   I G  +G +++   G  R       SL ++ A   E +   L  ++  T+VS  K   +      + W       E ++K++ + +P       P ++ A+           ET++  T  + +   +L+   I     H++           ++ GL +   K    TC  D+ + +W+ +++Q    K   + A S   HPSG  + VG  + +  +++    D+ T             FS  G++ A   H N I IY+       +  V    GH+  I ++ W+ D + L+S   D  +  W  +  K+       +   +   + T  G + + +  D +             +  D+    V  S + R+L  G + G +  F FP ++       Y GHS+ +T +    +D +LV T   D  +M WRV
Sbjct:  233 VYFIASVVVLYNVDEQLQRHYTG--HTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWD------SVSLNTLHILGNGFFDRALVCLSFSKSNGGSWLCVVDDSNDHMLSVWDWQREDRLAEVK----CSNESVFAADFHPTDANIIVTCGKSHLCFWSLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRI------SLAIQGAH--EASVFALCMLRNGTLVSGGKDRKL------ISW------DENFQKIQTVEVP---ELYGPVRTVAE--------GRGETVLIGTTKNYVLQGSLNGEFIPITQGHTD-----------ELWGLTIHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVGMQTGRWLVLDTESKDLVTVHTDGNEQLSVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTL-GFHVFGLWPDGS-------------DGTDIN--AVCSSYAKRLLVTGDDFGKVHLFSFPCSQSRAPSHIYSGHSSHVTNVNFLFDDSHLVSTGGKDMSIMQWRV 799          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 100.523 bits (249), Expect = 6.446e-21
Identity = 142/637 (22.29%), Postives = 261/637 (40.97%), Query Frame = 1
Query:  121 VYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVA---LAETTSEDK---PVIVIYDLNSMRKKKTLSAPEILANEF-------TSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNL-KNFGIL-KVESQNF-LCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGF-SDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFA-AVHSNLIQIYSTT----NFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKR-CGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKP-GEWQEYLGHSAQITKMKITPNDDYLV-TISDDCVVMIWRV 1956
            VY   S +V+YN+D++ Q+  +G   +  +  +A+ P++  +A   +A T+S+ K   P + ++D        +L+   IL N F        S S S    +L       D +L  W W++  +LA  +     +N SV    F+P D+  I   G +    +   + +L K  G+  K E   F LC T+  +   I G  +G +++   G  R       SL ++ A   E +   L  ++  T+VS  K   +      + W       E ++K++ + +P       P ++ A+           ET++  T  + +   +L+   I     H++           ++ GL +   K    TC  D+ + +W+ +++Q    K   + A S   HPSG  + VG  + +  +++    D+ T             FS  G++ A   H N I IY+       +  V    GH+  I ++ W+ D + L+S   D  +  W  +  K+       +   +   + T  G + + +  D +             +  D+    V  S + R+L  G + G +  F FP ++       Y GHS+ +T +    +D +LV T   D  +M WRV
Sbjct:  242 VYFIASVVVLYNVDEQLQRHYTG--HTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWD------SVSLNTLHILGNGFFDRALVCLSFSKSNGGSWLCVVDDSNDHMLSVWDWQREDRLAEVK----CSNESVFAADFHPTDANIIVTCGKSHLCFWSLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRI------SLAIQGAH--EASVFALCMLRNGTLVSGGKDRKL------ISW------DENFQKIQTVEVP---ELYGPVRTVAE--------GRGETVLIGTTKNYVLQGSLNGEFIPITQGHTD-----------ELWGLTIHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVGMQTGRWLVLDTESKDLVTVHTDGNEQLSVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTL-GFHVFGLWPDGS-------------DGTDIN--AVCSSYAKRLLVTGDDFGKVHLFSFPCSQSRAPSHIYSGHSSHVTNVNFLFDDSHLVSTGGKDMSIMQWRV 808          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Xenopus
Match: wrn (Werner syndrome, RecQ helicase-like [Source:Xenbase;Acc:XB-GENE-992875])

HSP 1 Score: 1406.35 bits (3639), Expect = 0.000e+0
Identity = 710/1216 (58.39%), Postives = 927/1216 (76.23%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSM--RKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAA----------SLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQE-DVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRKQGEAARQLVAAVTANKPQPLVEKEL---EEAGRVMEMQRALIGQLRDKIVGME 3630
            M++  A   ++FG R  V   I Y +EQT+++P G+N V YN+DQ+ QKFI G EKS  M A+AISPNRRY+A++E   E K  + IYDL S+  +K+K LSAP++ A+EF SI+FSPDSKYL  Q+  P+W +I+W WEK K +A+ +  S +    + Q+SF+PQD+TQIC  G+  FK+FRY E N+K     KVE QNFLCHTW+S++RVI GTD GKL L E+G++R E N+ +          S   +E Q           V++  I++ SKGF  + G GKV  FEK +DK++YK+ R+I IP D  S DP +S+ Q I  MC+SPSEE ++  TN  QLYS  LSS EI+K G+ + FE L+ S+H S I GL +C RKP+IATC++DRSVRIWN+E N LELYKE+ EEAYS++LHPSGLY+LVGFSDKLR MN+LIDDIR+ KEF++RGCKECAFS+GGH FAAV+ N+I IY T  FE + +LKGHNGK+R+V W++DD KL+SCG+DGAVYEW+   GKR  E VLKSCSY+ ++++ D K  +AVG+D+TLKEISDSQ++RE+ S DV  T V +S+SGRM+F GT+ G+IRS K+PL    E+ EY  H+  +T++ +T +D YL+++S+D  +++W++ DKEGR +KRDK++G+AEE+LITKSDLEEKN  M EL+TRV+ELKMENEYQLRLKDMNYNEK+KELTEKFIQEME LKT NQ+LKT+ ++++ KH+E + E++EK S+E+QD+E++N+QKL+LEYEKYQELQ KSQRMQE+YE+QL ELE  K QALEE+TE+YE K  EK ++L+    + R    E+EETK+ IEED DREI D KI+YERRLREE+ES+ RLKGE+GIM+KKF+SLQKEI+++  +I+K + E QKL+ VI++LEKD +GLK+EIQERDETIQDKEKRIYDLKKKNQEL+KFKFVLDYKIKELKKQIEPRE EI+  KEQIQEMESELERFHKQN+QL LNI ELKQKLK+T++E+  ERQ  RD+EA V+RFKTDL+NCV +IQ+PK LK++I  LY K++Q+ DV+          VDADIQ+E+ RQREHLERS+++L+KKL+KD+EIHR D VR+MQENV+LIKEINDLR+ELK SRT  HDLEA LGL++K  +     +   ++    P+    L   EE  R+++MQR  I +LRD I   E
Sbjct:    1 MSVIVAQSHYIFGLRSPVTNNIFYFDEQTIIFPSGNNCVKYNVDQKWQKFIPGSEKSQGMQALAISPNRRYLAMSEKGLE-KATVTIYDLASVPFKKRKVLSAPDLTAHEFVSIAFSPDSKYLVAQSGFPEWQIIFWMWEKQKVMATVKPDSHSN--PIYQVSFSPQDNTQICTTGHGVFKLFRYLEGNMKQTNFQKVEPQNFLCHTWLSEDRVICGTDNGKLSLWESGDLRWEINIGSKSGQTDHEKHSAYSQELQVTSAEHAAPAPVRINAILAYSKGFLCSAGPGKVCMFEKVEDKDFYKRSRDIRIPQDEYSTDPTQSEQQEIVCMCLSPSEEMVLISTNKGQLYSIALSSAEISK-GEDAYFEYLTESWHSSSITGLSICVRKPLIATCSLDRSVRIWNFENNTLELYKEYQEEAYSVSLHPSGLYVLVGFSDKLRFMNLLIDDIRSVKEFTVRGCKECAFSHGGHLFAAVNGNVIHIYCTATFENITNLKGHNGKVRSVAWSSDDSKLVSCGLDGAVYEWNILLGKRESECVLKSCSYSSVAMSSDSKTIFAVGSDQTLKEISDSQIMREIPSFDVTYTAVAVSHSGRMIFTGTSLGTIRSMKYPLPLQKEFNEYQAHAKPVTRLVVTFDDQYLLSVSEDGCLILWKISDKEGRGLKRDKEVGYAEEVLITKSDLEEKNQVMLELKTRVEELKMENEYQLRLKDMNYNEKLKELTEKFIQEMEVLKTTNQILKTDSERQDIKHQEDVAELLEKQSREIQDLETSNSQKLLLEYEKYQELQLKSQRMQEEYEKQLHELEESKIQALEEITEHYEAKLQEKMSVLQLTQDESRQHLREFEETKKQIEEDGDREIQDMKIRYERRLREEKESSLRLKGESGIMRKKFSSLQKEIEERAADIEKMKAEQQKLQGVIKSLEKDILGLKREIQERDETIQDKEKRIYDLKKKNQELEKFKFVLDYKIKELKKQIEPRENEIKEMKEQIQEMESELERFHKQNSQLDLNIAELKQKLKATDREMHKERQKVRDIEAVVKRFKTDLHNCVGFIQEPKMLKDNIRELYSKYVQDSDVAEI------VGVDADIQREYARQREHLERSLSTLQKKLAKDTEIHRTDNVRVMQENVTLIKEINDLRRELKLSRTKVHDLEAILGLNKKTRKNNATELKVSSSEGLHPVGVLRLNSEEETDRIIDMQRLEIKRLRDLIQSQE 1206          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Xenopus
Match: wrn (Werner syndrome, RecQ helicase-like [Source:Xenbase;Acc:XB-GENE-992875])

HSP 1 Score: 1387.47 bits (3590), Expect = 0.000e+0
Identity = 709/1234 (57.46%), Postives = 926/1234 (75.04%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSM--RKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLEN---------NQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQE---------------------MESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQE-DVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRK-QGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKIVGME 3630
            M++  A   ++FG R  V   I Y +EQT+++P G+N V YN+DQ+ QKFI G EKS  M A+AISPNRRY+A++E   E K  + IYDL S+  +K+K LSAP++ A+EF SI+FSPDSKYL  Q+  P+W +I+W WEK K +A+ +  S +    + Q+SF+PQD+TQIC  G+  FK+FRY E N+K     KVE QNFLCHTW+S++RVI GTD GKL L E+G++R E N+ +   +  + +L +                V++  I++ SKGF  + G GKV  FEK +DK++YK+ R+I IP D  S DP +S+ Q I  MC+SPSEE ++  TN  QLYS  LSS EI+K G+ + FE L+ S+H S I GL +C RKP+IATC++DRSVRIWN+E N LELYKE+ EEAYS++LHPSGLY+LVGFSDKLR MN+LIDDIR+ KEF++RGCKECAFS+GGH FAAV+ N+I IY T  FE + +LKGHNGK+R+V W++DD KL+SCG+DGAVYEW+   GKR  E VLKSCSY+ ++++ D K  +AVG+D+TLKEISDSQ++RE+ S DV  T V +S+SGRM+F GT+ G+IRS K+PL    E+ EY  H+  +T++ +T +D YL+++S+D  +++W++ DKEGR +KRDK++G+AEE+LITKSDLEEKN  M EL+TRV+ELKMENEYQLRLKDMNYNEK+KELTEKFIQEME LKT NQ+LKT+ ++++ KH+E + E++EK S+E+QD+E++N+QKL+LEYEKYQELQ KSQRMQE+YE+QL ELE  K QALEE+TE+YE K  EK ++L+    + R    E+EETK+ IEED DREI D KI+YERRLREE+ES+ RLKGE+GIM+KKF+SLQKEI+++  +I+K + E QKL+ VI++LEKD +GLK+EIQERDETIQDKEKRIYDLKKKNQEL+KFKFVLDYKIKELKKQIEPRE EI+  KEQIQE                     MESELERFHKQN+QL LNI ELKQKLK+T++E+  ERQ  RD+EA V+RFKTDL+NCV +IQ+PK LK++I  LY K++Q+ DV+          VDADIQ+E+ RQREHLERS+++L+KKL+KD+EIHR D VR+MQENV+LIKEINDLR+ELK SRT  HDLEA LGL++K +   A +L           L     EE  R+++MQR  I +LRD I   E
Sbjct:    1 MSVIVAQSHYIFGLRSPVTNNIFYFDEQTIIFPSGNNCVKYNVDQKWQKFIPGSEKSQGMQALAISPNRRYLAMSEKGLE-KATVTIYDLASVPFKKRKVLSAPDLTAHEFVSIAFSPDSKYLVAQSGFPEWQIIFWMWEKQKVMATVKPDSHSN--PIYQVSFSPQDNTQICTTGHGVFKLFRYLEGNMKQTNFQKVEPQNFLCHTWLSEDRVICGTDNGKLSLWESGDLRWEINIGSKSGIYRSTELSSCFVFRVTSAEHAAPAPVRINAILAYSKGFLCSAGPGKVCMFEKVEDKDFYKRSRDIRIPQDEYSTDPTQSEQQEIVCMCLSPSEEMVLISTNKGQLYSIALSSAEISK-GEDAYFEYLTESWHSSSITGLSICVRKPLIATCSLDRSVRIWNFENNTLELYKEYQEEAYSVSLHPSGLYVLVGFSDKLRFMNLLIDDIRSVKEFTVRGCKECAFSHGGHLFAAVNGNVIHIYCTATFENITNLKGHNGKVRSVAWSSDDSKLVSCGLDGAVYEWNILLGKRESECVLKSCSYSSVAMSSDSKTIFAVGSDQTLKEISDSQIMREIPSFDVTYTAVAVSHSGRMIFTGTSLGTIRSMKYPLPLQKEFNEYQAHAKPVTRLVVTFDDQYLLSVSEDGCLILWKISDKEGRGLKRDKEVGYAEEVLITKSDLEEKNQVMLELKTRVEELKMENEYQLRLKDMNYNEKLKELTEKFIQEMEVLKTTNQILKTDSERQDIKHQEDVAELLEKQSREIQDLETSNSQKLLLEYEKYQELQLKSQRMQEEYEKQLHELEESKIQALEEITEHYEAKLQEKMSVLQLTQDESRQHLREFEETKKQIEEDGDREIQDMKIRYERRLREEKESSLRLKGESGIMRKKFSSLQKEIEERAADIEKMKAEQQKLQGVIKSLEKDILGLKREIQERDETIQDKEKRIYDLKKKNQELEKFKFVLDYKIKELKKQIEPRENEIKEMKEQIQEVRFKRIHFLVFVSLHSSCSSPMESELERFHKQNSQLDLNIAELKQKLKATDREMHKERQKVRDIEAVVKRFKTDLHNCVGFIQEPKMLKDNIRELYSKYVQDSDVAEI------VGVDADIQREYARQREHLERSLSTLQKKLAKDTEIHRTDNVRVMQENVTLIKEINDLRRELKLSRTKVHDLEAILGLNKKTRKNNATELKGMHFCLSFIFLRLNSEEETDRIIDMQRLEIKRLRDLIQSQE 1224          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Xenopus
Match: EML6 (echinoderm microtubule associated protein like 6 [Source:NCBI gene;Acc:100498213])

HSP 1 Score: 95.5153 bits (236), Expect = 5.998e-19
Identity = 165/750 (22.00%), Postives = 299/750 (39.87%), Query Frame = 1
Query:   52 LKHVFGFR-VGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNL----KNFG-ILKVESQNFLCHTWVSDERVIL-GTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDK--EYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLEL-YKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRG--CKECAFSY-GGHYFA-AVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKL-ISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTK-PGEWQEYLGHSAQITKMKITPNDDYLVTISD-DCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEER 2250
            LK V G+R       + Y     +VY   +  V+Y+  Q SQ+F  G +    + ++AI P + YVA  +   +    I ++D  +++    L          +++ FS D K L       +  ++YW W+K +++A TR         +  +  NP  + ++  +G    K ++ +          FG I K+E+   +C ++   E ++  G  TG + + ++            ++L +  K  +         V  + +  KGF      G V  ++   ++  + Y   R  L P          S+  ++ D   +PS   I A T  H        + EI ++       LL       ++ GL    + P+ AT + D+++RIW   +    L  ++  +     A  P G  + VG SD   L+ +  D +     F  R     +  FS   G Y A A H N + IY+  + + V   KG +  I ++ W T  K L ++ G    ++ ++   GKR    V+K+     I       +T+      T + I  +       S    +   +L+   + L  G + G ++ F +P+     ++++Y+GHSA +T ++   +D  L+T+   D  +MIW  +                         LE K     E  T  +E    +    R K ++Y  KI  ++   I+EME  K   Q+       +EA  EER
Sbjct:  679 LKFVHGYRGYDCRNNLFYTQAGEVVYHVAAIAVVYDRLQHSQRFYLGHDDD--ILSLAIHPVKDYVATGQVGRD--AAIHVWDTQTLKCLSLLKGQH--QRGVSALDFSADGKCLVSVGLDDNHTIVYWDWKKGEKIACTR----GHKDKIFVVKCNPHHTDKLVTVGMKHIKFWQQTGGGFTAKRGTFGTIGKLET--MMCVSYGRAEDLVFSGAATGDIYIWKD------------VVLLKTIKAHDGP-------VFAMYALDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAALSP---------SSKGLLLED---NPS---IRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLATHPQLPLCATVSDDKTLRIWELSSQHRMLAVRKLKKGGRCCAFSPDGKALAVGLSDGSFLV-VNADTLEDMVSFHHRKEIIADIKFSPDAGKYLAVASHDNFVDIYNVLSSKRVGICKGASSYITHIDWDTRGKLLQVNSGAKEQLF-YEAPRGKR---YVIKAAEMEKIE-----WHTWTCVLGPTCEGIWPAH------SDITDVNAASLTKDRKALATGDDFGFVKLFSYPVKGCDAKFKKYVGHSAHVTNVRWLYDDSTLLTVGGADTALMIWTRE---------------------AFGSLENKPVDSEESDTDAEEDGGYDSDVAREKSIDYTTKIYAVS---IREMEGTKPHQQL-------KEASAEER 1335          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Xenopus
Match: EML6 (echinoderm microtubule associated protein like 6 [Source:NCBI gene;Acc:100498213])

HSP 1 Score: 94.7449 bits (234), Expect = 9.153e-19
Identity = 165/750 (22.00%), Postives = 299/750 (39.87%), Query Frame = 1
Query:   52 LKHVFGFR-VGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNL----KNFG-ILKVESQNFLCHTWVSDERVIL-GTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDK--EYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLEL-YKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRG--CKECAFSY-GGHYFA-AVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKL-ISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTK-PGEWQEYLGHSAQITKMKITPNDDYLVTISD-DCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEER 2250
            LK V G+R       + Y     +VY   +  V+Y+  Q SQ+F  G +    + ++AI P + YVA  +   +    I ++D  +++    L          +++ FS D K L       +  ++YW W+K +++A TR         +  +  NP  + ++  +G    K ++ +          FG I K+E+   +C ++   E ++  G  TG + + ++            ++L +  K  +         V  + +  KGF      G V  ++   ++  + Y   R  L P          S+  ++ D   +PS   I A T  H        + EI ++       LL       ++ GL    + P+ AT + D+++RIW   +    L  ++  +     A  P G  + VG SD   L+ +  D +     F  R     +  FS   G Y A A H N + IY+  + + V   KG +  I ++ W T  K L ++ G    ++ ++   GKR    V+K+     I       +T+      T + I  +       S    +   +L+   + L  G + G ++ F +P+     ++++Y+GHSA +T ++   +D  L+T+   D  +MIW  +                         LE K     E  T  +E    +    R K ++Y  KI  ++   I+EME  K   Q+       +EA  EER
Sbjct:  679 LKFVHGYRGYDCRNNLFYTQAGEVVYHVAAIAVVYDRLQHSQRFYLGHDDD--ILSLAIHPVKDYVATGQVGRD--AAIHVWDTQTLKCLSLLKGQH--QRGVSALDFSADGKCLVSVGLDDNHTIVYWDWKKGEKIACTR----GHKDKIFVVKCNPHHTDKLVTVGMKHIKFWQQTGGGFTAKRGTFGTIGKLET--MMCVSYGRAEDLVFSGAATGDIYIWKD------------VVLLKTIKAHDGP-------VFAMYALDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAALSP---------SSKGLLLED---NPS---IRAITLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLATHPQLPLCATVSDDKTLRIWELSSQHRMLAVRKLKKGGRCCAFSPDGKALAVGLSDGSFLV-VNADTLEDMVSFHHRKEIIADIKFSPDAGKYLAVASHDNFVDIYNVLSSKRVGICKGASSYITHIDWDTRGKLLQVNSGAKEQLF-YEAPRGKR---YVIKAAEMEKIE-----WHTWTCVLGPTCEGIWPAH------SDITDVNAASLTKDRKALATGDDFGFVKLFSYPVKGCDAKFKKYVGHSAHVTNVRWLYDDSTLLTVGGADTALMIWTRE---------------------AFGSLENKPVDSEESDTDAEEDGGYDSDVAREKSIDYTTKIYAVS---IREMEGTKPHQQL-------KEASAEER 1335          

HSP 2 Score: 53.9138 bits (128), Expect = 2.454e-6
Identity = 28/81 (34.57%), Postives = 45/81 (55.56%), Query Frame = 1
Query: 1717 REVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLT-KPGEWQEYLGHSAQITKMKITPNDDYLV-TISDDCVVMIWR 1953
            R  +  DV    V  S++G  +  G + G ++ F FP T K  + + Y GHSA +T ++ + +D Y++ T  DDC V +WR
Sbjct: 1878 RNADKADVNCACV--SHAGINVVTGDDFGLVKLFDFPCTEKFAKHKRYFGHSAHVTNVRFSHDDKYIISTGGDDCSVFVWR 1956          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Xenopus
Match: gucy1a2 (guanylate cyclase 1, soluble, alpha 2 [Source:Xenbase;Acc:XB-GENE-1011801])

HSP 1 Score: 72.0182 bits (175), Expect = 5.641e-12
Identity = 140/681 (20.56%), Postives = 264/681 (38.77%), Query Frame = 1
Query:   52 LKHVFGFRVGV-NGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSED-KPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMF---------RYSENNLKNF----GILKVESQN-------FLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAAS----------LILEEAQKLENNQG----VLNNVQ----VTTIVSSSKG--FAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIY--STTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLK--EISDSQVLREVE-SVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEY-LGHSAQITKMKITPNDDYLVTISDDCVVMIW 1950
            L+ + GF   V +G I++ + + L+YP G  +++ N+  R Q+F+ G   ++ ++ +A S + RY+A  + T    K  I+++D         L+  ++   +  +++FSP+  YL       D  ++ W   K + +  +  +S ++  +   I  N  D   +   GN   +++         R +E  L         L+V SQ+       F C T   D   IL  +T   +L      + +F+L  +          L+     KL   +G        VQ    VT+I    +G  F V  G  +++ F        Y + +E LI             ++ IND+        + A          T S  +I      ++ ELL  +      L +D  R    I +   D  +R +  E+ +L    E A        H  G+  +   SD  R++                       S GG          ++I+  S     +V S+K H   +  +    ++++ ++   DG    WD     R  + VL +  +  +    +       GTD+ +   E+ D   +RE+E S    +  + + + G     G ++  ++ + +     GE     +GHS  IT++KI P   Y++++S D  ++ W
Sbjct:   12 LQGIIGFNGHVPSGLISHPDREHLIYPLGCTVIIENLSSRKQQFLQG--HTNNVSCVAASRSGRYLASGQVTYMGFKADILLWDYGRREACAKLTLHKV---KVEALAFSPNDLYLVSLGGQDDGSVVVWNVAKREAICGSPASSLSSGHATTIIFTNNSDDIFMTG-GNGTLRVWDVDLPNRKMRPTECQLGQMKRVVTCLQVTSQSCFTDDSCFYCGTSSGD---ILTINTKSKLLSSFAPQKGKFSLGVTALRLLKTGELLVGSGDGKLALCKGPNYKAAKTVQLQGSVTSISLRGQGHQFFVGTGGAQIYRFS-------YPEFKEELIAT---------CHSEAINDIAFPFGTSELFA----------TCSKNDIRVWHTATHKELLRITVPNMTCLAIDFMRDGKSIISAWNDGRIRAFMPESGRLMYCIENA--------HSMGVTAIAATSDCKRIV-----------------------SGGGE-------GQVRIWEISKETQRLVQSMKEHKSSVTCIKLKGNNRECLTASSDGTCIIWDIVRFTRL-QMVLSNTLFRCVCYHPEEFQFVTSGTDRKVGYWEVFDGSAIRELEGSKSGAINGMDICDQGAHFVTGGDDKLVKVWDY---NEGEVTHVGIGHSGNITRLKICPLSKYIISVSTDGAILCW 615          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Mouse
Match: Cfap57 (cilia and flagella associated protein 57 [Source:MGI Symbol;Acc:MGI:2686209])

HSP 1 Score: 1338.17 bits (3462), Expect = 0.000e+0
Identity = 683/1226 (55.71%), Postives = 914/1226 (74.55%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSM--RKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNL-------AASL-ILEEAQKLENNQGVLNNV------------------QVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRK--QGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKI 3618
            M+   A   HVFG R  V   + + +EQ +++P G++ V YNIDQ+ QKFI+G +KS  M A+AISPNRRY+A++ET  E KP + IY+L+S+  RK+K L+  +    +FTS++FSPDSKYL  QTS PD  L+YW WEK K +A  +  S   N  + Q+S + QD++Q+C  G+  FK+ R++E  LK     + ES N+L H WVS++RVI+GTDTGKL L E+G+ R E ++       + SL +++E++ L     + + V                  QV  I + SKGFA + G G+V  FEK ++K++Y++ REI IP D  S DP +S  Q +  +C SPSEET++A TN +QLYS T+S TEI+K G+ ++FE L Y  H + I GLD C RKP+IATC++DRSVRIWNYE+N LELYKE+ EEAY+++LHPSG YI+VGF+DKLRLMN+LIDDIR FKE+S+RGCKEC+FS GGH FAAV+ N+I I++TT+ E +  LKGH GKIR++VW  DD KL+S G DGAVYEW+ +TGKR  E VLKSCSY  ++ + D K  +AVG+D+TLKEISDS +LRE+ + DV  T++T+S+SGRM+F GT+ G+IR+ K+PL+   E+ EY  H+  + KM +T +D +L+T+ +D  +  W+V DK+GR +KR++++G+AEE+L+TK+D+EEK   M EL+TRV+ELKMENEYQLRLKDMNY EKIKELT+KFIQEMESLKTKNQVLKTEK+K++  H ERL E+++K ++ELQD+E  NNQKL+LEYEKYQELQ KSQRMQE+YE+QL++ +  K QALEELTE+YE K  EK+ +LE   +D+R Q  E+EETK+ IEED DREI D K KYER+LR+E+ESN RLKGETGIM+KKF+SLQKEI+++  +I+  ++E  KL+ +IR+LEKD  GLK+EIQERDETIQDKEKRIYDLKKKNQEL+KFKFVLDYKIKELKKQIEPRE EI+  KEQIQEME+ELERFHKQN QL LNI EL QKL++T++E++ E+Q  RD+EA VRRFKTDL+NCV+YIQ+P  LKE I  L++K++Q            A +++D+Q+E+ RQREHLER++A+L+KK+ K+ E+HR DYVRIMQENVSLIKEIN+LR+ELK +R+  +DLE+AL + +K    E    +++         +   E EE GR++EMQR  I +LRD+I
Sbjct:    1 MSTVVAQALHVFGLRPHVTNNVFFFDEQIIIFPSGNHCVKYNIDQKWQKFIAGSDKSQGMLALAISPNRRYLAISETVQE-KPAVTIYELSSIPCRKRKVLNNFDFQVQKFTSMAFSPDSKYLLTQTSPPDSNLVYWLWEKQKVMAIIKADS--QNNPIYQVSISSQDNSQVCITGSGVFKLLRFAEGTLKQINFQRGESSNYLAHAWVSEDRVIVGTDTGKLFLFESGDQRWETSIMVKESTSSRSLEVIQESESLIEFPPLSSPVSSVERMDITTNTQQQAMPQVFAIAAYSKGFACSAGPGRVLLFEKVEEKDFYRESREIRIPTDQQSNDPSQSDKQDVLCLCFSPSEETLIASTNKNQLYSITMSLTEISK-GEAAHFEYLLYPLHSASITGLDTCIRKPLIATCSLDRSVRIWNYESNTLELYKEYQEEAYTVSLHPSGHYIVVGFADKLRLMNLLIDDIRPFKEYSVRGCKECSFSNGGHLFAAVNGNVIHIFTTTSLENINILKGHTGKIRSLVWNLDDSKLVSAGTDGAVYEWNLSTGKRETECVLKSCSYNSVTTSPDAKVIFAVGSDQTLKEISDSLILREIPAFDVIYTSITISHSGRMIFVGTSVGTIRAMKYPLSLQKEYNEYQAHAGPVMKMLLTFDDQFLLTVGEDGCLFTWKVFDKDGRGIKREREVGFAEEVLVTKTDMEEKAQIMLELKTRVEELKMENEYQLRLKDMNYTEKIKELTDKFIQEMESLKTKNQVLKTEKEKQDISHRERLEELVDKQTRELQDLECCNNQKLLLEYEKYQELQLKSQRMQEEYEKQLRDNDETKSQALEELTEFYEAKLQEKTGLLEEAQEDVRQQLREFEETKKQIEEDEDREIQDIKTKYERKLRDEKESNLRLKGETGIMRKKFSSLQKEIEERTNDIELLKSEQMKLQGIIRSLEKDIQGLKREIQERDETIQDKEKRIYDLKKKNQELEKFKFVLDYKIKELKKQIEPRENEIKVMKEQIQEMEAELERFHKQNTQLELNITELLQKLRATDQEMRKEQQKERDLEALVRRFKTDLHNCVAYIQEPGLLKEKIRGLFEKYVQR-----ADMVEIAGLNSDLQQEYARQREHLERNLATLKKKVIKEGELHRTDYVRIMQENVSLIKEINELRRELKLTRSQIYDLESALKVSKKTRSQEVPESVISKDVVGSTSTMRLNEQEETGRIIEMQRLEIRRLRDQI 1217          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Mouse
Match: Cfap57 (cilia and flagella associated protein 57 [Source:MGI Symbol;Acc:MGI:2686209])

HSP 1 Score: 1338.17 bits (3462), Expect = 0.000e+0
Identity = 683/1226 (55.71%), Postives = 914/1226 (74.55%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSM--RKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNL-------AASL-ILEEAQKLENNQGVLNNV------------------QVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRK--QGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKI 3618
            M+   A   HVFG R  V   + + +EQ +++P G++ V YNIDQ+ QKFI+G +KS  M A+AISPNRRY+A++ET  E KP + IY+L+S+  RK+K L+  +    +FTS++FSPDSKYL  QTS PD  L+YW WEK K +A  +  S   N  + Q+S + QD++Q+C  G+  FK+ R++E  LK     + ES N+L H WVS++RVI+GTDTGKL L E+G+ R E ++       + SL +++E++ L     + + V                  QV  I + SKGFA + G G+V  FEK ++K++Y++ REI IP D  S DP +S  Q +  +C SPSEET++A TN +QLYS T+S TEI+K G+ ++FE L Y  H + I GLD C RKP+IATC++DRSVRIWNYE+N LELYKE+ EEAY+++LHPSG YI+VGF+DKLRLMN+LIDDIR FKE+S+RGCKEC+FS GGH FAAV+ N+I I++TT+ E +  LKGH GKIR++VW  DD KL+S G DGAVYEW+ +TGKR  E VLKSCSY  ++ + D K  +AVG+D+TLKEISDS +LRE+ + DV  T++T+S+SGRM+F GT+ G+IR+ K+PL+   E+ EY  H+  + KM +T +D +L+T+ +D  +  W+V DK+GR +KR++++G+AEE+L+TK+D+EEK   M EL+TRV+ELKMENEYQLRLKDMNY EKIKELT+KFIQEMESLKTKNQVLKTEK+K++  H ERL E+++K ++ELQD+E  NNQKL+LEYEKYQELQ KSQRMQE+YE+QL++ +  K QALEELTE+YE K  EK+ +LE   +D+R Q  E+EETK+ IEED DREI D K KYER+LR+E+ESN RLKGETGIM+KKF+SLQKEI+++  +I+  ++E  KL+ +IR+LEKD  GLK+EIQERDETIQDKEKRIYDLKKKNQEL+KFKFVLDYKIKELKKQIEPRE EI+  KEQIQEME+ELERFHKQN QL LNI EL QKL++T++E++ E+Q  RD+EA VRRFKTDL+NCV+YIQ+P  LKE I  L++K++Q            A +++D+Q+E+ RQREHLER++A+L+KK+ K+ E+HR DYVRIMQENVSLIKEIN+LR+ELK +R+  +DLE+AL + +K    E    +++         +   E EE GR++EMQR  I +LRD+I
Sbjct:    1 MSTVVAQALHVFGLRPHVTNNVFFFDEQIIIFPSGNHCVKYNIDQKWQKFIAGSDKSQGMLALAISPNRRYLAISETVQE-KPAVTIYELSSIPCRKRKVLNNFDFQVQKFTSMAFSPDSKYLLTQTSPPDSNLVYWLWEKQKVMAIIKADS--QNNPIYQVSISSQDNSQVCITGSGVFKLLRFAEGTLKQINFQRGESSNYLAHAWVSEDRVIVGTDTGKLFLFESGDQRWETSIMVKESTSSRSLEVIQESESLIEFPPLSSPVSSVERMDITTNTQQQAMPQVFAIAAYSKGFACSAGPGRVLLFEKVEEKDFYRESREIRIPTDQQSNDPSQSDKQDVLCLCFSPSEETLIASTNKNQLYSITMSLTEISK-GEAAHFEYLLYPLHSASITGLDTCIRKPLIATCSLDRSVRIWNYESNTLELYKEYQEEAYTVSLHPSGHYIVVGFADKLRLMNLLIDDIRPFKEYSVRGCKECSFSNGGHLFAAVNGNVIHIFTTTSLENINILKGHTGKIRSLVWNLDDSKLVSAGTDGAVYEWNLSTGKRETECVLKSCSYNSVTTSPDAKVIFAVGSDQTLKEISDSLILREIPAFDVIYTSITISHSGRMIFVGTSVGTIRAMKYPLSLQKEYNEYQAHAGPVMKMLLTFDDQFLLTVGEDGCLFTWKVFDKDGRGIKREREVGFAEEVLVTKTDMEEKAQIMLELKTRVEELKMENEYQLRLKDMNYTEKIKELTDKFIQEMESLKTKNQVLKTEKEKQDISHRERLEELVDKQTRELQDLECCNNQKLLLEYEKYQELQLKSQRMQEEYEKQLRDNDETKSQALEELTEFYEAKLQEKTGLLEEAQEDVRQQLREFEETKKQIEEDEDREIQDIKTKYERKLRDEKESNLRLKGETGIMRKKFSSLQKEIEERTNDIELLKSEQMKLQGIIRSLEKDIQGLKREIQERDETIQDKEKRIYDLKKKNQELEKFKFVLDYKIKELKKQIEPRENEIKVMKEQIQEMEAELERFHKQNTQLELNITELLQKLRATDQEMRKEQQKERDLEALVRRFKTDLHNCVAYIQEPGLLKEKIRGLFEKYVQR-----ADMVEIAGLNSDLQQEYARQREHLERNLATLKKKVIKEGELHRTDYVRIMQENVSLIKEINELRRELKLTRSQIYDLESALKVSKKTRSQEVPESVISKDVVGSTSTMRLNEQEETGRIIEMQRLEIRRLRDQI 1217          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Mouse
Match: Cfap44 (cilia and flagella associated protein 44 [Source:MGI Symbol;Acc:MGI:1277238])

HSP 1 Score: 92.8189 bits (229), Expect = 3.065e-18
Identity = 97/445 (21.80%), Postives = 188/445 (42.25%), Query Frame = 1
Query:   52 LKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYS--------ENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETI-------------VACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHP-----SGLYILVGFSD 1308
            L H FG+       +   +  TL+Y  G+ +V+ +   ++Q ++        + A+ + P + Y A+AE  S   P I+IY+  S++  + L   +     +  + F+ +   LA     PD+ +  W W++ + +  T+    A +  V +++FNP +  Q+   G+   K +  +        + +L  FG  K  + +   +  + D +V+ G++ G L+L E   I+ E        ++       NQ +L+  +V T        A + G  ++  FE  D  +           +D    D G  + + IN++ I  S                 +A      ++   LS + IT+     + E L +SFH   I  L +     ++AT A+D SVR++++ +    ++ +F +   S+   P     S   I+VGF D
Sbjct:  123 LNHSFGYDCRKRANLQLLDSNTLLYVAGNQMVLLDFKDKTQIYLQS-SSGQGIGAIGVHPKKTYFAVAEKGS--FPKIIIYEYPSLKPYRILR--DGAEKAYAYVDFNNEGNLLASVGCHPDYTITIWGWKEEQPILRTK----AFSQDVFKVTFNPDNDEQLTTSGSGHIKFWEMAFTFTGLKLQGSLGRFG--KTSTSDIEGYAELPDGKVLSGSEWGNLLLWEGSLIKVELCRTG---MKSCHSGSINQIMLDEGEVIT--------AGSDGSVRIWDFETIDTADV----------ID----DTGLLEIEPINELHIDKSVNLFSMIKMNEVGNNFWLAQDANGAIWKLDLSFSNITQ-----DPECL-FSFHSGPIAALAVSPLTYLMATTAMDCSVRVYDFSSKNPLVHMKFKQGGTSLIWAPRSVSVSASQIVVGFQD 525          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Mouse
Match: Cfap44 (cilia and flagella associated protein 44 [Source:MGI Symbol;Acc:MGI:1277238])

HSP 1 Score: 92.8189 bits (229), Expect = 3.065e-18
Identity = 97/445 (21.80%), Postives = 188/445 (42.25%), Query Frame = 1
Query:   52 LKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYS--------ENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETI-------------VACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHP-----SGLYILVGFSD 1308
            L H FG+       +   +  TL+Y  G+ +V+ +   ++Q ++        + A+ + P + Y A+AE  S   P I+IY+  S++  + L   +     +  + F+ +   LA     PD+ +  W W++ + +  T+    A +  V +++FNP +  Q+   G+   K +  +        + +L  FG  K  + +   +  + D +V+ G++ G L+L E   I+ E        ++       NQ +L+  +V T        A + G  ++  FE  D  +           +D    D G  + + IN++ I  S                 +A      ++   LS + IT+     + E L +SFH   I  L +     ++AT A+D SVR++++ +    ++ +F +   S+   P     S   I+VGF D
Sbjct:  123 LNHSFGYDCRKRANLQLLDSNTLLYVAGNQMVLLDFKDKTQIYLQS-SSGQGIGAIGVHPKKTYFAVAEKGS--FPKIIIYEYPSLKPYRILR--DGAEKAYAYVDFNNEGNLLASVGCHPDYTITIWGWKEEQPILRTK----AFSQDVFKVTFNPDNDEQLTTSGSGHIKFWEMAFTFTGLKLQGSLGRFG--KTSTSDIEGYAELPDGKVLSGSEWGNLLLWEGSLIKVELCRTG---MKSCHSGSINQIMLDEGEVIT--------AGSDGSVRIWDFETIDTADV----------ID----DTGLLEIEPINELHIDKSVNLFSMIKMNEVGNNFWLAQDANGAIWKLDLSFSNITQ-----DPECL-FSFHSGPIAALAVSPLTYLMATTAMDCSVRVYDFSSKNPLVHMKFKQGGTSLIWAPRSVSVSASQIVVGFQD 525          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Mouse
Match: Cfap52 (cilia and flagella associated protein 52 [Source:MGI Symbol;Acc:MGI:1919110])

HSP 1 Score: 77.411 bits (189), Expect = 7.791e-14
Identity = 136/681 (19.97%), Postives = 269/681 (39.50%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGV-NGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSED-KPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVN---QISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQN-----FLCHTWVSDERVI--LGTDTGKL--------ILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQ----LYSF-------TLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSI-ALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIR----GCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLK--EISDSQVLREVE-SVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEY-LGHSAQITKMKITPNDDYLVTISDDCVVMIWR 1953
            + +A   L+ V GF   V NG   + +++ L+YP G  +++  I+   Q F+ G    + ++ + IS    Y+A  + T    K  I+++D    +K++ ++   +   +  +++FSP+  YL       D  ++ W+  K   +      SPAA  +V     + F+          GN   +++   E +L N  I   E Q       +  T ++D+     LGT TG +        +L + G ++ +F+L  S     A +     G+L        V S  G  + C   K   ++     +    +  I +  + +    G  ++ I   +  +  +ET++A  +       ++ F       T +  +I      S  ELL  +       G+D  R    I +   D  +R +  E+ +L          Y+I + H  G+  +   SD  R+       I    E  +R    GC+                       T   E  +  K H   +  +    ++++ ++   DG    WD    +R  + +L +  +  +    +       GTD+ +   E+ D  V+RE+E S+   +  + ++  G     G ++  ++ + +     GE     +GHS  I  M+I+P + Y+V++S D  ++ W+
Sbjct:    9 LDVAELELQAVIGFNGHVPNGLKCHPDQEHLIYPLGCTVLIQAINTNEQNFLHG--HGNNVSCVTISKEGDYIASGQVTFMGFKADIILWDF---KKRELIARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICG----SPAAGLNVGNATSVVFSRCRDEMFVTAGNGTIRVW---ELDLPNRKIWPTECQTGQMKRIVLSTGMADDDSFFYLGTTTGDILKMNPKTKLLADTGPVKDKFSLGVS-----ALRCLKMGGLL--------VGSGAGLLIFC---KSPSYKPIKKVQLQGGITSITLRGEGHQFFVGTEESHIYR-VNFTDFKETLIATCHFEAVQDIVFPFGTAELFATCAKKDIRVWHTMSKRELLRITVPNMTCHGIDFMRDGKSIISAWDDGKIRAFAPESGRL---------MYTINSAHRIGVTAIATTSDCKRI-------ISGGGEGEVRVWQVGCQ-----------------------TQKLEEAL--KEHKSSVSCIRVKKNNEECVTASTDGTCIIWDLVRLRR-NQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGSVIRELEGSLSGSINGMDITQEGGHFVTGGHDHLVKVWDY---NEGEVTHVGVGHSGNIMAMRISPGNQYIVSVSADGAILRWK 615          
BLAST of cilia- and flagella-associated protein 57 vs. UniProt
Match: sp|Q96MR6|CFA57_HUMAN (Cilia- and flagella-associated protein 57 OS=Homo sapiens OX=9606 GN=CFAP57 PE=2 SV=3)

HSP 1 Score: 1342.02 bits (3472), Expect = 0.000e+0
Identity = 686/1232 (55.68%), Postives = 917/1232 (74.43%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSM--RKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEF--------NLAASL-ILEEAQKL------------------ENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRK-------QGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKI 3618
            M+   A   HVFG R  V   I Y +EQ +++P G++ V YN+DQ+ QKFI G EKS  M A++ISPNRRY+A++ET  E KP I IY+L+S+  RK+K L+  +    +F S++FSPDSKYL  QTS P+  L+YW WEK K +A  R+ +   N  V Q+SF+PQD+TQ+C  GN  FK+ R++E  LK     + E QN+L HTWV+D+++++GTDTGKL L E+G+ R E         N + SL +++E++ L                   ++   ++  QV  I + SKGFA + G G+V  FEK ++K++Y++ REI IPVD  S DP +S  Q +  +C SPSEET+VA T+ +QLYS T+S TEI+K G+ ++FE L Y  H + I GL  C RKP+IATC++DRS+R+WNYETN LEL+KE+ EEAYSI+LHPSG +I+VGF+DKLRLMN+LIDDIR+FKE+S+RGC EC+FS GGH FAAV+ N+I +Y+TT+ E + SLKGH GKIR++VW  DD KLIS G DGAVYEW+ +TGKR  E VLKSCSY  ++V+ D K  +AVG+D TLKEI+DS +LRE+ + DV  T + +S+SGRM+F GT+ G+IR+ K+PL    E+ EY  H+  ITKM +T +D +L+T ++D  +  W+V DK+GR +KR++++G+AEE+L+TK+D+EEK   M EL+TRV+ELKMENEYQLRLKDMNY+EKIKELT+KFIQEMESLKTKNQVL+TEK+K++  H E + ++++K S+ELQD+E  NNQKL+LEYEKYQELQ KSQRMQE+YE+QL++ +  K QALEELTE+YE K  EK+T+LE   +D+R Q  E+EETK+ IEED DREI D K KYE++LR+E+ESN RLKGETGIM+KKF+SLQKEI+++  +I+  + E  KL+ VI++LEKD  GLK+EIQERDETIQDKEKRIYDLKKKNQEL KFKFVLDYKIKELKKQIEPRE EI+  KEQIQEME+ELE FHKQN QL LNI EL QKL++T++E++ ERQ  RD+EA V+RFKTDL+NCV+YIQ+P+ LKE +  L++K++Q            A ++ D+Q+E+TRQREHLER++A+L+KK+ K+ E+HR DYVRIMQENVSLIKEIN+LR+ELK +R+  +DLEAAL L +K       + E +R +++     +       E EE GR++EMQR  I +LRD+I
Sbjct:    1 MSAVVAQTLHVFGLRSHVANNIFYFDEQIIIFPSGNHCVKYNVDQKWQKFIPGSEKSQGMLALSISPNRRYLAISETVQE-KPAITIYELSSIPCRKRKVLNNFDFQVQKFISMAFSPDSKYLLAQTSPPESNLVYWLWEKQKVMAIVRIDT--QNNPVYQVSFSPQDNTQVCVTGNGMFKLLRFAEGTLKQTSFQRGEPQNYLAHTWVADDKIVVGTDTGKLFLFESGDQRWETSIMVKEPTNGSKSLDVIQESESLIEFPPVSSPLPSYEQMVAASSHSQMSMPQVFAIAAYSKGFACSAGPGRVLLFEKMEEKDFYRESREIRIPVDPQSNDPSQSDKQDVLCLCFSPSEETLVASTSKNQLYSITMSLTEISK-GEPAHFEYLMYPLHSAPITGLATCIRKPLIATCSLDRSIRLWNYETNTLELFKEYQEEAYSISLHPSGHFIVVGFADKLRLMNLLIDDIRSFKEYSVRGCGECSFSNGGHLFAAVNGNVIHVYTTTSLENISSLKGHTGKIRSIVWNADDSKLISGGTDGAVYEWNLSTGKRETECVLKSCSYNCVTVSPDAKIIFAVGSDHTLKEIADSLILREISAFDVTYTAIVISHSGRMMFVGTSVGTIRAMKYPLPLQKEFNEYQAHAGPITKMLLTFDDQFLLTAAEDGCLFTWKVFDKDGRGIKREREVGFAEEVLVTKTDMEEKAQVMLELKTRVEELKMENEYQLRLKDMNYSEKIKELTDKFIQEMESLKTKNQVLRTEKEKQDVYHHEHIEDLLDKQSRELQDMECCNNQKLLLEYEKYQELQLKSQRMQEEYEKQLRDNDETKSQALEELTEFYEAKLQEKTTLLEEAQEDVRQQLREFEETKKQIEEDEDREIQDIKTKYEKKLRDEKESNLRLKGETGIMRKKFSSLQKEIEERTNDIETLKGEQMKLQGVIKSLEKDIQGLKREIQERDETIQDKEKRIYDLKKKNQELGKFKFVLDYKIKELKKQIEPRENEIRVMKEQIQEMEAELENFHKQNTQLELNITELWQKLRATDQEMRRERQKERDLEALVKRFKTDLHNCVAYIQEPRLLKEKVRGLFEKYVQR-----ADMVEIAGLNTDLQQEYTRQREHLERNLATLKKKVVKEGELHRTDYVRIMQENVSLIKEINELRRELKFTRSQVYDLEAALKLTKKVRPQEVSETEPSRDMLSTAPTARL-----NEQEETGRIIEMQRLEIQRLRDQI 1218          
BLAST of cilia- and flagella-associated protein 57 vs. UniProt
Match: sp|Q9D180|CFA57_MOUSE (Cilia- and flagella-associated protein 57 OS=Mus musculus OX=10090 GN=Cfap57 PE=1 SV=3)

HSP 1 Score: 1338.17 bits (3462), Expect = 0.000e+0
Identity = 683/1226 (55.71%), Postives = 914/1226 (74.55%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSM--RKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNL-------AASL-ILEEAQKLENNQGVLNNV------------------QVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRK--QGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKI 3618
            M+   A   HVFG R  V   + + +EQ +++P G++ V YNIDQ+ QKFI+G +KS  M A+AISPNRRY+A++ET  E KP + IY+L+S+  RK+K L+  +    +FTS++FSPDSKYL  QTS PD  L+YW WEK K +A  +  S   N  + Q+S + QD++Q+C  G+  FK+ R++E  LK     + ES N+L H WVS++RVI+GTDTGKL L E+G+ R E ++       + SL +++E++ L     + + V                  QV  I + SKGFA + G G+V  FEK ++K++Y++ REI IP D  S DP +S  Q +  +C SPSEET++A TN +QLYS T+S TEI+K G+ ++FE L Y  H + I GLD C RKP+IATC++DRSVRIWNYE+N LELYKE+ EEAY+++LHPSG YI+VGF+DKLRLMN+LIDDIR FKE+S+RGCKEC+FS GGH FAAV+ N+I I++TT+ E +  LKGH GKIR++VW  DD KL+S G DGAVYEW+ +TGKR  E VLKSCSY  ++ + D K  +AVG+D+TLKEISDS +LRE+ + DV  T++T+S+SGRM+F GT+ G+IR+ K+PL+   E+ EY  H+  + KM +T +D +L+T+ +D  +  W+V DK+GR +KR++++G+AEE+L+TK+D+EEK   M EL+TRV+ELKMENEYQLRLKDMNY EKIKELT+KFIQEMESLKTKNQVLKTEK+K++  H ERL E+++K ++ELQD+E  NNQKL+LEYEKYQELQ KSQRMQE+YE+QL++ +  K QALEELTE+YE K  EK+ +LE   +D+R Q  E+EETK+ IEED DREI D K KYER+LR+E+ESN RLKGETGIM+KKF+SLQKEI+++  +I+  ++E  KL+ +IR+LEKD  GLK+EIQERDETIQDKEKRIYDLKKKNQEL+KFKFVLDYKIKELKKQIEPRE EI+  KEQIQEME+ELERFHKQN QL LNI EL QKL++T++E++ E+Q  RD+EA VRRFKTDL+NCV+YIQ+P  LKE I  L++K++Q            A +++D+Q+E+ RQREHLER++A+L+KK+ K+ E+HR DYVRIMQENVSLIKEIN+LR+ELK +R+  +DLE+AL + +K    E    +++         +   E EE GR++EMQR  I +LRD+I
Sbjct:    1 MSTVVAQALHVFGLRPHVTNNVFFFDEQIIIFPSGNHCVKYNIDQKWQKFIAGSDKSQGMLALAISPNRRYLAISETVQE-KPAVTIYELSSIPCRKRKVLNNFDFQVQKFTSMAFSPDSKYLLTQTSPPDSNLVYWLWEKQKVMAIIKADS--QNNPIYQVSISSQDNSQVCITGSGVFKLLRFAEGTLKQINFQRGESSNYLAHAWVSEDRVIVGTDTGKLFLFESGDQRWETSIMVKESTSSRSLEVIQESESLIEFPPLSSPVSSVERMDITTNTQQQAMPQVFAIAAYSKGFACSAGPGRVLLFEKVEEKDFYRESREIRIPTDQQSNDPSQSDKQDVLCLCFSPSEETLIASTNKNQLYSITMSLTEISK-GEAAHFEYLLYPLHSASITGLDTCIRKPLIATCSLDRSVRIWNYESNTLELYKEYQEEAYTVSLHPSGHYIVVGFADKLRLMNLLIDDIRPFKEYSVRGCKECSFSNGGHLFAAVNGNVIHIFTTTSLENINILKGHTGKIRSLVWNLDDSKLVSAGTDGAVYEWNLSTGKRETECVLKSCSYNSVTTSPDAKVIFAVGSDQTLKEISDSLILREIPAFDVIYTSITISHSGRMIFVGTSVGTIRAMKYPLSLQKEYNEYQAHAGPVMKMLLTFDDQFLLTVGEDGCLFTWKVFDKDGRGIKREREVGFAEEVLVTKTDMEEKAQIMLELKTRVEELKMENEYQLRLKDMNYTEKIKELTDKFIQEMESLKTKNQVLKTEKEKQDISHRERLEELVDKQTRELQDLECCNNQKLLLEYEKYQELQLKSQRMQEEYEKQLRDNDETKSQALEELTEFYEAKLQEKTGLLEEAQEDVRQQLREFEETKKQIEEDEDREIQDIKTKYERKLRDEKESNLRLKGETGIMRKKFSSLQKEIEERTNDIELLKSEQMKLQGIIRSLEKDIQGLKREIQERDETIQDKEKRIYDLKKKNQELEKFKFVLDYKIKELKKQIEPRENEIKVMKEQIQEMEAELERFHKQNTQLELNITELLQKLRATDQEMRKEQQKERDLEALVRRFKTDLHNCVAYIQEPGLLKEKIRGLFEKYVQR-----ADMVEIAGLNSDLQQEYARQREHLERNLATLKKKVIKEGELHRTDYVRIMQENVSLIKEINELRRELKLTRSQIYDLESALKVSKKTRSQEVPESVISKDVVGSTSTMRLNEQEETGRIIEMQRLEIRRLRDQI 1217          
BLAST of cilia- and flagella-associated protein 57 vs. UniProt
Match: sp|E9Q5M6|CFA44_MOUSE (Cilia- and flagella-associated protein 44 OS=Mus musculus OX=10090 GN=Cfap44 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.144e-17
Identity = 97/445 (21.80%), Postives = 188/445 (42.25%), Query Frame = 1
Query:   52 LKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYS--------ENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETI-------------VACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHP-----SGLYILVGFSD 1308
            L H FG+       +   +  TL+Y  G+ +V+ +   ++Q ++        + A+ + P + Y A+AE  S   P I+IY+  S++  + L   +     +  + F+ +   LA     PD+ +  W W++ + +  T+    A +  V +++FNP +  Q+   G+   K +  +        + +L  FG  K  + +   +  + D +V+ G++ G L+L E   I+ E        ++       NQ +L+  +V T        A + G  ++  FE  D  +           +D    D G  + + IN++ I  S                 +A      ++   LS + IT+     + E L +SFH   I  L +     ++AT A+D SVR++++ +    ++ +F +   S+   P     S   I+VGF D
Sbjct:  123 LNHSFGYDCRKRANLQLLDSNTLLYVAGNQMVLLDFKDKTQIYLQS-SSGQGIGAIGVHPKKTYFAVAEKGS--FPKIIIYEYPSLKPYRILR--DGAEKAYAYVDFNNEGNLLASVGCHPDYTITIWGWKEEQPILRTK----AFSQDVFKVTFNPDNDEQLTTSGSGHIKFWEMAFTFTGLKLQGSLGRFG--KTSTSDIEGYAELPDGKVLSGSEWGNLLLWEGSLIKVELCRTG---MKSCHSGSINQIMLDEGEVIT--------AGSDGSVRIWDFETIDTADV----------ID----DTGLLEIEPINELHIDKSVNLFSMIKMNEVGNNFWLAQDANGAIWKLDLSFSNITQ-----DPECL-FSFHSGPIAALAVSPLTYLMATTAMDCSVRVYDFSSKNPLVHMKFKQGGTSLIWAPRSVSVSASQIVVGFQD 525          
BLAST of cilia- and flagella-associated protein 57 vs. UniProt
Match: sp|A8ILK1|CFA52_CHLRE (Cilia- and flagella-associated protein 52 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP52 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.756e-15
Identity = 143/665 (21.50%), Postives = 259/665 (38.95%), Query Frame = 1
Query:   52 LKHVFGFRVGV-NGAIAYQNEQTLVYPCGSNLVMYN-IDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPV-IVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLK------NFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQ--VTTIVSSSKG-FAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSST--EITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAE--EAYSIALHPSGLYILVGFSD-KLRLMNI----LIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIY--STTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDK--TLKEISDSQVLREVESVDV-QLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEY---LGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQ 1959
            L  V GF   + NG IA+ + +T++YP GS +V+ +  D RSQ+F+ G   S K++ +A+S + RY+A  + T       I+I+DL S +    ++  ++   +  ++ FS D ++LA      D  L+ W       +      SP      N + F      ++   GN    ++ Y   N K        G LK   ++ +     +DE    GT TG ++                 I  E    +N      NVQ  VT       G   V  G G +    K              +P  + +   G   +  + DM  +    T    T +  +Y    S    E+ +   +     +++   YS++            ATC     +R+W+  T + EL +      E + IA    G  IL G+SD K+R        +I  I    + ++      A S      +     +++++    T+  +  S+K H G +  +       + +S   DG+   WD +T KR   S+  +  +  +    D       GTD+  T  +  D   +R ++  D+ ++  + +   G  L  G  +  ++ + +      E   Y   + HS  IT + +TP+   +V++  +  + IW  Q
Sbjct:    7 LNSVIGFGGAIENGLIAHPDGRTIIYPLGSTIVLRDRADPRSQEFLQG--HSDKVSCLALSRSGRYLASGQITYMGFTADIIIWDLESKQLIHRMALHKV---KVQALDFSCDERFLASLGGQDDNALVLWDVASGNAICG----SPCNTNFTNCVKFFNNSPDKLITAGNFNMNVWTYDAGNNKLRPTDATLGTLKRVFKSVVVD--ANDEYAYCGTTTGDVL----------------QIALERVLFKNTGPAKGNVQMGVTATCEVPTGDILVGGGDGSLQLLRK--------------MPALAGTKVEGAITSIALADM--NARGFTFFVGTAMCNIYKPATSRLKEELVQTAHNDKINGMAFPNEYSEVF-----------ATCGTG-FIRLWHLTTCR-ELLRIAVPNLECFCIAFTTDGSAILSGWSDGKIRAFGPQSGKIIFTINDAHQKAVTAIASTADS--SRILSGGEEGMVRVWRIGRTSQTLEASMKDHKGPVNCIRIKGSGDECVSASSDGSCILWDLHTFKR-RTSLFANTFFKSVVYHPDESQLVTAGTDRKVTYWDAYDGNAIRIIDGSDLDEVNALAVDRDGEALVSGGGDKLVKLWGYD-----EGHCYFVGVAHSGAITAVGVTPDKQRIVSVGTEGGIFIWDYQ 607          
BLAST of cilia- and flagella-associated protein 57 vs. UniProt
Match: sp|Q8N1V2|CFA52_HUMAN (Cilia- and flagella-associated protein 52 OS=Homo sapiens OX=9606 GN=CFAP52 PE=1 SV=3)

HSP 1 Score: 79.337 bits (194), Expect = 1.635e-13
Identity = 141/678 (20.80%), Postives = 268/678 (39.53%), Query Frame = 1
Query:   37 IAAAHLKHVFGFRVGV-NGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSED-KPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVN---QISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWV-------SDERVILGTDTGKL--------ILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLY--SFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEE--AYSIALHPSGLYILVGFSDK---------LRLMNILIDDIRTFKEFSIRGCKEC--AFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLK--EISDSQVLREVE-SVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEY-LGHSAQITKMKITPNDDYLVTISDDCVVMIWR 1953
            +A   L  V GF   V  G   + +++ ++YP G  +++  I+ + Q F+ G    + ++ +AIS +  Y+A  + T    K  I+++D    + ++ L+   +   +  +++FSP+  YL       D  ++ W+  K   +      SPAA  +V     + F+          GN   +++   E +L N  I   E Q       V        D    LGT TG +        +L + G  + +F+L  S I     +     G+L        V S  G  V C                YK +++I +            Q  I +        + +V     H +Y  SFT     +         E + + F  +++            ATCA  + +R+W+  +N+ EL +        + I     G  I+  ++D           RLM + I++       +I    +C    S GG     V     QI   T  ++  +LK H   +  +    ++++ ++   DG    WD    +R  + +L +  +  +    +       GTD+ +   E+ D  V+RE+E S+   +  + ++  G     G N+  ++ + +     GE     +GHS  IT+++I+P + Y+V++S D  ++ W+
Sbjct:   11 VAELELDAVIGFNGHVPTGLKCHPDQEHMIYPLGCTVLIQAINTKEQNFLQG--HGNNVSCLAISRSGEYIASGQVTFMGFKADIILWD---YKNRELLARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICG----SPAAGLNVGNATNVIFSRCRDEMFMTAGNGTIRVW---ELDLPNRKIWPTECQTGQLKRIVMSIGVDDDDSFFYLGTTTGDILKMNPRTKLLTDVGPAKDKFSLGVSAI-----RCLKMGGLL--------VGSGAGLLVFC------------KSPGYKPIKKIQL------------QGGITSITLRGEGHQFLVGTEESH-IYRVSFTDFKETLIATCHFDAVEDIVFPFGTAELF-----------ATCA-KKDIRVWHTSSNR-ELLRITVPNMTCHGIDFMRDGKSIISAWNDGKIRAFAPETGRLMYV-INNAHRIGVTAIATTSDCKRVISGGGEGEVRVW----QIGCQTQ-KLEEALKEHKSSVSCIRVKRNNEECVTASTDGTCIIWDLVRLRR-NQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGTVIRELEGSLSGSINGMDITQEGVHFVTGGNDHLVKVWDY---NEGEVTHVGVGHSGNITRIRISPGNQYIVSVSADGAILRWK 615          
BLAST of cilia- and flagella-associated protein 57 vs. TrEMBL
Match: gnl|BL_ORD_ID|23508613 (tr|A0A210Q048|A0A210Q048_MIZYE WD repeat-containing protein 65 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09167 PE=4 SV=1)

HSP 1 Score: 1616.28 bits (4184), Expect = 0.000e+0
Identity = 806/1208 (66.72%), Postives = 985/1208 (81.54%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQG-----VLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKM-GDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRKQGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKIVGMESG 3636
            M+IA A  KH+FG + GV G I Y +EQT+VYP G+N ++YNIDQ+SQKFI G +KS  MTA+A+SPNRRYVA+AE    +KP I IYDL+S+RK+K LS+P++ +NEF S++FSPDSKYL  Q   PD+ L+YW WEKSK +A T+ ++P  +  V Q+SFNPQD+TQ+C +GN  FK FRYSE NLK F   K+E QN+LCH WVS+ERVI+GTDTG+L+L E GE++ EFN+ A    ++ +    N+G     +    QV+ IV+ SKGFA +CG G VH FEKTDDK+++KK REI IP D+NSADP K+Q Q+I  + +SPSEET+VA T++ QLY  TL S ++ K  GD ++FE+L+ SFHY QI GLD+C RKP+IAT + DRSVRIWNYE   LEL+KEFAEEAYSIALHPSGLYILVGFSDKLRLMN+LIDDIRTFKEF+IRGC+EC FS GG+ FAAVHSN+IQIYST+ FE   +LKGHNGK+R++VW++DD K++SCG DGAVYEW+T +GKR GESVLKSC YTG++VT DGK T+AVG+DKTLKEI+DSQ+LR++E+ D+ L++V LS+SGRMLF GT  G++ S KFPL  PGEW E+ GH +QITKMKI+ +D YLVT+S+D  V++W++QDKEGR +KRDK++GWAEEILITKSDLEEKN  M++L+TR DELK+EN+YQLRLKDMNYNEKIKELTEKFIQEME+LKTKNQVLKT+KDKEEAKHEE + E+M+KH+KELQD+ESANNQKLMLEYEK+QE Q+K+ +MQE+Y+R LQE E  K +A+EELTEYYETK  EK+T LE  + + R    EYEETK+ IEEDADREILD K  YE RLR E+E N +L+GE+GIMKKKF SLQ+EIDD KEEIKKFQ ETQK  NVIRN+EKD +GLKKEIQERD+TIQDKEKRIYDLKKKNQEL+KFKFVLDYKIKELKKQIEPRE +I+  K+QIQEMESELERFHKQN QL L+I EL QKL++T+KE+  ERQ  RDVEA V+RFKTDL+NCV YIQDPK LKESI ALY KH+QEDV      T  ASVDADIQKE++RQREHLERSVASLRKKLSKDSEIHRAD VRIMQENVSLIKEINDLR+ELK +RT  HDLEAA+GLH K+ +     +AA+TA  P  L+EK++EE  +++EMQ   I +LR +I  ++ G
Sbjct:    1 MSIAIAQAKHIFGLKPGVTGNICYHDEQTIVYPSGANCILYNIDQKSQKFIPGTDKSEGMTALAVSPNRRYVAIAEKG--EKPTITIYDLHSLRKRKVLSSPDVQSNEFVSLAFSPDSKYLVAQGGKPDYTLLYWTWEKSKVMAGTKTSNPQTSPPVYQVSFNPQDNTQLCVVGNGIFKHFRYSEGNLKTFNFQKMEPQNYLCHAWVSEERVIVGTDTGRLLLFEAGELKNEFNIGA----QQREAGRPNEGEEVSSIPVIPQVSAIVAYSKGFACSCGPGTVHLFEKTDDKDFFKKTREIKIPPDNNSADPTKAQQQLITCLTVSPSEETLVASTDLSQLYYLTLPSADLGKSEGDQAHFEVLAQSFHYGQITGLDVCIRKPLIATSSHDRSVRIWNYENCNLELHKEFAEEAYSIALHPSGLYILVGFSDKLRLMNLLIDDIRTFKEFTIRGCRECGFSNGGNLFAAVHSNVIQIYSTSTFENTSNLKGHNGKVRSIVWSSDDSKMVSCGGDGAVYEWETYSGKRVGESVLKSCGYTGVAVTPDGKATFAVGSDKTLKEIADSQILRQIEAGDMTLSSVALSHSGRMLFAGTVKGTLWSLKFPLNPPGEWTEHSGHGSQITKMKISYDDQYLVTVSEDASVILWKIQDKEGRGLKRDKEVGWAEEILITKSDLEEKNTMMSDLKTRNDELKLENDYQLRLKDMNYNEKIKELTEKFIQEMEALKTKNQVLKTDKDKEEAKHEEEMREVMDKHTKELQDLESANNQKLMLEYEKFQEQQSKTMKMQEEYDRLLQEKEESKMRAMEELTEYYETKLQEKTTQLEQAHDEARQSLKEYEETKKQIEEDADREILDIKNNYEIRLRAEKEDNIKLRGESGIMKKKFTSLQREIDDHKEEIKKFQAETQKQTNVIRNMEKDIMGLKKEIQERDDTIQDKEKRIYDLKKKNQELEKFKFVLDYKIKELKKQIEPRENDIKRMKDQIQEMESELERFHKQNTQLELSIKELTQKLRATDKEMHQERQKVRDVEAVVKRFKTDLHNCVGYIQDPKMLKESIKALYSKHVQEDV------TESASVDADIQKEYSRQREHLERSVASLRKKLSKDSEIHRADNVRIMQENVSLIKEINDLRRELKIARTQIHDLEAAMGLHSKKNKNDTAAIAAITAKGPSALMEKDMEEKNKMIEMQMVEIRRLRSEISDLDFG 1196          
BLAST of cilia- and flagella-associated protein 57 vs. TrEMBL
Match: gnl|BL_ORD_ID|17220100 (tr|A0A3S0ZUG9|A0A3S0ZUG9_ELYCH Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_009172 PE=4 SV=1)

HSP 1 Score: 1603.57 bits (4151), Expect = 0.000e+0
Identity = 804/1207 (66.61%), Postives = 985/1207 (81.61%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPA-ANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVD-SNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALG----LHRKQGEAARQ-LVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKIVGME 3630
            M+IA A  +H+FG + GV+G I Y +EQT+VYP GSN ++YNIDQ+ Q+FI G +KS  MTA+A+SPNRRYVA+AE    ++P I IYDL+S+RKKK LS+ E+ ++E+ S++FSPDSKYL  Q   PDW L+YW WEKSK +A+ + ++P   N  V Q+SFNPQD+TQ+C +GN  F+ FRYSE NLK F   K+E QN+LCH WVS+ER+I+GTDTG+L+L E GE++ EFNL A  I ++A  L++    +  +QVT++VS SKGFA + GLG V+ FEKTDDK+Y+KK REI+IP D  NS D   +Q Q+I  + +SPSEET+VA T+  QLY  TLSS +++K GD + FE+LS  FH + I GLD+C RKP+IATC+VDRSVRIWNYET  LELYK FAEEAYSIALHPSGLYILVGFSDKLRLMN+LIDDIRTFKEF++RGC+ECAFS GGH FA+V  N+IQ+YSTT FE + +LKGHNGK+++VVW+ DD KL+SCGMDGAVYEWDT TGKR  ESV KSCSYTG+++T DGK T+AVG+DKTLKEI+DSQ+LREV + D+ L+TV+LS+SGRMLF GT  G++ S K+PL  PG+W E+ GH A I KMKI+ +D +LV+I++D  +++W++QDKEGR +KRDK++GWAEEILITKSDLEEKN T+ +L +RV+ELKMENEYQLRLKDM YNEK+KELTEKFIQEMESLKTKNQVLKT+KDKEE+KHEE + E+M+KH+KELQD+ESANNQKLMLEYEK+QE QAK  +MQEDY+RQLQE+E  KE+ALEELTEYYETK  + +T L+  N + R Q+ EYEETK+ IEEDADREILD K +YERRLR+E+E+N RL+GETGIMKKKF SLQKEIDD KEEIKK Q ET KL NVIR+LEKD +GLKKEIQERD+TIQDKEKRIYDLKKKNQEL+KFKFVLDYKIKELKKQIEPRE++I++ KEQIQEMESELERFHKQN QL LNI EL+QKLK+T+KE+  ERQ  RDVEA VRRFKTDL+NCV YIQDPK LKESI ALY+KH+QED+      T  ASVDADIQKEF+RQ+EHLERSVASLRKKL KDSEIH+AD VRIMQENV+LIKEINDLRKELK  R   HD+EAA+G      +  G+   Q  V A+   +  P+VEKELEE  +V+EMQ+  + +LRD+I  +E
Sbjct:    1 MSIAIAQARHIFGLKPGVSGNICYHDEQTIVYPAGSNCILYNIDQKVQRFIPGTDKSEGMTALAVSPNRRYVAIAEKG--ERPTITIYDLHSLRKKKVLSSHEVQSSEYISLAFSPDSKYLVAQGGKPDWTLLYWTWEKSKVMATAKTSNPQNPNSEVYQVSFNPQDNTQLCVVGNTVFRHFRYSEGNLKPFNFQKMEPQNYLCHAWVSEERIIVGTDTGRLLLFEAGEVKNEFNLVAPNI-DKAAALDDANTAMT-LQVTSLVSYSKGFACSFGLGTVYLFEKTDDKDYFKKAREIMIPPDLCNSQDSTLAQQQLIRCLAVSPSEETLVASTDQAQLYYLTLSSADLSK-GDQAQFEVLSQVFHNAPITGLDVCIRKPLIATCSVDRSVRIWNYETCNLELYKVFAEEAYSIALHPSGLYILVGFSDKLRLMNLLIDDIRTFKEFTVRGCRECAFSNGGHLFASVMGNVIQLYSTTTFENINNLKGHNGKVKSVVWSADDSKLVSCGMDGAVYEWDTFTGKRISESVWKSCSYTGVTITPDGKATFAVGSDKTLKEIADSQILREVPAGDMTLSTVSLSHSGRMLFAGTVKGTLWSLKYPLAVPGDWTEHQGHGAPIVKMKISFDDQFLVSIAEDASIILWKIQDKEGRGLKRDKEVGWAEEILITKSDLEEKNTTVNDLNSRVEELKMENEYQLRLKDMTYNEKMKELTEKFIQEMESLKTKNQVLKTDKDKEESKHEEEMAELMDKHAKELQDLESANNQKLMLEYEKFQEQQAKMMKMQEDYDRQLQEMEESKEKALEELTEYYETKIQDMTTKLDQSNDEARQQSREYEETKKQIEEDADREILDIKHQYERRLRDEKEANMRLRGETGIMKKKFTSLQKEIDDHKEEIKKLQAETSKLNNVIRSLEKDILGLKKEIQERDDTIQDKEKRIYDLKKKNQELEKFKFVLDYKIKELKKQIEPREMDIKNMKEQIQEMESELERFHKQNTQLELNITELRQKLKATDKEMHQERQKVRDVEAVVRRFKTDLHNCVGYIQDPKMLKESIKALYQKHVQEDI------TESASVDADIQKEFSRQKEHLERSVASLRKKLEKDSEIHKADNVRIMQENVTLIKEINDLRKELKLCRVLIHDMEAAMGQDSRTRKMTGQGQGQGTVTALPTKQAGPMVEKELEEKSKVIEMQQLELRRLRDEIYDLE 1196          
BLAST of cilia- and flagella-associated protein 57 vs. TrEMBL
Match: gnl|BL_ORD_ID|21107128 (tr|A0A2T7NNI4|A0A2T7NNI4_POMCA Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_15980 PE=4 SV=1)

HSP 1 Score: 1598.95 bits (4139), Expect = 0.000e+0
Identity = 806/1209 (66.67%), Postives = 983/1209 (81.31%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPA-ANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDS-NSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKE----CAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLH-RKQGEAARQLVAAVT-ANKPQPLVEKELEEAGRVMEMQRALIGQLRDKIVGMES 3633
            M+IA A  K++FG + GV+G I Y +EQT+VYP GSN ++YNIDQ++QKFI G EKS  MTA+A+SPNRRYVA+AE    +KP+I +YDL+S+RK+K LS+PE+   E+ S++FSPDSKYL  Q   PDW L+YW WEKSK +A+T+ ++P      VNQ+SFNPQD+TQ+C +GN  F+ FRYSE NLK F   K+E QN+LCH WV++ER+++GTD G+L++ E GE+++E  L          K + +   +++ Q+T IVS SKGFA ACG G V  FEKTDDK+++KK RE+ IP DS NSADP +   QII  + ISPSEET+VA T+  QLY  TLSS ++ + GD + FE+LS +FH  QILGLD+C RKP+IATC++DRSVRIWNYET  +EL+K FAEEAYSI+LHPSGLYILVGFSDKLRLMN+LIDDIRTFKEF+IRGC+E    CAFS GGH FAAVH N+IQIYSTT FE + +LKGHNGK+R+VVW+T+D +LISCGMDGAVY+WD  T KR GESVLK+CSYTG++VT DGK ++AVG+DKTLKEI+DSQVLREV S D+ LT V +S+SGRMLF GT  G++ S KFPLT PGEWQE+ GHSA ITKMKIT +D YL+T+++D  +++W++QDKEGR +KRDK++GWAEEILITKSDLEEKNA MA+L +RV+ELKMENEYQLRLKDMNYNEK+KELTEKFIQEMESLKTKNQVLKT+KDKEEAKHEE + E+MEKH+KELQD+ESANN KLMLEYEK+QE QAK  +MQEDY+RQLQE+E  KE+ALEELTEYYETK  E +T LE  N + R Q  EYEE K+ IEEDADREILD K KYERRLR+E+E+N RLKGETGIM+KKF SLQKEIDD KEEIKK Q ET KL N+IRNLEKD  GLKKEIQERD+TIQDKEKRIYDLKKKNQEL+KFKFVLDYKIKELKKQIEPRE +I++ KEQIQEMESELERFHKQN QL LNI EL+QKLK+ +KE++ ERQ  RDVEA VRRFKTDL+NCV YIQ+PK LKESI ALY+KH+QED++ T      ASVDADIQKEF RQ+EHLERSVASLRKKL KDSEIH+AD VRIMQENV LIKEINDLRKE+K  RT+ HDL+A LGL+ +KQ + +   +   + A + +  +E ++EE  R++++Q   I +LR+++  +ES
Sbjct:    1 MSIALAQAKYIFGLKPGVSGNICYHDEQTIVYPAGSNCILYNIDQKAQKFIPGSEKSDGMTALAVSPNRRYVAIAEKG--EKPIITVYDLHSLRKRKVLSSPEVPTGEYISLAFSPDSKYLIAQGGQPDWTLLYWTWEKSKVMATTKTSNPQNLGCDVNQVSFNPQDNTQLCVVGNTIFRHFRYSEGNLKPFSFQKLEPQNYLCHAWVTEERIVVGTDNGRLLIFEAGEMKSEIYLG---------KDDKDTEDISSNQITAIVSYSKGFACACGPGTVFLFEKTDDKDFFKKTREVKIPTDSYNSADPTEPLHQIITCLAISPSEETLVASTDQAQLYYLTLSSADLAR-GDQAIFEVLSQTFHNGQILGLDVCIRKPLIATCSLDRSVRIWNYETCNMELHKVFAEEAYSISLHPSGLYILVGFSDKLRLMNLLIDDIRTFKEFTIRGCREASLQCAFSNGGHLFAAVHGNVIQIYSTTTFECITNLKGHNGKVRSVVWSTNDSRLISCGMDGAVYDWDVATEKRIGESVLKTCSYTGVTVTPDGKTSFAVGSDKTLKEIADSQVLREVSSADMILTNVAMSHSGRMLFAGTVKGTLWSLKFPLTIPGEWQEHQGHSAAITKMKITLDDQYLITVAEDASILLWKIQDKEGRGLKRDKEVGWAEEILITKSDLEEKNALMADLNSRVEELKMENEYQLRLKDMNYNEKMKELTEKFIQEMESLKTKNQVLKTDKDKEEAKHEEEMAEVMEKHAKELQDLESANNHKLMLEYEKFQEQQAKMMKMQEDYDRQLQEMEESKERALEELTEYYETKLQEMTTKLEQSNDEARQQNREYEEMKKQIEEDADREILDIKNKYERRLRDEKEANMRLKGETGIMRKKFTSLQKEIDDHKEEIKKLQAETAKLNNIIRNLEKDIQGLKKEIQERDDTIQDKEKRIYDLKKKNQELEKFKFVLDYKIKELKKQIEPRENDIKNMKEQIQEMESELERFHKQNTQLELNITELRQKLKACDKEMRLERQRVRDVEAIVRRFKTDLHNCVGYIQEPKMLKESIKALYQKHVQEDITET------ASVDADIQKEFGRQKEHLERSVASLRKKLEKDSEIHKADNVRIMQENVMLIKEINDLRKEVKLQRTHVHDLKATLGLYTKKQKKGSDHAIQMQSPARRHEATMELKMEEQNRLIDLQLMEIKRLRNEVQELES 1191          
BLAST of cilia- and flagella-associated protein 57 vs. TrEMBL
Match: gnl|BL_ORD_ID|20346341 (tr|A0A1S3IR34|A0A1S3IR34_LINUN cilia- and flagella-associated protein 57 OS=Lingula unguis OX=7574 GN=LOC106164647 PE=4 SV=1)

HSP 1 Score: 1585.47 bits (4104), Expect = 0.000e+0
Identity = 814/1210 (67.27%), Postives = 969/1210 (80.08%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAAN----FSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNV----QVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRKQGEA-ARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKIVGMES 3633
            M+IA A  +H+FG + GV G +AYQ+EQT++YP GSN V+YNIDQ++QKFI G EKS  MTAMA+SPNR+YVA+AE    +K  I IYDL+S R++K LS+PE+ + E+ S++FSPDSKYL  Q   PDW L+YW W+KSK +AS + TS A        V Q++FNPQD+TQ+C +GN  FK++RYSE +LK F   K+E QN LC  WVSDERV++GTD G+L+L E GE++ EF++  S   ++ +    ++G         ++T IV+ SKGFA + G G V  +EKTDDKEY+KK REI IP DSNSADP KS+ Q+I  + +SPSEET+VA T+  QLYS TLSS ++ K G  + FE L  +FH  QI GLD+C RK ++ATC VDRSVRIWN+E   LELYKEFAEEAYSIALHPSGLY+LVGFSDKLRLMN+LIDDIR FKEF+IRGC+ECAFS GGH FAAV SNLI IYST  FE ++ LKGHNGKIR+V+WT DD KLISCGMDGAVYEWDT TGKR GE+VLKSCSY+ ++VT DGK T AVGTD TLKEISDS +LREV + D  L TV +S+SGRMLF GTN G++RS+KFPLT  GEWQEY GHS+ ITKMKIT +D  LVT+S+D  +M+W++QDKEGR  +RDK++GWAEEILITKSDLEEKN  MAEL+TRVDELK ENEYQLR+KDMNYNEKIKELTEKFIQEMESLKTKNQVLKT+KDKEEAKHEE + E +EKH+KE+QD+ESANNQKLMLEYEKYQ+L AKSQ+MQEDY+RQLQE+E  KE+ALEELTEYYET+  +K+T LE  +   R+   EYEETKR IEEDADREILD K +YER LR+E+ESN RLKGE+GIMKKKF SLQKEI+D KEEIKK  T+ +KL  VI NLEKDK GLKKEI ERDETIQDKEKRIYDLKKKNQEL+KFKFVLDYKIKELKKQIEPRE +I+  KEQIQEMESELERFHKQN QL LNI EL+QKLK+T+KE+  ERQ  RD EA ++RFKTDL+NCV YIQDPK LK+SI ALYKKH+QED+      T  ASVDADIQKE+ RQREHLERSVASLRKKL+KD+EIHRAD VRIMQENVSLIKEINDLRKELK +RT  HDLEAALGLHRK   A A   + AV +     ++EK+LEE+ R+++MQ+  I +LR  I  +E+
Sbjct:    1 MSIAVAQARHIFGLKTGVTGNVAYQDEQTIIYPSGSNCVLYNIDQKAQKFIPGSEKSTGMTAMAVSPNRKYVAIAEKG--EKATITIYDLHSQRRRKVLSSPEVQSGEYVSLAFSPDSKYLVAQGGKPDWTLLYWTWDKSKVMASIK-TSVAQGKEIPPPVYQVTFNPQDNTQLCVVGNQIFKLYRYSEGSLKPFAFQKMEPQNNLCQAWVSDERVVVGTDNGRLLLFEAGELKNEFHVEKSQKGDKEKMDSISEGEATQPSGPPEITAIVAYSKGFACSVGPGTVFLYEKTDDKEYFKKAREIKIPADSNSADPSKSENQVITSLTVSPSEETLVASTDSSQLYSMTLSSADLGKDG-QAYFEYLCQAFHQGQITGLDVCIRKALVATCGVDRSVRIWNFENCNLELYKEFAEEAYSIALHPSGLYVLVGFSDKLRLMNLLIDDIRVFKEFTIRGCRECAFSNGGHLFAAVTSNLIYIYSTATFENLLQLKGHNGKIRSVIWTADDNKLISCGMDGAVYEWDTFTGKRVGENVLKSCSYSSVAVTPDGKTTLAVGTDHTLKEISDSSILREVPAEDTTLNTVGMSHSGRMLFAGTNTGTLRSYKFPLTADGEWQEYQGHSSAITKMKITYDDTTLVTVSEDASIMLWKIQDKEGRGARRDKEVGWAEEILITKSDLEEKNTMMAELKTRVDELKTENEYQLRMKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTDKDKEEAKHEEEVQEALEKHAKEMQDMESANNQKLMLEYEKYQDLLAKSQKMQEDYDRQLQEMEDSKERALEELTEYYETELQKKTTQLEEAHDQARNAQKEYEETKRQIEEDADREILDIKNRYERLLRDEKESNLRLKGESGIMKKKFTSLQKEIEDHKEEIKKNHTDKEKLSGVISNLEKDKTGLKKEIAERDETIQDKEKRIYDLKKKNQELEKFKFVLDYKIKELKKQIEPREKDIKDMKEQIQEMESELERFHKQNTQLELNITELRQKLKATDKEMHQERQKVRDREAMIKRFKTDLHNCVGYIQDPKMLKDSIKALYKKHVQEDI------TESASVDADIQKEYARQREHLERSVASLRKKLAKDTEIHRADNVRIMQENVSLIKEINDLRKELKIARTQVHDLEAALGLHRKNAAAEATATLQAVASQNKNAMLEKDLEESKRIVDMQKNEIKRLRLSIYELEN 1200          
BLAST of cilia- and flagella-associated protein 57 vs. TrEMBL
Match: gnl|BL_ORD_ID|22665674 (tr|A0A2C9K1G6|A0A2C9K1G6_BIOGL Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106077617 PE=4 SV=1)

HSP 1 Score: 1577.38 bits (4083), Expect = 0.000e+0
Identity = 787/1202 (65.47%), Postives = 969/1202 (80.62%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPA-ANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDS-NSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRKQGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKIVGME 3630
            M+IA A  +++FG + GV G ++Y +EQT+VYP GSN ++YNIDQ++QKFI G ++S + TA+A+SPNRRYVALAE    +K +I IYDL+S+RKKK LS+ E+ +NE+ S++FSPDSKYL  Q   PDW L+YW WEKSK +AS + ++P   N  V Q+SFNPQD+TQ+C +GN  F+ FRYSE NLK F   K + QN+LCH WVS++R+I+GTD+GKL+L E GE++ EF LA + I  +    + +        VT++VS SKGFA + G G V+ +EKT+DKE++KK REI IP D  NS DP  +Q Q+   + +SPSEET++  T+  QLY  TLSS +++K GD ++FE+LS  FH + ILGLD+C RKP+IATC++DRSV+IWNYET  LELYK FAEEAYS+ALHPSGLYILVGFSDKLRLMN+LIDDIRTFKEF++RGC+ECAFS GGH FA+V  N+IQ+YSTT FE + +LKGHNGK++ VVW+ DD KLISCGMDGAVYEWDT +GKR  ESV+KSC+YT ++VT DGK T+AVGTDK LKEI+DS +LREV + D+ L+TV +S+SGRMLF GT  G++ S KFPL  PG+W EY GH A I KMKIT +D YL+++++D  +++W++QDKEGR +KRDK++GWAEEILITKSDLEEKN+T+A+L +RV+ELKMENEYQLRLKDM YNEK+KELTEKFIQEMESLKTKNQVLKT+KDKEEAKHEE L E+M+ H+KE+QD+ESANNQKLMLEYEK+QE QAK  +MQEDY++QLQE+E  KE+ALEELTEYYETK  E +  LE  N + R Q  EYEETK+ IEED DREILD K +YERRLR+E+E+N RLKGETGIMKKKF SLQKEIDD K+EIKK Q E  KL NVIR+LEKD  GLKKEIQERD+TIQDKEKRIYDLKKKNQEL+KFKFVLDYKIKELKKQIEPRE++I++ KEQIQEMESELERFHKQN QL LNI EL+QKLK+T+KE+  ERQ  RDVEA VRRFKTDL+NCV YIQDPK LKESI ALY+KH+QED+     +T  ASVDADIQKEF+RQ+EHLERSVASLRKKL KDSEIH+AD VRIMQENV+LIKEINDLRKEL+  R   HD+EAA+GL  + G+    +   +      PLVEKELEE  +++EMQ+  + +LRD+I  ME
Sbjct:    1 MSIAIAQARYIFGLKSGVTGNVSYHDEQTIVYPAGSNCILYNIDQKTQKFIQGTDRSEETTALAVSPNRRYVALAEKG--EKAIITIYDLHSLRKKKVLSSSEVQSNEYVSLAFSPDSKYLVAQGGKPDWTLLYWTWEKSKVMASIKTSNPQNPNSEVYQVSFNPQDNTQLCVVGNTVFRYFRYSEGNLKPFNFQKSDPQNYLCHAWVSEDRIIVGTDSGKLLLFEAGELKREFILANNDISTDESSYQTH--------VTSLVSYSKGFACSFGYGTVYLYEKTEDKEFFKKSREITIPPDPYNSQDPALNQQQLFRHLTVSPSEETLIGSTDQSQLYYLTLSSADLSK-GDQASFEILSQVFHNAPILGLDVCIRKPLIATCSMDRSVKIWNYETCNLELYKVFAEEAYSVALHPSGLYILVGFSDKLRLMNLLIDDIRTFKEFTVRGCRECAFSNGGHLFASVMGNVIQLYSTTTFENINNLKGHNGKVKAVVWSADDSKLISCGMDGAVYEWDTFSGKRISESVMKSCNYTSVTVTPDGKTTFAVGTDKALKEIADSHILREVMAGDMTLSTVAMSHSGRMLFAGTVKGALWSMKFPLAVPGDWTEYPGHGAAIVKMKITFDDQYLISVAEDATIILWKIQDKEGRGLKRDKEVGWAEEILITKSDLEEKNSTVADLNSRVEELKMENEYQLRLKDMTYNEKMKELTEKFIQEMESLKTKNQVLKTDKDKEEAKHEEELSEIMDNHAKEIQDLESANNQKLMLEYEKFQEQQAKMMKMQEDYDKQLQEMEDSKEKALEELTEYYETKLQEMTAKLEQCNDETRQQNREYEETKKQIEEDGDREILDIKHQYERRLRDEKEANMRLKGETGIMKKKFTSLQKEIDDHKDEIKKLQAEALKLNNVIRSLEKDIQGLKKEIQERDDTIQDKEKRIYDLKKKNQELEKFKFVLDYKIKELKKQIEPREMDIKNMKEQIQEMESELERFHKQNTQLELNITELRQKLKATDKEMHQERQKVRDVEAIVRRFKTDLHNCVGYIQDPKMLKESIKALYQKHVQEDI-----KTESASVDADIQKEFSRQKEHLERSVASLRKKLEKDSEIHKADNVRIMQENVTLIKEINDLRKELRICRVLIHDMEAAMGLDVR-GQKKTGITIPLPPKPVGPLVEKELEEHKKIIEMQQLELKRLRDEIYDME 1185          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Cavefish
Match: cfap57 (cilia and flagella associated protein 57 [Source:ZFIN;Acc:ZDB-GENE-110411-266])

HSP 1 Score: 1157.51 bits (2993), Expect = 0.000e+0
Identity = 618/1200 (51.50%), Postives = 819/1200 (68.25%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLN--SMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQL-YSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQE-DVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRKQGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKI 3618
            MA   A   H+FG R GVN  + + +E T+V+PCG+N V Y++DQ  Q FI G E+S  M AMAIS NRRY+A+AE   ++K  I IYDL     R++K L+  E+   EF  ++FSPDSKYL GQ  GP+W L YW WEK K +A+ + TS   +      SF PQD+ QIC  GN  FK+FRY+E  LK    +K+E  N L H W+S ER+I GT+TG+L++ E+G+ R   ++ +    +E +  + +       +VT I   SKGFA + G G V  FEKT++K+ YKK REI IP D    DP +++ Q I+ +CISPSEET+ A T+  Q  Y   L  T +                     LG        ++  C+              LELYKEF EE+YS+ALHPSGL+ILVGFSDK+RLMN+LIDDIR FKEF++RGC+ECAFS+GGH FAAV+ N+I IYSTT FE V++LKGHNGK+R++ W+ DD +L+SCGMDGAVYEW+  +GKR  ESVLK+CSYTG++++ D K  +AVG+D TLKEI D Q+LRE+ S D   TT+ +++SGR LF GT  G++R+ K+PL    +W EY  HSA ITKM +T +D +L+T+S+D  ++IW++ DKEGR++KR+K++ +AEEILITKSDLEEKN  M EL+TRVDELKMENEYQLRLKDMNYNEKI+ELTE+FIQ++ESLKT+NQVLKTEK+K+   H+E           +L   ES NNQKLMLEY+KY ELQ KSQ+MQE YE +LQ+LE  K  ALE+LT++YE K  EK + L     + R Q  E+EET +L EED DRE+ D +I+YE +LR+E+E+N + + E  +MKKK  SLQ+E+ ++  EI K + E  KLE +I++LEKD + LK+E+Q+RD TI DKEK IYDL  KNQEL+KFKFVLDYKI ELKKQIEPRE  I+  KEQ QEME EL +F ++N QL L I +LK KLK+T+KE+  E Q  R+VEA VRR KTDL+NCV +IQ+PK LK+SI  LY++++Q+ DV           VDADIQ+E +RQ+EHLER+VASL++KLS D+ +H+A  V+ M+EN  LIKEINDLRKEL+  R   H+ E   GL +K    +  L  ++          K  EEA R+++ QR  I +LR ++
Sbjct:    1 MAAVVAQSHHIFGLRTGVNNNLLFFDEHTVVFPCGNNCVRYDLDQACQSFIPGTERSQSMQAMAISANRRYLAVAE--HKEKATITIYDLQHEQSRRRKVLTGGELPVREFVCMAFSPDSKYLIGQAGGPEWTLFYWVWEKHKIMATVKTTSTGPS-----TSFCPQDNMQICVSGNGLFKIFRYTEGALKQTNSVKMEQHNILSHAWMSKERIIAGTETGRLLVFESGDQRGSLSVTSKPSTQERKSEDTSSSPALLPRVTAISPYSKGFACSAGPGTVCLFEKTEEKDSYKKNREIKIPPDPCFNDPTQAEQQEISTLCISPSEETLAASTDRGQSNYPTPLCFTAV--------------------FLGSKYALSGGVLVCCSA-------------LELYKEFQEESYSVALHPSGLFILVGFSDKIRLMNLLIDDIRAFKEFTVRGCRECAFSHGGHMFAAVNGNVIHIYSTTTFENVLNLKGHNGKVRSMAWSADDSRLVSCGMDGAVYEWNALSGKRESESVLKTCSYTGLTLSPDNKTIFAVGSDCTLKEIQDCQILREMASDDAAYTTIAMTHSGRALFTGTAFGTVRAIKYPLPLQKDWTEYQAHSAPITKMVVTFDDQFLLTVSEDGCLLIWKIIDKEGRALKREKEMSYAEEILITKSDLEEKNQFMLELKTRVDELKMENEYQLRLKDMNYNEKIRELTEEFIQQIESLKTENQVLKTEKEKQAVTHKE-----------DLTFAESNNNQKLMLEYDKYHELQLKSQQMQESYEEKLQQLEDSKVHALEKLTQFYEAKIQEKVSALGQCQDETRQQLREFEETIKLTEEDGDRELQDIRIRYENKLRKEKETNIKHEDEIRVMKKKHDSLQRELKNKDLEIDKLKLEQNKLEGIIKSLEKDILVLKREVQKRDVTINDKEKNIYDLNSKNQELEKFKFVLDYKITELKKQIEPRENVIKEMKEQTQEMEGELAQFQQKNTQLELTIADLKLKLKATDKEMHKEMQRVRNVEALVRRIKTDLHNCVGFIQEPKKLKDSIRTLYERYVQQSDV------VEIVGVDADIQRENSRQKEHLERNVASLKRKLSNDTNVHQAYKVKTMKENAFLIKEINDLRKELRLIRAQLHNYETQEGLSKKNKCKSEVLSPSL----------KFEEEAERIIQFQRVEIQRLRQEL 1133          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Cavefish
Match: CFAP57 (cilia and flagella associated protein 57 [Source:HGNC Symbol;Acc:HGNC:26485])

HSP 1 Score: 1120.92 bits (2898), Expect = 0.000e+0
Identity = 615/1204 (51.08%), Postives = 810/1204 (67.28%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLN--SMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELY-KEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQE-DVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRKQGEAARQLVAAVTAN-KPQPLVEKEL---EEAGRVMEMQRALIGQLRDKI 3618
            MA   A   H+FG R GVN  + + +E T+V+PCG+N V Y++DQ  Q FI G E+S  M AMAIS NRRY+A+AE   ++K  I IYDL     R++K L+  E+   EF  ++FSPDSKYL GQ  GP+W L YW WEK K +A+ + TS      ++Q+SF PQD+ QIC  GN  FK+FRY+E  LK    +K+E  N L H W+S ER+I GT+TG+L++ E+G+ R   ++ +    +E +  + +       +VT I   SKGFA + G G V  FEKT++K+          P D    DP +++ Q I+ +CISPSEET+ A T+  QLY  TLSS E+++ G+ + FE LS+SFH   I GL +C RKP+IATC++D SVRIWN+ETN  E Y KEF EE+YS+ALHPSGL+ILVGFSDK+RLMN+LIDDIR FKEF++RGC+ECAFS+GGH FAAV+ N+I IYSTT FE V++LKGHNGK+R++ W+ + +      MDGAVYEW+  +GKR  ESV                       D TLKEI D Q+LRE+ S D   TT+ +++SGR LF GT  G++R+ K+PL    +W EY            T +   +VT  D   ++        GR         +AEEILITKSDLEEKN  M EL+TRVDELKMENEYQLRLKDMNYNEKI+ELTE+FIQ++ESLKT+NQVLKTEK+K+   H+E L E+++KH KE QD+ES NNQKLMLEY+KY ELQ KSQ+MQE YE +LQ+LE  K  ALE+LT++YE K  EK + L     + R Q  E+EET +L EED DRE+ D +I+YE +LR+E+E+N + + E  +MKKK  SLQ+E+ ++  EI K + E  KLE +I++LEKD + LK+E+Q+RD TI DKEK IYDL  KNQEL+KFKFVLDYKI ELKKQIEPRE  I+  KEQ QEME EL +F ++N QL L I +LK KLK+T+KE+  E Q  R+VEA VRR KTDL+NCV +IQ+PK LK+SI  LY++++Q+ DV           VDADIQ+E +RQ+EHLER+VASL++KLS D+ +H+A  V+ M+EN  LIKEINDLRKEL+  R   H+ E   GL +K      +  +A   N KP+      L   EEA R+++ QR  I +LR ++
Sbjct:    1 MAAVVAQSHHIFGLRTGVNNNLLFFDEHTVVFPCGNNCVRYDLDQACQSFIPGTERSQSMQAMAISANRRYLAVAE--HKEKATITIYDLQHEQSRRRKVLTGGELPVREFVCMAFSPDSKYLIGQAGGPEWTLFYWVWEKHKIMATVKTTSTGP---IHQVSFCPQDNMQICVSGNGLFKIFRYTEGALKQTNSVKMEQHNILSHAWMSKERIIAGTETGRLLVFESGDQRGSLSVTSKPSTQERKSEDTSSSPALLPRVTAISPYSKGFACSAGPGTVCLFEKTEEKDN---------PPDPCFNDPTQAEQQEISTLCISPSEETLAASTDRGQLYHITLSSVEMSR-GEQAQFEFLSHSFHSGIITGLSICMRKPLIATCSLDHSVRIWNFETNAREHYVKEFQEESYSVALHPSGLFILVGFSDKIRLMNLLIDDIRAFKEFTVRGCRECAFSHGGHMFAAVNGNVIHIYSTTTFENVLNLKGHNGKVRSMAWSAERQSAGLLWMDGAVYEWNALSGKRESESV-----------------------DCTLKEIQDCQILREMASDDAAYTTIAMTHSGRALFTGTAFGTVRAIKYPLPLQKDWTEYQAPFC-------TYHQSMVVTFDDQFFLL----DGFRGRV--------YAEEILITKSDLEEKNQFMLELKTRVDELKMENEYQLRLKDMNYNEKIRELTEEFIQQIESLKTENQVLKTEKEKQAVTHKEALSEVLKKHGKEQQDLESNNNQKLMLEYDKYHELQLKSQQMQESYEEKLQQLEDSKVHALEKLTQFYEAKIQEKVSALGQCQDETRQQLREFEETIKLTEEDGDRELQDIRIRYENKLRKEKETNIKHEDEIRVMKKKHDSLQRELKNKDLEIDKLKLEQNKLEGIIKSLEKDILVLKREVQKRDVTINDKEKNIYDLNSKNQELEKFKFVLDYKITELKKQIEPRENVIKEMKEQTQEMEGELAQFQQKNTQLELTIADLKLKLKATDKEMHKEMQRVRNVEALVRRIKTDLHNCVGFIQEPKKLKDSIRTLYERYVQQSDV------VEIVGVDADIQRENSRQKEHLERNVASLKRKLSNDTNVHQAYKVKTMKENAFLIKEINDLRKELRLIRAQLHNYETQEGLSKKN-----KCKSATNINSKPESGSIWSLKFEEEAERIIQFQRVEIQRLRQEL 1136          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Cavefish
Match: cfap57 (cilia and flagella associated protein 57 [Source:ZFIN;Acc:ZDB-GENE-110411-266])

HSP 1 Score: 1097.42 bits (2837), Expect = 0.000e+0
Identity = 546/987 (55.32%), Postives = 715/987 (72.44%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLN--SMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELER 2985
            MA   A   H+FG R GVN  + + +E T+V+PCG+N V Y++DQ  Q FI G E+S  M AMAIS NRRY+A+AE   ++K  I IYDL     R++K L+  E+   EF  ++FSPDSKYL GQ  GP+W L YW WEK K +A+ + TS   +      SF PQD+ QIC  GN  FK+FRY+E  LK    +K+E  N L H W+S ER+I GT+TG+L++ E+G+ R   ++ +    +E  +  ++   L   +VT I   SKGFA + G G V  FEKT++K+ YKK REI IP D    DP +++ Q I+ +CISPSEET+ A T+  QLY  TLSS E+++ G    FE LS+SFH   I GL +C RKP+IATC++D SVRIWN+ETN LELYKEF EE+YS+ALHPSGL+ILVGFSDK+RLMN+LIDDIR FKEF++RGC+ECAFS+GGH FAAV+ N+I IYSTT FE V++LKGHNGK+R++ W+ DD +L+SCGMDGAVYEW+  +GKR  ESVLK+CSYTG++++ D K  +AVG+D TLKEI D Q+LRE+ S D   TT+ +++SGR LF GT  G++R+ K+PL    +W EY  HSA ITKM +T +D +L+T+S+D  ++IW++ DKEGR++KR+K++ +AEEILITKSDLEEKN  M EL+TRVDELKMENEYQLRLKDMNYNEKI+ELTE+FIQ++ESLKT+NQVLKTEK+K+   H+E           +L   ES NNQKLMLEY+KY ELQ KSQ+MQE YE +LQ+LE  K  ALE+LT++YE K  EK + L     + R Q  E+EET +L EED DRE+ D +I+YE +LR+E+E+N + + E  +MKKK  SLQ+E+ ++  EI K + E  KLE +I++LEKD + LK+E+Q+RD TI DKEK IYDL  KNQEL+KFKFVLDYKI ELKKQIEPRE  I+  KEQ QE+   ++R
Sbjct:    1 MAAVVAQSHHIFGLRTGVNNNLLFFDEHTVVFPCGNNCVRYDLDQACQSFIPGTERSQSMQAMAISANRRYLAVAE--HKEKATITIYDLQHEQSRRRKVLTGGELPVREFVCMAFSPDSKYLIGQAGGPEWTLFYWVWEKHKIMATVKTTSTGPS-----TSFCPQDNMQICVSGNGLFKIFRYTEGALKQTNSVKMEQHNILSHAWMSKERIIAGTETGRLLVFESGDQRGSLSVTSKPSTQEKSEDTSSSPALLP-RVTAISPYSKGFACSAGPGTVCLFEKTEEKDSYKKNREIKIPPDPCFNDPTQAEQQEISTLCISPSEETLAASTDRGQLYHITLSSVEMSRFG-RCQFEFLSHSFHSGIITGLSICMRKPLIATCSLDHSVRIWNFETNALELYKEFQEESYSVALHPSGLFILVGFSDKIRLMNLLIDDIRAFKEFTVRGCRECAFSHGGHMFAAVNGNVIHIYSTTTFENVLNLKGHNGKVRSMAWSADDSRLVSCGMDGAVYEWNALSGKRESESVLKTCSYTGLTLSPDNKTIFAVGSDCTLKEIQDCQILREMASDDAAYTTIAMTHSGRALFTGTAFGTVRAIKYPLPLQKDWTEYQAHSAPITKMVVTFDDQFLLTVSEDGCLLIWKIIDKEGRALKREKEMSYAEEILITKSDLEEKNQFMLELKTRVDELKMENEYQLRLKDMNYNEKIRELTEEFIQQIESLKTENQVLKTEKEKQAVTHKE-----------DLTFAESNNNQKLMLEYDKYHELQLKSQQMQESYEEKLQQLEDSKVHALEKLTQFYEAKIQEKVSALGQCQDETRQQLREFEETIKLTEEDGDRELQDIRIRYENKLRKEKETNIKHEDEIRVMKKKHDSLQRELKNKDLEIDKLKLEQNKLEGIIKSLEKDILVLKREVQKRDVTINDKEKNIYDLNSKNQELEKFKFVLDYKITELKKQIEPRENVIKEMKEQTQEVGFSVQR 967          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Cavefish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 106.301 bits (264), Expect = 8.372e-23
Identity = 147/643 (22.86%), Postives = 261/643 (40.59%), Query Frame = 1
Query:  121 VYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVA---LAETTSEDK---PVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDS--KYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNL-KNFGIL-KVESQNF-LCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSS--TEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGF-SDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFA-AVHSNLIQIYSTT----NFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRC----------GESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKP-GEWQEYLGHSAQITKMKITPNDDYLV-TISDDCVVMIWRV 1956
            +Y   S +V+YN+D++ Q+  +G   +  +  +A+ P++  +A   +A T+S+ K   P + ++D  S+     L +          +SFS  +   +L       D +L  W W++ ++LA  +     +N SV    F+P D+  I   G +    +   +N+L K  G+  K E   F LC T+  +   I G  +G +++   G  R       SL ++ A   E++   L  ++  T++S  K   +    G             Y+K++ + IP       P ++ A+           ET++  T  + +   +L    T IT+              H  ++ GL +   K    TC  D+ V +W+ + +Q    K   + A S   HPSG  + +G  + +  +++    D+ T            +FS  G++ A   H N I IY+ +     +  V    GH+  I ++ W+ D + L+S   D  +  W  +  K+             S   + S+    +  DG +    GTD                     +  V  SN  R+L  G + G +  F FP ++       Y GHS+ +T +    ND +LV T   D  VM WRV
Sbjct:  165 LYFIASVVVLYNVDEQLQRHYTG--HTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHVLGS-GFFDRALVCLSFSKSNGGSWLCVVDDSNDHVLSVWDWQREERLAEVK----CSNESVFATDFHPTDANTIVTCGKSHLYFWSLEKNSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRI------SLAVQAAH--ESSVLALCMLRNGTLLSGGKDRRITAWDGN------------YQKIQTVEIP---EVYGPIRTVAE--------GRGETVLIGTTKNYVLQGSLDGEFTPITQG-------------HTDELWGLAVHPLKHQFLTCGHDKLVCLWDCDQHQPLWTKTMEDAAQSAGFHPSGATVAIGTQTGRWLVLDTETKDLVTMHTDGNEQISVMSFSPDGNFLAIGSHDNYIYIYAVSENGRKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIPWSSFTCTLSFHVFGLWPDGSD----GTD---------------------VNAVCRSNETRLLATGDDFGKVHLFSFPCSQSRAPSHMYGGHSSHVTNVHFLFNDSHLVSTGGKDMSVMQWRV 731          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Cavefish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 105.916 bits (263), Expect = 1.385e-22
Identity = 145/643 (22.55%), Postives = 257/643 (39.97%), Query Frame = 1
Query:  121 VYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVA---LAETTSEDK---PVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDS--KYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNL-KNFGIL-KVESQNF-LCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSS--TEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGF-SDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFA-AVHSNLIQIYSTT----NFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRC----------GESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKP-GEWQEYLGHSAQITKMKITPNDDYLV-TISDDCVVMIWRV 1956
            +Y   S +V+YN+D++ Q+  +G   +  +  +A+ P++  +A   +A T+S+ K   P + ++D  S+     L +          +SFS  +   +L       D +L  W W++ ++LA  +     +N SV    F+P D+  I   G +    +   +N+L K  G+  K E   F LC T+  +   I G  +G +++   G  R       SL ++ A   E++   L  ++  T++S  K   +    G     +  +  E Y  +R +           G+               ET++  T  + +   +L    T IT+              H  ++ GL +   K    TC  D+ V +W+ + +Q    K   + A S   HPSG  + +G  + +  +++    D+ T            +FS  G++ A   H N I IY+ +     +  V    GH+  I ++ W+ D + L+S   D  +  W  +  K+             S   + S+    +  DG +    GTD                     +  V  SN  R+L  G + G +  F FP ++       Y GHS+ +T +    ND +LV T   D  VM WRV
Sbjct:  264 LYFIASVVVLYNVDEQLQRHYTG--HTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHVLGS-GFFDRALVCLSFSKSNGGSWLCVVDDSNDHVLSVWDWQREERLAEVK----CSNESVFATDFHPTDANTIVTCGKSHLYFWSLEKNSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRI------SLAVQAAH--ESSVLALCMLRNGTLLSGGKDRRITAWDGNYQKIQTVEIPEVYGPIRTVA---------EGRG--------------ETVLIGTTKNYVLQGSLDGEFTPITQG-------------HTDELWGLAVHPLKHQFLTCGHDKLVCLWDCDQHQPLWTKTMEDAAQSAGFHPSGATVAIGTQTGRWLVLDTETKDLVTMHTDGNEQISVMSFSPDGNFLAIGSHDNYIYIYAVSENGRKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIPWSSFTCTLSFHVFGLWPDGSD----GTD---------------------VNAVCRSNETRLLATGDDFGKVHLFSFPCSQSRAPSHMYGGHSSHVTNVHFLFNDSHLVSTGGKDMSVMQWRV 830          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001632.1 (pep scaffold:Pmarinus_7.0:GL476536:457691:473572:-1 gene:ENSPMAG00000001473.1 transcript:ENSPMAT00000001632.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 1.111e-11
Identity = 73/324 (22.53%), Postives = 133/324 (41.05%), Query Frame = 1
Query: 1042 SFTLSSTE--ITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFS--IRGCKECAF----SYGGHYFAAVHSNLIQIYSTT----NFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEW-DTNTGKRCGESVLKSCSYTGISVTQDGKNTYAV---GTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKP-GEWQEYLGHSAQITKMKITPNDDYLVTISD-DCVVMIWRVQ 1959
            SF + +TE  I +   H  F  +    H  ++ GL + + +    TCA D+   +WN  T++    K   +   S   HPSG  + +G     +  + L+ D++T KE      G ++ A       G H     + N I +YS +     +  V    GH+  + ++ W+T+ + L+S   D     W   N  +    + ++   +  ++    G +T+ V   G D T                   +  +  S SG++   G + G +R F+    +P      Y GH + +T +  + +D ++ T    D  V+ WRVQ
Sbjct:  349 SFWVGTTENGILQGSAHGEFSPVVQG-HTDELWGLAVHQNQDAFLTCAQDKQAILWNSATHRPTWIKTLKDPLQSADFHPSGKVVAIG----TQAASWLVLDLKTQKELHHESAGNEQIAVMRYSPDGSHLAVGSNDNFIYVYSVSEEGHKYNAVGKCTGHSSFVTHLDWSTNGEFLMSNSGDYETLYWTPANCKQVTAMATVRDVEWATMTCVL-GFSTFGVWSEGADGT------------------DINALCRSGSGKLCVLGDDFGKVRLFRSSAFQPRSPSHAYGGHCSHVTNVAFSSDDSFVFTTGGKDMGVLQWRVQ 648          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Sea Lamprey
Match: cfap52 (cilia and flagella associated protein 52 [Source:ZFIN;Acc:ZDB-GENE-050522-296])

HSP 1 Score: 63.929 bits (154), Expect = 1.933e-10
Identity = 133/668 (19.91%), Postives = 263/668 (39.37%), Query Frame = 1
Query:   52 LKHVFGFRVGV-NGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSED-KPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQN------FLCHTWVSDERVI-LGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNN---VQVTTIVSSSKG-FAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLS--STEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEE--AYSIALHPSGLYILVGFSD---------KLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLK--EISDSQVLREVE-SVDVQLTTVTLSNSGRMLFC--GTNNGSIRSFKF---PLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWR 1953
            L+ V GF   V +G +++ + + L+YP G  +V+ ++    Q F+ G   ++ ++ +A+S +  YVA  + T    K  +++++         L+  ++   +  +++FSP+  YLA      D  ++ W   K + +    ++ P A  + N + F           GN+  ++++    ++ N  I   + Q         C     D+     GT +G ++ V         NL          KL N+ G   N   + VT +     G   V  G G V   ++ + K   K   E                   +  + +        A T + Q+Y F L   + E+           +++ F  S            + ATC+  + +R+W+ ++ + EL +        +SI    +G  I+ G++D           RLM I ID+       ++    +C     G     V    +    T +  +V ++K H   I  +    +DK+ +S   DG    WD     R  + V+ +  +       +       GTD+ +   E+ D  ++RE+E S    +  + +S  G       G ++  I+ + +    +T  G+     GHS  +T++ + PN  +++++S D  ++ WR
Sbjct:   16 LESVIGFNGQVPSGLVSHPDCEHLLYPLGCTVVIRSLKGARQSFLHG--HTNNVSCLAVSNSGHYVASGQVTYMGFKADVILWNFEKRELHARLTLHKV---KVEALAFSPNDLYLASLGGQDDGSVVIWNVTKKEAVCGNAVSLPTAG-TTNTVRFTNTSDLSFITAGNDTIRVWQL---DIPNRKIRPTDCQTGQLKRIIKCVAVAPDDSFFYCGTTSGDILKV---------NLKT--------KLLNSYGPAKNKLTLGVTALSLLKSGELLVGTGDGVVALCKEANFKTMQKVALE-----------------GAVTSISLRGQGHQFFAGTAVAQIYQFNLPEFTHEMIATCHSEPVNDVAFPFITSGT--------SELFATCS-SQDIRVWHTQSGK-ELLRITVPNMTCHSIQFARNGKNIVSGWNDGKIRAFTPESGRLMYI-IDNAHGMGVTTVSLTGDCKRIISGGVSGQVR---VWELGTQSQRLVEAMKEHKSSISCIRLKHNDKECVSASTDGTCIIWDLERFVR-KQIVMANTLFKCACYHPEEFQIITSGTDRKIGFWEVFDGSLIRELEASQSGSINGMDVSPDGEYFVTVKGGDDKLIKVWSYNDGDVTFVGK-----GHSGNVTRLCVCPNRWHILSVSTDGAILRWR 620          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005742.1 (pep scaffold:Pmarinus_7.0:GL478452:1315:31647:1 gene:ENSPMAG00000005164.1 transcript:ENSPMAT00000005742.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 4.350e-9
Identity = 66/322 (20.50%), Postives = 124/322 (38.51%), Query Frame = 1
Query: 1117 HYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFA--EEAYSIALHPSGLYILVGFSDK-LRLMNILIDDIRTFKEFSIRGCKECAFSYGGH---YFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWD----------------------TNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKE---GRSVKRD 1989
            H   +      R    +A+CA D  ++ WN  T + EL   +A  E     A  P+G  I  G +D  ++L N     +           + C F++  H          + I+++         +L GH+G +R   ++ DD++L+SC +D  +  W                       T  G+R     L+SC++     + DG+   AV  +      + +     V       T + ++ +   L C     S     + +    +  +Y GH   +  +  + +  +L++ S+D  V +W+V  +E   G  +KRD
Sbjct:  120 HAGAVYHAAFSRSGEYVASCAGDGYLKKWNSRTGE-ELMATYAHDEPVLCCAFAPNGRVIATGSADHTVKLWNAQSGRLLGPHRAHDGEVQHCTFAHAFHKPLLATCSQDSSIKLWEWKEQGKGSALLGHSGPVRCCCFSPDDQRLVSCSVDCTLKVWSVKLRQEERSVDVRECVDSEDGATKEGER--SLALRSCAW-----SPDGRRIVAVAENIVFVFNALTVACENVLRTHAHCTILAVAFAPDSLHCAVGLSSYSLEMWNVKSCRKTADYRGHVGWVHGVAFSADGSWLLSASEDHTVSLWQVNGEESAAGVYLKRD 433          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 58.5362 bits (140), Expect = 7.680e-9
Identity = 56/286 (19.58%), Postives = 121/286 (42.31%), Query Frame = 1
Query: 1117 HYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFA--EEAYSIALHPSGLYILVGFSDK-LRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFA-AVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTG-ISVTQDGKNTYAVGTDKTLK--EISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWR 1953
            H   I  +D       +A+ ++D  + +WN++  Q   Y+     +   S+   PSG  ++    DK +RL    +    T  +      +  +FS  G     A     I++++    + + SL  H+  +R+  ++ D + ++S   D  V  WD+N+ + C  +  +   +   +     G    A GTD T+K  +I  +++L+  +     + +++   +G  L   +N+ +++     L +   +    GH    T +  +   D+  +   D  VM+W+
Sbjct:   17 HRDTITSVDFNPNMKQLASGSMDACLMVWNFKP-QTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNS-RECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLD--LVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVWK 298          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Sea Lamprey
Match: mapkbp1 (mitogen-activated protein kinase binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-120207-1])

HSP 1 Score: 57.7658 bits (138), Expect = 1.674e-8
Identity = 49/207 (23.67%), Postives = 92/207 (44.44%), Query Frame = 1
Query:   52 LKHVFGFRVGVNGAIAYQNEQTLV-YPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMF-----RYSENNLK-----NFGILKVESQNFLC 639
            L+ V G  +  +  +    +  LV YP G  +V++N  +  Q  I    +   +T +A SP+ +Y+   E  S   P + ++DL     +  +S  +      + ++FSP+ KY+       D ++  W W K   +A  +++S      V  +SF+  D++    +GN   + +     + S+ NL        G+L V+  NF C
Sbjct:    3 LEKVLGITLSSSSGLCCDPKTGLVAYPAGCTVVIFNPKKGKQTHIFNASRK-PITTLAFSPDGKYLVTGE--SGHMPAVRVWDLAD---RTQVSEFQRHKYGISCVAFSPNVKYVVSVGYQHDMMVNVWDWRKGALIAFNKVSS-----KVTAVSFS-SDNSYFVTVGNRHVRFWYLDASKASKANLTVPLLGRSGLLGVQRNNFFC 197          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 55.0694 bits (131), Expect = 6.617e-8
Identity = 54/214 (25.23%), Postives = 97/214 (45.33%), Query Frame = 1
Query: 1378 KECAFSYGGHYFA-AVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQ-DGKNTYAVGTDKTLKEISDSQVLREVESVDVQ----------LTTVTLSNSGRMLFCGTNNGSIRSF-----------KFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIW 1950
            +   FS  G + A      LI+I+   N ++VM L+GH   I ++ +     KL+S   D  V  WD  TG+ C  ++      T ++V+  DGK   A   D+ ++ + DS+    VE +D +          + +V  +  G+ +  G+ + S++ +           K P +   E   Y+GH   +  +  T ND+Y+++ S D  V+ W
Sbjct:  447 RSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQ-CSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVR-VWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVT-YIGHKDFVLSVATTQNDEYILSGSKDRGVLFW 657          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Yeast
Match: UTP13 (Nucleolar protein; component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA [Source:SGD;Acc:S000004212])

HSP 1 Score: 51.9878 bits (123), Expect = 7.279e-7
Identity = 41/158 (25.95%), Postives = 68/158 (43.04%), Query Frame = 1
Query: 1117 HYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGK 1590
            H   I  L +     I AT + D++ +IWN E  +LE          ++A H  GL+                 D+ +F ++     K  A S G           ++I+S   F V+ +L+GH   ++   +    K+LISCG DG +  WD ++G+
Sbjct:  490 HEKDINALSVSPNDSIFATASYDKTCKIWNLENGELE---------ATLANHKRGLW-----------------DV-SFCQYD----KLLATSSG--------DKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGE 608          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Yeast
Match: LST8 (Protein required for the transport of Gap1p; required for the transport of amino acid permease Gap1p from the Golgi to the cell surface; component of the TOR signaling pathway; associates with both Tor1p and Tor2p; contains a WD-repeat [Source:SGD;Acc:S000004951])

HSP 1 Score: 48.1358 bits (113), Expect = 5.089e-6
Identity = 44/200 (22.00%), Postives = 86/200 (43.00%), Query Frame = 1
Query: 1417 AVHSNLIQIYS--TTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNT---------GKRCGESVLKSCSYTGISVTQDGK-NTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFP------LTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQD 1962
            A H N +++Y   TTN   V S +GH G + +V +  D++ +++   DG +  WD  +              E V+       IS  +DG    + +G ++   +++           D  L ++++++ G ML      G+   ++ P        KP    ++  HS  IT++ ++ +  +L T S D    +W + D
Sbjct:   50 AGHQN-VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED--------DTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPV--TKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDD 238          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Nematostella
Match: EDO36068 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJM7])

HSP 1 Score: 1118.22 bits (2891), Expect = 0.000e+0
Identity = 546/886 (61.63%), Postives = 670/886 (75.62%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNL---------AASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKK 2661
            M+IA A  +H FG +                              +SQ+FI G +KS  MTAMA+SPNRRYVA+AE    +K  I IYDL+++RKKK LS PE+ + EF S++FSPDSKYL  Q+  PDW L+YW WEK+K +A T+ +S   + +V Q+SFNPQD+TQ+C +GN  FK+FRYSE NLK F   K+E QNFLCH WVSDER+I GTDTG+L+L E+GE++ EF++          A  +   A   + +       QVT I + SKGF  + G G VH FEK ++K+ YKK REI IP D+ + DP   ++Q I D+ +SPSEET+V  T+  QLYS TLS+ ++ K GD + FELLS SFH+  I G+D+C RKP+IATC++DRSVRIWNYET  LE YKEF EE YSIALHPSGLYILVGFSDKLRLMN+LIDDIR FKEF+IRGC+EC+FS GGH FAAVH N+IQ+YS+T FE V +LKGHNGK+R V+W+ DD K+ISCGMDGAVYEW+    KR GESVLKSCSYT ++V+ DG+ T+AVG+D+T+KEI DSQ+LREV + D+ LT   +S SGRMLF GT +G++R+ KFPLT PGEWQE+  H+  I KM+++ +D YL T S+D  + I++  DKEGR +KRDK++G+AEEILITKSDLEEKNA MAEL+TRV+ELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKT+KDKEEAKHEE + + MEKHSKELQD+ESANNQKLM EYEKYQELQAKSQ+MQEDYERQL E+E  +EQ LEELTEYYE K  EK+  L+   ++ R Q  EYEETK+ IEEDADREILD K KYERRLREE+E+N RLKGETGIM+KK
Sbjct:    1 MSIAVATPRHCFGLKA----------------------------DKSQRFIPGSDKSVGMTAMAVSPNRRYVAIAEKG--EKATITIYDLHTLRKKKVLSHPEVQSAEFVSLAFSPDSKYLVSQSGRPDWTLLYWTWEKAKVMAFTK-SSNQQDSAVYQVSFNPQDNTQLCVVGNGIFKLFRYSEGNLKQFAFQKMEPQNFLCHAWVSDERIITGTDTGRLLLFESGELKNEFSVFGGGPSAPGTARQLSTAAIGADPSPTQTAYPQVTCIAAFSKGFICSGGAGTVHLFEKAEEKDAYKKSREIRIPTDTTNPDPQMIESQEIKDLTVSPSEETLVCSTSTSQLYSITLSTADLGK-GDLATFELLSQSFHHGVITGMDVCIRKPLIATCSLDRSVRIWNYETCSLEAYKEFQEECYSIALHPSGLYILVGFSDKLRLMNLLIDDIRYFKEFTIRGCRECSFSNGGHLFAAVHGNVIQLYSSTTFENVGNLKGHNGKVRQVIWSQDDSKIISCGMDGAVYEWNVYNYKREGESVLKSCSYTSVTVSPDGRTTFAVGSDRTIKEICDSQILREVPASDMVLTQCVMSRSGRMLFAGTASGTLRAMKFPLTVPGEWQEHQVHAGSINKMRMSYDDQYLFTASEDGSLYIYKAVDKEGRGLKRDKEVGYAEEILITKSDLEEKNAMMAELKTRVEELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTDKDKEEAKHEEEVADHMEKHSKELQDLESANNQKLMSEYEKYQELQAKSQKMQEDYERQLTEMEEAREQVLEELTEYYENKLQEKTAQLDQSQEESRQQLREYEETKKQIEEDADREILDIKNKYERRLREEKEANLRLKGETGIMRKK 854          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Nematostella
Match: EDO36069 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJM8])

HSP 1 Score: 184.496 bits (467), Expect = 2.853e-54
Identity = 92/131 (70.23%), Postives = 110/131 (83.97%), Query Frame = 1
Query: 3088 DVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRK 3480
            DVEA V+RFKTDLYNCV +IQ+PK LKE++ ALY+K++Q++   +      A VDADIQ+E+ RQREHLERSVASLRKKL+KDSEIHRAD VRIMQENV+LIKEINDLR+ELK +RT  HDLE ALG+ RK
Sbjct:    1 DVEAVVKRFKTDLYNCVGFIQEPKKLKENVKALYQKYVQDETPES------AGVDADIQREYARQREHLERSVASLRKKLTKDSEIHRADNVRIMQENVTLIKEINDLRRELKIARTQVHDLETALGVMRK 125          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Nematostella
Match: EDO48487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIZ6])

HSP 1 Score: 100.908 bits (250), Expect = 1.246e-21
Identity = 167/725 (23.03%), Postives = 296/725 (40.83%), Query Frame = 1
Query:   52 LKHVFGFRVG-VNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQI--CAIGNNFFKMFRYSENNLKNFGILK--VESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQ---VTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEI--TKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRG--CKECAFSYGGHYFA-AVHSNLIQIYSTTN-FEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKR-CGESVLKSCSYTGISVTQDGKNTYAVGT--DKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPG-EWQEYLGHSAQITKMKITPNDDYLVTI-SDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDEL--KMENEYQLRLKDMNYNEKIKELTEK 2163
            L+ V+G+R       + Y   + +VY      V+YN  + +Q+F  G +    + ++A+ P +  VA  +   +  P I ++D +S      L   +      T ++F+P   YL         +++ W W++ KQLASTR  +      +  + FNP     +  C + +  F   R +  N K  GI     E Q  LC  + SD+    GT +G++                        K +N  G + N     V +I   + GFA     G V  +    D E+    +  LI  ++     G S    I  +C     E I+  TN  +++    +  +   T +  H+  EL + + H           +K I AT + D+SVR+W+     L    +  ++  S+A +  G ++ VG SD    M +   D+      + R     E  +S  G + A   + N + IY+    ++ V   KG +  I ++ W+ D K L +         +   TGKR   +  +KS  +           T  VGT  +    + SD+    +V ++D             ++  G + G ++ FKFP  + G ++++Y+GHSA +T ++ + + + ++++   D  V  WR    EG +   D D+  A         L+  +       + +DEL   +ENE Q+      Y E +  L EK
Sbjct:   13 LEWVYGYRGHQCRNNLYYTASKEIVYFVAGVGVVYNTRENTQRFFLGHDDD--IISLALHPEKVLVATGQVGKD--PYICVWDSHSTETVSILK--DAHQRGITCLAFNPSGNYLVSVGLEDYHMVVVWDWKRGKQLASTRGHTD----RIFDMQFNPYKENVLVSCGVKHIIFWTLRGNSLNPKK-GIFGKTGEIQTNLCLAFGSDDVTYSGTLSGEIY---------------------KWKGQNLAGAIPNAHTGAVFSIFGGADGFASGSKDGTVVLW----DAEFKPIAKLDLI--NTRVGYEGLS----IRSVCWLG--EKILVGTNAGEVFEVMATDKDKPRTIVQGHAEGELWALAAH----------PKKGIFATGSDDKSVRLWSMADKSLLARTDVDQKVRSVAFNADGTHLAVGLSDG-SFMILKARDLSEVTRINDRKEVLHEMKYSPDGQFLAVGSNDNFVDIYAVAQKYKKVGECKGSSSFITHLDWSEDSKYLQTNSGAAERLFYRMPTGKRITNKEEIKSIHWA--------TWTCVVGTEVNGIWGKYSDTN---DVNALDACFQH-------NVMVTGDDFGLVKLFKFPSVRKGSKFRKYVGHSAHVTNVRFSNDFNRVISVGGGDHAVFQWRFL-PEGITDDHD-DLPEA-----VSGYLDSDSEESDSEASDIDELDSDVENEQQIDYSRTIYREDLPALKEK 657          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Nematostella
Match: EDO48010 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKM0])

HSP 1 Score: 80.1073 bits (196), Expect = 3.075e-15
Identity = 135/666 (20.27%), Postives = 259/666 (38.89%), Query Frame = 1
Query:   52 LKHVFGFRVGV-NGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSED-KPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLK------NFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLEN-NQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEY-YKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLS--STEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAY--SIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYG-GHYFAAVHSNLIQIYSTT---------NFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLK--EISDSQVLREVE---SVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFP---LTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWR 1953
            L+ V GF   V NG + + +   L+YP G+ +V+  I    Q  +SG   +  +T +A+S + RY+A  +      K  ++++D    + K  L+  ++   +  +++FSP+ +YL       D  ++ W  +  + +  +    P+A  + N ++F   +       GN   +++     N K      N G LK    N +  T   D     GT +G ++++         N+   L        E  +QG    V    ++   +   V  G G V      D K +   K    L  V+ +           I  + +          T + Q+Y F     + E      +     + + F +S I            ATC+ +  +R+WN  T++ EL +         ++ +   G   + G+ D           IR F+  S +   E + ++  G     V+S   +I S             +++  +K H G +  +    DD + +S   DG    W+  +  R  + V  +  +  +            GTD+ +   E  D  ++R++E   +  +Q   + L +S      G  +  ++ + +    +T  G      GHS  IT++KI PN  ++V++S D  ++ WR
Sbjct:   14 LESVIGFAGAVPNGLLVHPDRDHLIYPLGNTVVIEQIKTGKQSCLSG--HTDNVTCVAVSKSGRYLASGQQAHMGFKASVIVWDYAEKKLKYQLTLHKV---KVEALAFSPNDEYLVSLGGQDDGSVVVWDLQAGEAVCGSPAAVPSAG-TTNAVAFANHNDNLFITGGNKTLRVWELDRPNRKIRPTECNMGQLK-RIVNCIKVT-EDDTHFFCGTTSGDILMI---------NIQNRLFRHYGPAKEKFSQG----VTAMELIKGGQELLVGAGDGTV---AVVDCKNFKVSKANSKLCKVEGD-----------ITSIALRGQGHQFFVGTKLSQMYRFNFPEFTYERINTCHYDKVNDVVFPFGFSDIF-----------ATCSKNE-IRVWNTNTSK-ELLRIVVPNVTCNTVDIQKDGKAFVSGWDD---------GKIRVFRPESGQLFYEISDAHSKGVTAVIVNSTCSKIVSGGGEGQVRVWEGKKLLGMMKEHKGSVTCIKLKRDDTECVSASTDGTCIIWNLESFVR-SQIVFANTMFEAVCYHPSDCQIITAGTDRKIAYWETFDGALIRDLEGSSAGSIQGMDIALDDSVTHFVTGGADKLLKVWDYDAGQVTHLGG-----GHSGDITRVKICPNSRWIVSVSADGAILRWR 616          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Nematostella
Match: EDO49767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFR6])

HSP 1 Score: 68.9366 bits (167), Expect = 1.933e-12
Identity = 65/285 (22.81%), Postives = 117/285 (41.05%), Query Frame = 1
Query: 1129 ILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYK--EFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTT---VTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKE 1968
            ILG+ +      I T   D S+R+W+YET + EL K  +  +  Y++AL P   +++ G                             AF +            ++I+      +V +LKGH   +  V+ T D K++IS   D  V  WD  T               GI++T DG+   +   D+TL+ I + +    V ++     T   V  S   +    G+ +  ++ +     K  E +  +GH++ I  + +TP+   +++  DD  V +W ++  E
Sbjct:   16 ILGIAVTPDTKKIITGGADGSIRVWDYETGK-ELNKLLDHTKLVYTLALSPHADFLVSG-----------------------------AFDH-----------TVKIWDMDTLSLVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAITSDGRRLVSASQDRTLR-IWNLETFAHVSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAK--EVRSLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGE 256          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Medaka
Match: cfap57 (cilia and flagella associated protein 57 [Source:NCBI gene;Acc:101154773])

HSP 1 Score: 946.421 bits (2445), Expect = 0.000e+0
Identity = 504/1156 (43.60%), Postives = 759/1156 (65.66%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLN--SMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAAS------------LILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQE--DVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHD 3450
            M+  +A    + G R GV+  + + +E TLVY  GS+ V  N  QR Q+F  G EKS  + A+A+S + R++A++E    +   I ++DL     RKKK LSA +I A EF  I+FS DSKYL GQT  P+W+L++W WEK+K LAS + T+ +    VNQ+SF+P +STQ+C  G+  FK+ R SE  LK     +VE+ NFLCH WV ++R+I GTDTG+L++ E+G+IR E  + +             + L+EA+ +E+    L+   +T + S SKGF  + G G    FEK + ++ Y++ REI IP D        +  Q I  MC+SP+EET+   T   QL+S  +SS ++ K     +F+ +   FH S I GL +C RKP++ATC++DRSV IWNYET +L+LYK+F EEA+S+ALHP+G ++LVGFSDKLRLMN+L+DDIR F+EF++R C+ECAFS+GGH FAAV  N+I +YS  + E V++LKGH+GK+R++ W+ DD +L+SCGMDGAVYEW+T TGKR  ESVL+SCS+TG++ + D K+  AVG+D TLKE+ D QVLR V +     T + +S+SGR++F GT++G+IR+ K+PL    +W +   HS  ITKM IT +D +L+++++D  +++ ++ DK+GR +K ++ +  AEEIL+TK +LEEKN +M  L+ R++EL+ME+EY+LRLKD+NYNEKIKEL+EKF QE++SLKT  QV+  E +  + + E+   E+ +KH K+L+D+E + NQKL+LE+EK+Q+LQ K ++ +ED+++QL+  E  K QALEE T  YE K  EK+ +L    ++ + +     E  + +EED + ++   +IKYE++L+ E+E N  LKG+T  +K +   LQ ++ DQ  +  K Q E Q L ++I  LE D   L  +I    +TI++K+  I DLK K Q+L+K KF+ ++++ E +KQ E ++ EI+  +E I  ++ +L++  K ++QL L+  +L+ KLK+ +KE+    Q  +++E ++ R ++DL+ CV YIQ+P+ LKESI  LY  H+ E   V    +   E   + D+Q   T QR+ LE++V SL+ KL      H   Y R+ +E  ++I E N LRKEL   RT   D
Sbjct:    1 MSSISAQAHFILGLRTGVSNNLNFIDEHTLVYATGSSCVCLNTVQRFQRFFPGSEKSRSVRALAVSASHRFLAVSECG--ESACITVFDLQHEQGRKKKVLSAGDIHAQEFVCIAFSHDSKYLIGQTGAPEWMLVFWLWEKNKVLASVKTTTSSN--PVNQVSFSPHNSTQLCVSGSGVFKLLRLSEGVLKQTSTARVENFNFLCHAWVPEDRLIAGTDTGRLLVSESGDIRKEIRMMSKEGQSQADRQVKVMRLKEAEVVES----LSACPITAVFSYSKGFVCSTGPGTACLFEKME-QDSYRRSREIQIPPDPQGDQLTLADGQEIQSMCMSPAEETLAISTTRGQLFSVNVSSADMNK-EQKLHFDFVCQPFHSSPITGLSICFRKPLVATCSLDRSVHIWNYETKELDLYKQFQEEAHSVALHPTGFFVLVGFSDKLRLMNLLVDDIRVFQEFTVRSCRECAFSHGGHMFAAVSGNMIHVYSFISCENVLNLKGHSGKVRSIEWSVDDSRLVSCGMDGAVYEWNTQTGKRESESVLESCSFTGVAFSLDYKSALAVGSDLTLKEVQDGQVLRVVPADQDAHTAIAVSHSGRVVFTGTSSGAIRAIKYPLPSQRDWFQQRAHSGAITKMVITYDDQFLLSVAEDNCLLVSKIIDKDGRGLKSNRQVVHAEEILVTKLELEEKNQSMMALKMRLEELQMEHEYRLRLKDVNYNEKIKELSEKFQQEIKSLKTTQQVMTVEVETCKRESEKNSAELAKKHVKQLKDLERSFNQKLILEHEKFQDLQEKLKKTEEDHKKQLRSAEQSKVQALEEATHMYEAKLQEKTQLLAQSQQEAQLKISVLNEVIKQMEEDEELKLNAVQIKYEKKLQSEKEINLNLKGKTDDVKHEIRCLQAQVRDQSADTHKLQQERQSLRDLITALEGDIQELNMQIFGHKQTIENKDITISDLKGKIQQLEKLKFIYEFQLNEFRKQTETQKEEIKEQREMITTLKDDLQQMDKSSSQLKLSNSDLRLKLKAKDKEIFKNLQKVKNLELRLTRIRSDLHTCVGYIQEPRKLKESIKILYAHHVPEPGSVERDSEDVEEEEDEDDVQMTLTVQRDQLEKTVDSLKMKLDNSDAEHNKVYERMKKEKAAMITENNQLRKELLLIRTQVKD 1146          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Medaka
Match: cfap57 (cilia and flagella associated protein 57 [Source:NCBI gene;Acc:101154773])

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 483/1156 (41.78%), Postives = 724/1156 (62.63%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLN--SMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAAS------------LILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQE--DVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHD 3450
            M+  +A    + G R GV+  + + +E TLVY  GS+ V  N  QR Q+F  G EKS  + A+A+S + R++A++E    +   I ++DL     RKKK LSA +I A EF  I+FS DSKYL GQT  P+W+L++W WEK+K LAS + T+ +    VNQ+SF+P +STQ+C  G+  FK+ R SE  LK     +VE+ NFLCH WV ++R+I GTDTG+L++ E+G+IR E  + +             + L+EA+ +E+    L+   +T + S SKGF  + G G    FEK + ++ Y++ REI IP D        +  Q I  MC+SP+EET+   T   QL+S  +SS ++ K     +F+ +   FH S I GL +C RKP++ATC++DRSV IWNYET +L+LYK+F EEA+S+ALHP+G ++LVGFSDKLRLMN+L+DDIR F+EF++R C+ECAFS+GGH FAAV  N+I +YS  + E V++LKGH+GK+R++ W+ DD +L+SCGMDGAVYEW+T TGKR  ESVL+SCS+TG++ + D K+  AVG+D TLKE+ D QVLR V +     T + +S+SGR++F GT++G+IR+ K+PL    +W +   HS  ITKM IT +D +L+++++D  +++ ++ DK+GR +K ++ +  AEEIL+TK +LEEKN +M  L+ R++EL+ME+EY+LRLKD+NYNEKIKEL+EKF QE++SLKT  QV+  E +  + + E+   E+ +KH K+L+D+E + NQKL+LE+EK+Q+LQ K ++ +ED+++QL+  E  K QALEE T  YE K  EK+ +L    ++ + +     E  + +EED + ++   +IKYE++L+ E+E N  LKG+T  +K +   LQ ++ DQ  +  K Q E Q L ++I  LE D   L  +I    +TI++K      LK   Q++DK    L     +L+ +++ ++ EI    +++                                          +++E ++ R ++DL+ CV YIQ+P+ LKESI  LY  H+ E   V    +   E   + D+Q   T QR+ LE++V SL+ KL      H   Y R+ +E  ++I E N LRKEL   RT   D
Sbjct:    1 MSSISAQAHFILGLRTGVSNNLNFIDEHTLVYATGSSCVCLNTVQRFQRFFPGSEKSRSVRALAVSASHRFLAVSECG--ESACITVFDLQHEQGRKKKVLSAGDIHAQEFVCIAFSHDSKYLIGQTGAPEWMLVFWLWEKNKVLASVKTTTSSN--PVNQVSFSPHNSTQLCVSGSGVFKLLRLSEGVLKQTSTARVENFNFLCHAWVPEDRLIAGTDTGRLLVSESGDIRKEIRMMSKEGQSQADRQVKVMRLKEAEVVES----LSACPITAVFSYSKGFVCSTGPGTACLFEKME-QDSYRRSREIQIPPDPQGDQLTLADGQEIQSMCMSPAEETLAISTTRGQLFSVNVSSADMNK-EQKLHFDFVCQPFHSSPITGLSICFRKPLVATCSLDRSVHIWNYETKELDLYKQFQEEAHSVALHPTGFFVLVGFSDKLRLMNLLVDDIRVFQEFTVRSCRECAFSHGGHMFAAVSGNMIHVYSFISCENVLNLKGHSGKVRSIEWSVDDSRLVSCGMDGAVYEWNTQTGKRESESVLESCSFTGVAFSLDYKSALAVGSDLTLKEVQDGQVLRVVPADQDAHTAIAVSHSGRVVFTGTSSGAIRAIKYPLPSQRDWFQQRAHSGAITKMVITYDDQFLLSVAEDNCLLVSKIIDKDGRGLKSNRQVVHAEEILVTKLELEEKNQSMMALKMRLEELQMEHEYRLRLKDVNYNEKIKELSEKFQQEIKSLKTTQQVMTVEVETCKRESEKNSAELAKKHVKQLKDLERSFNQKLILEHEKFQDLQEKLKKTEEDHKKQLRSAEQSKVQALEEATHMYEAKLQEKTQLLAQSQQEAQLKISVLNEVIKQMEEDEELKLNAVQIKYEKKLQSEKEINLNLKGKTDDVKHEIRCLQAQVRDQSADTHKLQQERQSLRDLITALEGDIQELNMQIFGHKQTIENK------LKDDLQQMDKSSSQLKLSNSDLRLKLKAKDKEIFKNLQKV------------------------------------------KNLELRLTRIRSDLHTCVGYIQEPRKLKESIKILYAHHVPEPGSVERDSEDVEEEEDEDDVQMTLTVQRDQLEKTVDSLKMKLDNSDAEHNKVYERMKKEKAAMITENNQLRKELLLIRTQVKD 1098          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Medaka
Match: eml2 (EMAP like 2 [Source:NCBI gene;Acc:101162059])

HSP 1 Score: 94.3597 bits (233), Expect = 4.818e-19
Identity = 140/642 (21.81%), Postives = 254/642 (39.56%), Query Frame = 1
Query:  118 LVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDK------PVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDS--KYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNL-KNFGIL-KVESQNF-LCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGK----VHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTN---IHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECA---FSYGGHYFA-AVHSNLIQIYSTT----NFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVD-VQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKP-GEWQEYLGHSAQITKMKITPNDDYLVTISD-DCVVMIWRV 1956
            +VY   S +V+YN +++ Q+   G   +  +  +++ P+   +A  +     K      P + I+D  S+     +          T +SFS  +   +L       D +L  W W+K KQLA  +     +N SV    F+P D+  I   G +    +      L K  G+  K E   + LC  +  +   I G  +G + +   G  R    ++ +           ++G + ++ V       K   +  G GK    V W     D +Y KK  E+ +   S+S  P ++ A+          EE  V  T    I   +  TL  T I +              H  ++ GLD+        TCA D+ V++W+  ++Q    K   ++A S+  HPSG  + VG      L  +L  D R        G +  +   +S  G++ A   H N + IY+ +     +  V    GH+  + ++ W+ + + +++   D  +  W+ + GK            T +   ++ +   +  T      +S + +    ES D   +     S+ G +L    + G +  F FP ++P     EY GHS+ +T +    +D  L++    D  ++ W V
Sbjct:  223 IVYFIASVVVLYNTEEQQQRHYLG--HTDDVKCLSVHPDMVTIATGQVAGNSKEGKLLAPHVRIWDSVSLNTVHVIGMGG-FDRAVTCVSFSKSNGGAFLCAVDDANDHILSVWDWQKEKQLADVK----CSNDSVLAAVFHPMDNNLIVTCGKSHINFWTMEGRTLTKRQGLFEKHEKPKYVLCVAFAENGDTITGDSSGNIYIWAKGGSRISHAVSGA-----------HEGGIFSICVL------KDGTMVSGGGKDRRVVLW-----DHDYRKKA-EMEV---SDSLGPVRALAE-------GKPEELFVGTTKNAIIRSAFPDTL--TPIVQG-------------HTDELWGLDVHPSMEQFVTCAQDKLVQLWDSNSHQPLWSKSIEDQARSVGFHPSGAVLAVGTMTGRWL--VLDADTRDLVSVHTDGNEMISTIRYSPDGNFLAVGSHDNFVYIYAVSEGGRKYSRVGKCSGHSSFVTHLDWSANSQYIVTNSGDYEILFWEASNGKHV----------TNVDTVRNLEWATSTCT------LSFNTLGIWPESADGTDINAACRSHGGSLLASADDFGKVHLFTFPCSQPRAPSLEYGGHSSHVTNVAFLHDDSRLISSGGKDTSILQWAV 791          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Medaka
Match: eml2 (EMAP like 2 [Source:NCBI gene;Acc:101162059])

HSP 1 Score: 93.9745 bits (232), Expect = 6.083e-19
Identity = 140/642 (21.81%), Postives = 254/642 (39.56%), Query Frame = 1
Query:  118 LVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDK------PVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDS--KYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNL-KNFGIL-KVESQNF-LCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGK----VHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTN---IHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECA---FSYGGHYFA-AVHSNLIQIYSTT----NFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVD-VQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKP-GEWQEYLGHSAQITKMKITPNDDYLVTISD-DCVVMIWRV 1956
            +VY   S +V+YN +++ Q+   G   +  +  +++ P+   +A  +     K      P + I+D  S+     +          T +SFS  +   +L       D +L  W W+K KQLA  +     +N SV    F+P D+  I   G +    +      L K  G+  K E   + LC  +  +   I G  +G + +   G  R    ++ +           ++G + ++ V       K   +  G GK    V W     D +Y KK  E+ +   S+S  P ++ A+          EE  V  T    I   +  TL  T I +              H  ++ GLD+        TCA D+ V++W+  ++Q    K   ++A S+  HPSG  + VG      L  +L  D R        G +  +   +S  G++ A   H N + IY+ +     +  V    GH+  + ++ W+ + + +++   D  +  W+ + GK            T +   ++ +   +  T      +S + +    ES D   +     S+ G +L    + G +  F FP ++P     EY GHS+ +T +    +D  L++    D  ++ W V
Sbjct:  245 IVYFIASVVVLYNTEEQQQRHYLG--HTDDVKCLSVHPDMVTIATGQVAGNSKEGKLLAPHVRIWDSVSLNTVHVIGMGG-FDRAVTCVSFSKSNGGAFLCAVDDANDHILSVWDWQKEKQLADVK----CSNDSVLAAVFHPMDNNLIVTCGKSHINFWTMEGRTLTKRQGLFEKHEKPKYVLCVAFAENGDTITGDSSGNIYIWAKGGSRISHAVSGA-----------HEGGIFSICVL------KDGTMVSGGGKDRRVVLW-----DHDYRKKA-EMEV---SDSLGPVRALAE-------GKPEELFVGTTKNAIIRSAFPDTL--TPIVQG-------------HTDELWGLDVHPSMEQFVTCAQDKLVQLWDSNSHQPLWSKSIEDQARSVGFHPSGAVLAVGTMTGRWL--VLDADTRDLVSVHTDGNEMISTIRYSPDGNFLAVGSHDNFVYIYAVSEGGRKYSRVGKCSGHSSFVTHLDWSANSQYIVTNSGDYEILFWEASNGKHV----------TNVDTVRNLEWATSTCT------LSFNTLGIWPESADGTDINAACRSHGGSLLASADDFGKVHLFTFPCSQPRAPSLEYGGHSSHVTNVAFLHDDSRLISSGGKDTSILQWAV 813          
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Medaka
Match: ENSORLT00000018745.2 (cilia and flagella associated protein 44 [Source:NCBI gene;Acc:101160927])

HSP 1 Score: 70.8626 bits (172), Expect = 1.066e-11
Identity = 56/233 (24.03%), Postives = 109/233 (46.78%), Query Frame = 1
Query:   49 HLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVE-------SQNFLCHTWVSDERVILGTDTGKLILVENGEIRTE 726
            HL H FGF       +   ++ TL++  G+ +V+ ++  + Q+F+        + A+A+ P+R + A+AE  +   P I++Y+  S+R  + L       + ++ +SF+ D   LA     PD+LL  W W + +++ S + TS      V+++SF+  D   +   G      ++ S      F + K+        + +      + D  V+ GT+ G L+L +   I+ E
Sbjct:   48 HLSHSFGFDSRRRANLGVLDDSTLIFIAGNLMVLLDVHAQEQRFLR-SSGGGGIGAIAVHPSREFFAVAEKGTS--PDIIVYEYPSLRPGRILRGGT--RHRYSCVSFNHDGSLLASVGGEPDFLLTLWDWRR-EEVQSFQATSQ----EVHRVSFSHYDQELLTTAGCRHINFWKLS-TTFTGFKLEKLAGHFGNSVASDIEGVLELPDGEVVSGTEWGNLLLWDGNSIKAE 269          
BLAST of cilia- and flagella-associated protein 57 vs. Planmine SMEST
Match: SMESG000072029.1 (SMESG000072029.1)

HSP 1 Score: 2468.34 bits (6396), Expect = 0.000e+0
Identity = 1238/1239 (99.92%), Postives = 1239/1239 (100.00%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRKQGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKIVGMESGRLIXXXXXXXXXXXXAPDEIATRSILSAGERLPPIDT 3747
            MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACT+IHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLQKEIDDQKEEIKKFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDELKQKLKSTEKELKTERQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRKQGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKIVGMESGRLINTNTNNNGGNTGAPDEIATRSILSAGERLPPIDT
Sbjct:    1 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTDIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLQKEIDDQKEEIKKFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDELKQKLKSTEKELKTERQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRKQGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKIVGMESGRLINTNTNNNGGNTGAPDEIATRSILSAGERLPPIDT 1239          
BLAST of cilia- and flagella-associated protein 57 vs. Planmine SMEST
Match: SMESG000072029.1 (SMESG000072029.1)

HSP 1 Score: 2449.08 bits (6346), Expect = 0.000e+0
Identity = 1232/1239 (99.44%), Postives = 1233/1239 (99.52%), Query Frame = 1
Query:   31 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLXXXXXXXXXXXXXFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDXXXXXXXXXXXXXXXXRQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRKQGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKIVGMESGRLIXXXXXXXXXXXXAPDEIATRSILSAGERLPPIDT 3747
            MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACT+IHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLQKEIDDQKEEIKKFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDELKQKLKSTEKELKTERQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDV      TSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRKQGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKIVGMESGRLINTNTNNNGGNTGAPDEIATRSILSAGERLPPIDT
Sbjct:    1 MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTDIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCKECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPLTKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSKELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALEELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTKIKYERRLREERESNARLKGETGIMKKKFASLQKEIDDQKEEIKKFQTETQKLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFVLDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDELKQKLKSTEKELKTERQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIVALYKKHIQEDV------TSEASVDADIQKEFTRQREHLERSVASLRKKLSKDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRKQGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKIVGMESGRLINTNTNNNGGNTGAPDEIATRSILSAGERLPPIDT 1233          
BLAST of cilia- and flagella-associated protein 57 vs. Planmine SMEST
Match: SMESG000027261.1 (SMESG000027261.1)

HSP 1 Score: 103.219 bits (256), Expect = 1.212e-21
Identity = 169/750 (22.53%), Postives = 318/750 (42.40%), Query Frame = 1
Query:   52 LKHVFGFR-VGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNL----KNFG-ILKVESQNFLCHTWVSDERVIL--GTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEY--YKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQ--LELYKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCK-----ECAFSYG-GHYFA-AVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDKKLI--SCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPL-TKPGEWQEYLGHSAQITKMKITPNDDYLVTISD-DCVVMIWRVQDKEGRSVKRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMNYNEKI-KELTEKFIQEMESLKTKNQVLKTEKDKE 2229
            L+ V G+R       I Y     +V+   +  ++ NI  ++Q+F +    +  +  + + P +  +A  E   E  P I ++D  +M+    L           ++ FS D K LA      + LL+ W W K ++LASTR    A    +  I ++P ++ Q+ A+G  F + +             FG + K+++Q  LC  +  ++  +   G+ +G L+ +    I     L +++++ E                  I +  KGF      G +   ++T  K +  YK   E L P             Q+++  C  P+  ++V      ++ + T SS EI ++       +L       ++ GL +   K I AT + D  + IW  E +   L   K+    A    +   G  + VGF D     + L+  + +  E +    +     +  FS   G Y A   H N + IYS  + + +   KG +  I ++ W+TD K L+  S   +   +E    T +   ++ ++   +   S    G +   +   K   +I+D             + +V+L++ G++L  G + G ++ F++P  TK  ++++YLGHSA +T ++   ND+YL+++   D  +M+W    K  R     +D    ++I + +SDL +   T +E     D   +E E  +      Y+E++ ++ TE    ++ S  T N  LK    +E
Sbjct:  675 LEWVHGYRGYDCRNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYA--SHNDDILCLGLHPLKDLIATGEVGRE--PTIHVWDTQTMKSVSILKGEH--ERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTR----AHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVGGGFTTKRGTFGNVAKLDTQ--LCAAYNPNKPGVCYTGSPSG-LVYIWKDNI-----LQSAVMMHEGG-------------CYAIDALDKGFVTGGKDGTIKLCDETFTKVHKSYKLSPENLQP------------QQMLSSAC--PTIRSVVLGKG--KILAST-SSGEIMELSTDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPARCCDISCDGSAVAVGFKDG----SFLVLSLTSLGEIASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSVCKGCSSYITHLDWSTDGKLLMVNSGAKEQLFFEAPRGTRQIIAKTEIEKIIWASWSCVL-GDSCIGIWPPKC--DITD-------------INSVSLTSDGKVLATGDDFGRVKLFEYPSKTKFAKFKQYLGHSAHVTNVRWLHNDEYLLSVGGADTALMVW----KHRRDPVPLEDSINNKKINMPQSDLSD---TDSEEENGFDS-DVEREKSMDYIAKTYSERLNQQQTESLKPDLVSQTTSNNNLKASVSRE 1348          

HSP 2 Score: 78.5666 bits (192), Expect = 3.278e-14
Identity = 145/679 (21.35%), Postives = 262/679 (38.59%), Query Frame = 1
Query:   52 LKHVFGFRVG-VNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKN----FG-------ILKVE---SQNFLCHT---------WVSD--ERVILGTDTGKLILVEN---GEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSIALHPSGLYILVGFSDK----LRLMNIL-IDDIRTFKEFSIRGCKECAFSYGGHYFA-AVHSNLIQIY-STTNFEVVMSLKGHNGKIRNVVWTTDDKKLISCGMDGAVYEWDTNTGKRCGESVL----KSCSYTGISVTQDGKNTYAVGTDKTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFP-LTKPGEWQEYLGHSAQITKMKITPNDDYLVTI-SDDCVVMIWRVQD 1962
            L  V+G+R    +  + Y N + +VY      ++Y+I QR Q +    E +  + ++A++ +   VA  +      P I I++ NS+  K  L       +  +S++FS +  YL      P+  L  W W+K K L+STR  S     +   +S  P    +    G    K +    N L +    +G       IL V    S N +C++         W  +  ERVI    +G L  +E+   G +    +    L   E Q +      L N+    ++  S           VHW                     SN+   G   + II     +P++                      + M  H+  EL +   H           +K I AT + D S+RIW     +        ++  S   +  G  I +G  D     +R  +++ + + +  KE       E  FS  GH+ A   + N + IY +T +F+     KG++  I ++ W+ D   + +      +  +    G+   ++ L    K   +TG+ +  D +  +A  TD             ++ + DV L       +  ++  G + G ++ F +P  TK   +++Y GHSA +T ++ + +  +L++I   D  +  WR+ D
Sbjct:   13 LDWVYGYRGHQCHNNLFYTNSEKIVYFVAGIGIVYDIKQRKQFYY--FEHNDDIISLALASDGELVATGQVGKS--PFICIWNSNSLETKSILKDQH--THGISSVAFSKNGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGP---IKFVTCGIKHIKFWSLCGNTLSSKKGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIATVHSGALYSIESCASGYVTGGKDSCVVLHDPEFQPMTRIDLKLTNIGYPNLIVRS-----------VHWL--------------------SNNVLVGTQGSDIIEIPVSTPNKPK--------------------SLMMGHAAGELWALGVH----------PKKSIFATGSDDCSLRIWQMNEREPLTTLRIDKKIRSCGFNHDGSLIAIGIMDGSFSVIRTRDMIEVHNAQDRKEV----LHELKFSPDGHWLAVGSNDNFVDIYDATASFKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPGGEHITQTQLLTSIKWAMFTGV-LGTDIQGIWAKYTDT-----------NDINAADVNL-------NANLIATGDDFGLVKLFNYPSPTKGAHFRKYTGHSAHVTNVRWSFDKKFLISIGGGDQSIFQWRLTD 598          
BLAST of cilia- and flagella-associated protein 57 vs. Planmine SMEST
Match: SMESG000022927.1 (SMESG000022927.1)

HSP 1 Score: 79.337 bits (194), Expect = 2.003e-14
Identity = 94/450 (20.89%), Postives = 189/450 (42.00%), Query Frame = 1
Query:   52 LKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSE--------NNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGL-GKVH-W-FEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCI-----SPSEETIV--ACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSI-----ALHPSGLYILVGFSDK-LRLMNI 1329
            L H FG+       +A  ++QTL Y  G+ +   N+   S  ++  L     +  MA+ P + Y+A+ E  S+  PV  IY+  S++  + L   +     ++   F+   + LA   S PD++L  W W+  +    T L S A +  + +++++      +   G    + ++ ++         ++  FG  K E  +      + D +V+ G++ G + LV +GE+         + +    K   + G +N + +       +G  +  G  GK++ W FE  D  E  +++            DP  ++  + ND  +     SP  E+ +  A     +++   LS +  +   +  N      +FH  +I   D+     + A+   D S+R++++   +L    +F  E   I      + P G  ++ GF D  +R++N 
Sbjct:   96 LAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSL-SGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILR--DGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQ----TVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFG--KTEISDIEGFVVLPDGKVLSGSEWGNM-LVWDGEL-------IKVQIGRKNKKPCHSGTINQIII------EEGELMTLGTDGKINTWDFETIDTAEVAEEMATF-------EMDP-MNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILN------TFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNF 508          
BLAST of cilia- and flagella-associated protein 57 vs. Planmine SMEST
Match: SMESG000022927.1 (SMESG000022927.1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.357e-14
Identity = 95/450 (21.11%), Postives = 192/450 (42.67%), Query Frame = 1
Query:   52 LKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKFISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLSAPEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTSPAANFSVNQISFNPQDSTQICAIGNNFFKMFRYS--------ENNLKNFGILKVESQNFLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENNQGVLNNVQVTTIVSSSKGFAVACGL-GKVH-W-FEKTDDKEYYKKVREILIPVDSNSADPGKSQAQIINDMCI-----SPSEETIV--ACTNIHQLYSFTLSSTEITKMGDHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLELYKEFAEEAYSI-----ALHPSGLYILVGFSDK-LRLMNI 1329
            L H FG+       +A  ++QTL Y  G+ +   N+   S  ++  L     +  MA+ P + Y+A+ E  S+  PV  IY+  S++  + L   +     ++   F+   + LA   S PD++L  W W+  +    T L S A +  + +++++      +   G    + ++ +        + ++  FG  K E  +      + D +V+ G++ G + LV +GE+         + +    K   + G +N + +       +G  +  G  GK++ W FE  D  E  +++            DP  ++  + ND  +     SP  E+ +  A     +++   LS +  +     +  E+L+ +FH  +I   D+     + A+   D S+R++++   +L    +F  E   I      + P G  ++ GF D  +R++N 
Sbjct:   96 LAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSL-SGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILR--DGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQ----TVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFG--KTEISDIEGFVVLPDGKVLSGSEWGNM-LVWDGEL-------IKVQIGRKNKKPCHSGTINQIII------EEGELMTLGTDGKINTWDFETIDTAEVAEEMATF-------EMDP-MNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTS-----APPEILN-TFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNF 508          
The following BLAST results are available for this feature:
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CFAP570.000e+055.68cilia and flagella associated protein 57 [Source:H... [more]
CFAP570.000e+054.23cilia and flagella associated protein 57 [Source:H... [more]
CFAP570.000e+050.62cilia and flagella associated protein 57 [Source:H... [more]
CFAP575.003e-4448.52cilia and flagella associated protein 57 [Source:H... [more]
CFAP579.648e-3176.71cilia and flagella associated protein 57 [Source:H... [more]
back to top
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
snrp-40.16.194e-723.84Small Nuclear RibonucleoProtein homolog [Source:U... [more]
prp-41.684e-619.11Yeast PRP (Splicing factor) related [Source:UniPr... [more]
snrp-40.22.546e-625.43Small Nuclear RibonucleoProtein homolog [Source:U... [more]
gpb-27.357e-622.11Guanine nucleotide-binding protein subunit beta-2 ... [more]
back to top
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG43291.915e-14029.50gene:FBgn0034745 transcript:FBtr0071940[more]
CG34364.492e-922.62gene:FBgn0031229 transcript:FBtr0078119[more]
CG34364.492e-922.62gene:FBgn0031229 transcript:FBtr0340650[more]
Prp198.993e-825.15gene:FBgn0261119 transcript:FBtr0086723[more]
Wdr621.857e-625.56gene:FBgn0031374 transcript:FBtr0110882[more]
back to top
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cfap570.000e+050.05cilia and flagella associated protein 57 [Source:Z... [more]
cfap570.000e+051.70cilia and flagella associated protein 57 [Source:Z... [more]
eml16.193e-2122.29EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml16.361e-2122.29EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml16.446e-2122.29EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
back to top
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wrn0.000e+058.39Werner syndrome, RecQ helicase-like [Source:Xenbas... [more]
wrn0.000e+057.46Werner syndrome, RecQ helicase-like [Source:Xenbas... [more]
EML65.998e-1922.00echinoderm microtubule associated protein like 6 [... [more]
EML69.153e-1922.00echinoderm microtubule associated protein like 6 [... [more]
gucy1a25.641e-1220.56guanylate cyclase 1, soluble, alpha 2 [Source:Xenb... [more]
back to top
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cfap570.000e+055.71cilia and flagella associated protein 57 [Source:M... [more]
Cfap570.000e+055.71cilia and flagella associated protein 57 [Source:M... [more]
Cfap443.065e-1821.80cilia and flagella associated protein 44 [Source:M... [more]
Cfap443.065e-1821.80cilia and flagella associated protein 44 [Source:M... [more]
Cfap527.791e-1419.97cilia and flagella associated protein 52 [Source:M... [more]
back to top
BLAST of cilia- and flagella-associated protein 57 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96MR6|CFA57_HUMAN0.000e+055.68Cilia- and flagella-associated protein 57 OS=Homo ... [more]
sp|Q9D180|CFA57_MOUSE0.000e+055.71Cilia- and flagella-associated protein 57 OS=Mus m... [more]
sp|E9Q5M6|CFA44_MOUSE2.144e-1721.80Cilia- and flagella-associated protein 44 OS=Mus m... [more]
sp|A8ILK1|CFA52_CHLRE1.756e-1521.50Cilia- and flagella-associated protein 52 OS=Chlam... [more]
sp|Q8N1V2|CFA52_HUMAN1.635e-1320.80Cilia- and flagella-associated protein 52 OS=Homo ... [more]
back to top
BLAST of cilia- and flagella-associated protein 57 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|235086130.000e+066.72tr|A0A210Q048|A0A210Q048_MIZYE WD repeat-containin... [more]
gnl|BL_ORD_ID|172201000.000e+066.61tr|A0A3S0ZUG9|A0A3S0ZUG9_ELYCH Uncharacterized pro... [more]
gnl|BL_ORD_ID|211071280.000e+066.67tr|A0A2T7NNI4|A0A2T7NNI4_POMCA Uncharacterized pro... [more]
gnl|BL_ORD_ID|203463410.000e+067.27tr|A0A1S3IR34|A0A1S3IR34_LINUN cilia- and flagella... [more]
gnl|BL_ORD_ID|226656740.000e+065.47tr|A0A2C9K1G6|A0A2C9K1G6_BIOGL Uncharacterized pro... [more]
back to top
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cfap570.000e+051.50cilia and flagella associated protein 57 [Source:Z... [more]
CFAP570.000e+051.08cilia and flagella associated protein 57 [Source:H... [more]
cfap570.000e+055.32cilia and flagella associated protein 57 [Source:Z... [more]
eml18.372e-2322.86EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml11.385e-2222.55EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
back to top
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001632.11.111e-1122.53pep scaffold:Pmarinus_7.0:GL476536:457691:473572:-... [more]
cfap521.933e-1019.91cilia and flagella associated protein 52 [Source:Z... [more]
ENSPMAT00000005742.14.350e-920.50pep scaffold:Pmarinus_7.0:GL478452:1315:31647:1 ge... [more]
POC1A7.680e-919.58POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
mapkbp11.674e-823.67mitogen-activated protein kinase binding protein 1... [more]
back to top
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TUP16.617e-825.23General repressor of transcription; forms complex ... [more]
UTP137.279e-725.95Nucleolar protein; component of the small subunit ... [more]
LST85.089e-622.00Protein required for the transport of Gap1p; requi... [more]
back to top
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360680.000e+061.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360692.853e-5470.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484871.246e-2123.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480103.075e-1520.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497671.933e-1222.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cilia- and flagella-associated protein 57 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cfap570.000e+043.60cilia and flagella associated protein 57 [Source:N... [more]
cfap570.000e+041.78cilia and flagella associated protein 57 [Source:N... [more]
eml24.818e-1921.81EMAP like 2 [Source:NCBI gene;Acc:101162059][more]
eml26.083e-1921.81EMAP like 2 [Source:NCBI gene;Acc:101162059][more]
ENSORLT00000018745.21.066e-1124.03cilia and flagella associated protein 44 [Source:N... [more]
back to top
BLAST of cilia- and flagella-associated protein 57 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072029.10.000e+099.92SMESG000072029.1[more]
SMESG000072029.10.000e+099.44SMESG000072029.1[more]
SMESG000027261.11.212e-2122.53SMESG000027261.1[more]
SMESG000022927.12.003e-1420.89SMESG000022927.1[more]
SMESG000022927.14.357e-1421.11SMESG000022927.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006820 ID=SMED30006820|Name=cilia- and flagella-associated protein 57|organism=Schmidtea mediterranea sexual|type=transcript|length=4184bp
AAATCTATATAAATCTTATATGCTGGAATAATGGCGATTGCAGCTGCTCA
TCTGAAGCATGTTTTTGGATTTAGAGTCGGTGTTAATGGAGCGATTGCAT
ATCAAAATGAGCAAACTCTTGTATATCCATGCGGTTCTAATTTGGTCATG
TATAATATCGACCAAAGATCGCAGAAGTTTATATCAGGATTGGAAAAATC
CCACAAAATGACTGCAATGGCAATCAGTCCAAATCGAAGATATGTTGCCT
TGGCAGAAACAACCTCCGAAGACAAGCCTGTGATTGTCATTTATGATCTT
AATTCGATGAGAAAGAAAAAAACTTTGTCAGCTCCTGAAATTCTGGCCAA
CGAATTCACAAGCATTTCATTCTCGCCCGATTCGAAATATTTGGCTGGCC
AAACTTCGGGCCCGGATTGGTTATTGATTTACTGGGCCTGGGAGAAAAGT
AAACAGTTGGCATCAACGAGATTGACTTCACCAGCTGCTAACTTTTCCGT
TAATCAAATTTCATTCAATCCCCAAGACAGCACCCAGATTTGTGCAATCG
GCAACAATTTCTTCAAGATGTTTCGCTACTCGGAGAACAACCTGAAAAAC
TTTGGTATTCTGAAAGTGGAATCACAAAACTTCCTCTGTCACACTTGGGT
GTCGGATGAGCGAGTGATCCTGGGCACGGACACGGGAAAACTGATCCTCG
TTGAGAACGGAGAAATCAGGACCGAGTTCAATCTGGCGGCCTCGCTAATT
TTGGAGGAGGCTCAGAAACTAGAAAACAACCAAGGTGTGTTAAATAATGT
CCAAGTAACGACAATTGTATCAAGTAGCAAAGGATTTGCTGTGGCGTGCG
GGTTAGGAAAGGTCCATTGGTTCGAAAAAACGGACGATAAGGAATATTAT
AAAAAGGTCCGTGAAATTCTAATTCCGGTCGATTCAAATAGTGCAGACCC
AGGGAAATCCCAGGCACAGATCATCAATGATATGTGCATAAGTCCGTCAG
AAGAAACAATAGTTGCGTGCACCAATATCCATCAGTTGTATTCCTTTACT
CTCTCTTCAACAGAGATCACGAAAATGGGCGATCATTCGAATTTCGAATT
GCTGTCGTATTCTTTTCACTACTCTCAAATCCTCGGGCTTGATCTCTGCC
GACGGAAACCCATAATCGCCACATGTGCTGTTGACAGATCAGTACGCATC
TGGAATTATGAAACCAACCAGCTGGAACTATATAAGGAGTTTGCTGAGGA
GGCCTACAGCATCGCCCTACATCCTTCTGGCCTTTATATCCTTGTTGGGT
TCAGTGATAAATTGAGACTGATGAACATCCTCATCGATGATATCCGCACC
TTCAAGGAGTTCTCAATCCGTGGTTGCAAGGAGTGTGCCTTCAGTTACGG
TGGTCATTACTTTGCAGCGGTCCACAGCAATCTCATTCAGATCTATTCTA
CCACCAACTTTGAGGTTGTCATGAGCCTGAAAGGGCACAACGGGAAAATT
CGCAACGTTGTTTGGACGACTGACGATAAGAAGCTGATTTCGTGTGGCAT
GGACGGAGCTGTATACGAGTGGGACACAAATACAGGGAAGCGATGTGGGG
AGAGTGTGCTCAAATCGTGCAGCTACACCGGTATCAGTGTCACACAGGAT
GGCAAGAACACGTACGCAGTTGGCACTGACAAAACGCTGAAGGAAATTTC
TGATTCGCAAGTTCTGAGGGAAGTGGAGAGTGTCGATGTACAATTGACCA
CGGTGACGCTGTCGAATTCTGGCCGTATGCTGTTCTGTGGTACCAATAAC
GGCTCGATACGGTCGTTCAAGTTTCCCCTGACCAAGCCGGGAGAATGGCA
GGAATATTTGGGGCATTCTGCTCAGATAACCAAGATGAAAATTACTCCTA
ATGACGATTATTTAGTAACGATATCCGATGACTGCGTCGTTATGATCTGG
AGAGTTCAGGATAAGGAAGGAAGGTCCGTAAAACGTGACAAGGATATTGG
TTGGGCTGAGGAAATCCTAATTACCAAGTCAGATTTGGAAGAAAAGAATG
CTACAATGGCGGAGTTGCGCACGAGAGTTGATGAACTGAAAATGGAAAAT
GAATATCAGTTGCGATTGAAGGACATGAATTATAATGAAAAGATCAAGGA
GCTTACGGAAAAGTTCATTCAGGAAATGGAATCATTGAAAACTAAAAACC
AAGTGCTGAAGACAGAGAAAGACAAAGAAGAGGCAAAGCACGAGGAACGG
TTGCATGAAATGATGGAAAAGCACAGCAAAGAATTGCAGGACATCGAGTC
GGCGAACAATCAGAAATTGATGCTAGAATACGAGAAATATCAGGAACTGC
AGGCGAAATCCCAGAGGATGCAGGAGGATTACGAGCGACAATTACAGGAA
CTCGAATCTCAGAAGGAACAAGCATTGGAAGAGCTGACAGAATATTACGA
AACGAAGCAGGCGGAAAAGTCGACAATCCTGGAAAATCTCAACAAAGATA
TGCGCGATCAAACGATGGAATACGAGGAAACCAAGCGATTGATCGAGGAG
GATGCGGATAGGGAAATCCTTGACACGAAGATTAAATACGAACGGCGGCT
TCGTGAGGAAAGGGAAAGCAATGCTCGATTGAAGGGAGAAACGGGAATCA
TGAAGAAGAAATTTGCAAGCCTCCAGAAAGAAATCGATGACCAAAAAGAG
GAGATTAAGAAATTCCAGACAGAAACGCAGAAATTGGAAAACGTTATTCG
AAATTTGGAGAAAGATAAAATCGGGTTGAAGAAAGAGATCCAGGAGAGAG
ACGAGACGATCCAGGACAAAGAGAAACGCATCTACGATTTGAAGAAGAAA
AATCAGGAGCTGGACAAATTCAAGTTTGTGCTCGATTACAAAATCAAGGA
GTTGAAAAAGCAAATTGAGCCTCGAGAATTGGAAATCCAATCGGCGAAAG
AACAAATACAAGAGATGGAGTCGGAATTGGAAAGGTTTCACAAGCAGAAT
AACCAACTGACACTCAATATTGATGAGCTGAAGCAGAAATTGAAGTCGAC
TGAGAAGGAACTGAAAACAGAACGGCAAGCAACAAGAGATGTGGAGGCCC
AAGTGCGACGATTCAAGACCGATTTATATAATTGCGTCAGTTACATTCAA
GATCCTAAAGGACTTAAAGAAAGCATTGTAGCATTATACAAGAAGCATAT
TCAGGAGGACGTGAGTGGAACACAGAAGCAGACCAGTGAGGCATCCGTTG
ATGCAGACATCCAAAAGGAATTCACTCGTCAACGGGAACATCTGGAACGT
TCCGTGGCATCTTTAAGAAAGAAATTGTCGAAAGATTCAGAAATTCACCG
AGCAGATTATGTCAGAATTATGCAGGAGAATGTCTCGCTTATCAAGGAAA
TAAACGATTTGCGAAAGGAACTGAAAAACAGCAGGACGTACAATCACGAT
CTGGAGGCCGCCCTGGGGCTACACCGGAAGCAGGGTGAAGCTGCTAGACA
ATTGGTTGCTGCGGTGACGGCCAATAAACCGCAACCGTTGGTGGAGAAGG
AACTCGAGGAAGCAGGGAGAGTAATGGAGATGCAGCGGGCGCTAATTGGT
CAATTGAGGGACAAAATTGTCGGCATGGAGAGCGGCCGGTTAATAAATAC
GAACACCAATAACAACGGTGGTAACACTGGGGCTCCAGATGAAATTGCTA
CCCGGTCAATCCTCAGTGCCGGAGAACGGCTGCCACCGATTGACACGTGA
TGAAGCGGATGGTTACTGCCTAGTACCGCCGAGATTGTGTTGCGGGGTTG
ATGTTGGTGATGCTAATGATGATAATAATATGTACTTTTGTCTTGTTGTT
GCTGTTGTTGCCGTTGGTGACGGTAATTTATTTGATTTCTTTCTGCAGGG
TCGATAATTACATATTGATTGACTTATTCATTGATTTGCATGTGCCAGTA
TTGATTATATTAGATTCCCTCCTTCCCCGAGTAGTATAGAATCCAGCTCA
CCTTGACCTCAATAACCTTTCAATGTCATCGCAATGTTCCTAAGGCTATG
TCAAGGTTAACAAATATAGGCTAATTGAAAAATCTGTTATACTTTTTATT
TGTATACTTTATTGAATTCATTACATTTTATTAATTAACTATTTTATTTT
AATTACCTTATTTAATTTTTTACTTTTTATTGCC
back to top

protein sequence of SMED30006820-orf-1

>SMED30006820-orf-1 ID=SMED30006820-orf-1|Name=SMED30006820-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1240bp
MAIAAAHLKHVFGFRVGVNGAIAYQNEQTLVYPCGSNLVMYNIDQRSQKF
ISGLEKSHKMTAMAISPNRRYVALAETTSEDKPVIVIYDLNSMRKKKTLS
APEILANEFTSISFSPDSKYLAGQTSGPDWLLIYWAWEKSKQLASTRLTS
PAANFSVNQISFNPQDSTQICAIGNNFFKMFRYSENNLKNFGILKVESQN
FLCHTWVSDERVILGTDTGKLILVENGEIRTEFNLAASLILEEAQKLENN
QGVLNNVQVTTIVSSSKGFAVACGLGKVHWFEKTDDKEYYKKVREILIPV
DSNSADPGKSQAQIINDMCISPSEETIVACTNIHQLYSFTLSSTEITKMG
DHSNFELLSYSFHYSQILGLDLCRRKPIIATCAVDRSVRIWNYETNQLEL
YKEFAEEAYSIALHPSGLYILVGFSDKLRLMNILIDDIRTFKEFSIRGCK
ECAFSYGGHYFAAVHSNLIQIYSTTNFEVVMSLKGHNGKIRNVVWTTDDK
KLISCGMDGAVYEWDTNTGKRCGESVLKSCSYTGISVTQDGKNTYAVGTD
KTLKEISDSQVLREVESVDVQLTTVTLSNSGRMLFCGTNNGSIRSFKFPL
TKPGEWQEYLGHSAQITKMKITPNDDYLVTISDDCVVMIWRVQDKEGRSV
KRDKDIGWAEEILITKSDLEEKNATMAELRTRVDELKMENEYQLRLKDMN
YNEKIKELTEKFIQEMESLKTKNQVLKTEKDKEEAKHEERLHEMMEKHSK
ELQDIESANNQKLMLEYEKYQELQAKSQRMQEDYERQLQELESQKEQALE
ELTEYYETKQAEKSTILENLNKDMRDQTMEYEETKRLIEEDADREILDTK
IKYERRLREERESNARLKGETGIMKKKFASLQKEIDDQKEEIKKFQTETQ
KLENVIRNLEKDKIGLKKEIQERDETIQDKEKRIYDLKKKNQELDKFKFV
LDYKIKELKKQIEPRELEIQSAKEQIQEMESELERFHKQNNQLTLNIDEL
KQKLKSTEKELKTERQATRDVEAQVRRFKTDLYNCVSYIQDPKGLKESIV
ALYKKHIQEDVSGTQKQTSEASVDADIQKEFTRQREHLERSVASLRKKLS
KDSEIHRADYVRIMQENVSLIKEINDLRKELKNSRTYNHDLEAALGLHRK
QGEAARQLVAAVTANKPQPLVEKELEEAGRVMEMQRALIGQLRDKIVGME
SGRLINTNTNNNGGNTGAPDEIATRSILSAGERLPPIDT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0005575cellular_component
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
IPR011047Quinoprotein_ADH-like_supfam
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 820..844
NoneNo IPR availableCOILSCoilCoilcoord: 770..811
NoneNo IPR availableCOILSCoilCoilcoord: 741..764
NoneNo IPR availableCOILSCoilCoilcoord: 1113..1147
NoneNo IPR availableCOILSCoilCoilcoord: 672..692
NoneNo IPR availableCOILSCoilCoilcoord: 958..1027
NoneNo IPR availableCOILSCoilCoilcoord: 881..929
NoneNo IPR availableCOILSCoilCoilcoord: 1081..1101
NoneNo IPR availableCOILSCoilCoilcoord: 705..739
NoneNo IPR availableCOILSCoilCoilcoord: 853..873
NoneNo IPR availablePANTHERPTHR32215FAMILY NOT NAMEDcoord: 11..1204
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 397..435
e-value: 34.0
score: 7.3
coord: 605..644
e-value: 0.0011
score: 28.2
coord: 95..139
e-value: 390.0
score: 0.6
coord: 561..600
e-value: 6.2
score: 12.0
coord: 479..518
e-value: 1.4E-6
score: 37.9
coord: 356..395
e-value: 0.016
score: 24.4
IPR001680WD40 repeatPFAMPF00400WD40coord: 360..395
e-value: 0.01
score: 16.7
coord: 611..643
e-value: 0.019
score: 15.8
coord: 482..518
e-value: 0.016
score: 16.0
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 363..404
score: 9.606
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 612..653
score: 11.879
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 486..527
score: 12.714
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 343..646
e-value: 2.1E-55
score: 189.9
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 20..307
e-value: 7.3E-35
score: 122.5
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 363..404
score: 9.441
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 486..653
score: 15.346
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 318..650
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 61..402