Chromodomain-helicase-DNA-binding protein

Overview
NameChromodomain-helicase-DNA-binding protein
Smed IDSMED30006818
Length (bp)4789
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chromodomain-helicase-DNA-binding protein (SMED30006818) t-SNE clustered cells

Violin plots show distribution of expression levels for Chromodomain-helicase-DNA-binding protein (SMED30006818) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chromodomain-helicase-DNA-binding protein (SMED30006818) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chromodomain-helicase-DNA-binding protein (SMED30006818) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006818

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30006818h1SMcG0006548 Contig30432newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006818h1SMcG0006548 Contig30432uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30006818h1SMcG0006548 dd_Smed_v4_2597_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006818h1SMcG0006548 dd_Smed_v4_2597_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006818h1SMcG0006548 dd_Smed_v4_2597_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30006818h1SMcG0006548 dd_Smed_v4_2597_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30006818h1SMcG0006548 dd_Smed_v4_2597_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006818h1SMcG0006548 dd_Smed_v4_2597_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neural progenitor cellSMED30006818h1SMcG0006548 dd_Smed_v6_2597_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30006818h1SMcG0006548 dd_Smed_v6_2597_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30006818h1SMcG0006548 dd_Smed_v6_2597_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30006818h1SMcG0006548 dd_Smed_v6_2597_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006818h1SMcG0006548 dd_Smed_v6_2597_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Human
Match: CHD2 (chromodomain helicase DNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:1917])

HSP 1 Score: 953.74 bits (2464), Expect = 0.000e+0
Identity = 532/1078 (49.35%), Postives = 708/1078 (65.68%), Query Frame = 2
Query:  656 VIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKN----------------SDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDE-ETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXX-XXXXXXXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVG----------QVNXXXXXXXXXDNKETGGK-----------------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKA-----------VFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
             IE+VL+ R+G  G TG  T+ Y      +  G+ D   DE E QYLIKW+ WS+IHSTWESE ++Q  Q   G+KKL  FK+ +   + W     SPED++    ++E    L +Q    ER+I  + +K+                S+  +YL KW  L Y   +WE   +I K  F N I  F  R+ S  IP R+C+AL +RP+F  +++QP YL    +++LRDYQL+G+NWLAH+W + NSVILADEMGLGKTIQTI FLSYLF+QH ++GPFL+VVPLST++SWQ EF IWAP +N+++Y GD +SR  IRE EW   + K LKF+  ITTYE+LLKDK  L  I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF  W DFE+ +      +  E     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV M   Q + YK ILT+NY+AL+K TRG TS FLNIVMELKKCCNH  L+ P +E E EN  +    L   I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL ++ + FQRLDGSIKG +RKQA+DHFNA+GS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K ++EE+IIE AK+KMVLDHLVIQRMD+     L   +  + + PF+K+EL  ILKFGA DLF + + E  E QE++I +IL+ AE T  ++ S +  ++LLS FKV N     ++E++    HK     W +I+P++ R+K++EEE QK L E+ + PR R   K  Q            Q   +S   SE ++ +   K                  TD EI+  IK  KKF  PLER++ I  +AE++D +  ++  + + I N C +   E + + K+N +              I  + ++VK+I+Q  ++ ++LH+ +P + EE+ K+ L    K A++   W  EDD+RLL+G++E G  NWE IK D +LKLT KILP    ++PQ   L+TR +YLLK LR
Sbjct:  262 TIEKVLDSRLGKKGATGASTTVYAIEANGDPSGDFDTEKDEGEIQYLIKWKGWSYIHSTWESEESLQQ-QKVKGLKKLENFKKKEDEIKQWLGK-VSPEDVEYFNCQQELASELNKQYQIVERVIAVKTSKSTLGQTDFPAHSRKPAPSNEPEYLCKWMGLPYSECSWEDEALIGKK-FQNCIDSFHSRNNSKTIPTRECKALKQRPRFVALKKQPAYLG-GENLELRDYQLEGLNWLAHSWCKNNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLIVVPLSTLTSWQREFEIWAPEINVVVYIGDLMSRNTIREYEWIHSQTKRLKFNALITTYEILLKDKTVLGSINWAFLGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFEFWEDFEEDHG-----KGRENGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVEMSALQKQYYKWILTRNYKALAKGTRGSTSGFLNIVMELKKCCNHCYLIKPPEENERENGQEI---LLSLIRSSGKLILLDKLLTRLRERGNRVLIFSQMVRMLDILAEYLTIKHYPFQRLDGSIKGEIRKQALDHFNADGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTILENNSGRSNSNPFNKEELTAILKFGAEDLFKELEGEESEPQEMDIDEILRLAE-TRENEVSTSATDELLSQFKVANFATMEDEEELEERPHKD----WDEIIPEEQRKKVEEEERQKELEEIYMLPRIRSSTKKAQTNDSDSDTESKRQAQRSSASESETEDSDDDKKPKRRGRPRSVRKDLVEGFTDAEIRRFIKAYKKFGLPLERLECIARDAELVDKSVADLKRLGELIHNSCVSAMQEYEEQLKENASEGKGPGKRRGPTIKISGVQVNVKSIIQHEEEFEMLHKSIPVDPEEKKKYCLTCRVKAAHFDVEWGVEDDSRLLLGIYEHGYGNWELIKTDPELKLTDKILPVETDKKPQGKQLQTRADYLLKLLR 1322          

HSP 2 Score: 58.9214 bits (141), Expect = 1.019e-7
Identity = 32/93 (34.41%), Postives = 51/93 (54.84%), Query Frame = 2
Query: 4013 FDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            F  C +RM+P+K  LK L+   +  G  ++   +   +CLL IG+ I   +  + + E  + WR  LW FV+ F + F    LH++YK A+KK
Sbjct: 1469 FSICKERMRPVKKALKQLDKPDK--GLNVQEQLEHTRNCLLKIGDRIAECLKAYSDQEHIKLWRRNLWIFVSKFTE-FDARKLHKLYKMAHKK 1558          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Human
Match: CHD2 (chromodomain helicase DNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:1917])

HSP 1 Score: 952.97 bits (2462), Expect = 0.000e+0
Identity = 532/1078 (49.35%), Postives = 708/1078 (65.68%), Query Frame = 2
Query:  656 VIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKN----------------SDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDE-ETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXX-XXXXXXXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVG----------QVNXXXXXXXXXDNKETGGK-----------------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKA-----------VFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
             IE+VL+ R+G  G TG  T+ Y      +  G+ D   DE E QYLIKW+ WS+IHSTWESE ++Q  Q   G+KKL  FK+ +   + W     SPED++    ++E    L +Q    ER+I  + +K+                S+  +YL KW  L Y   +WE   +I K  F N I  F  R+ S  IP R+C+AL +RP+F  +++QP YL    +++LRDYQL+G+NWLAH+W + NSVILADEMGLGKTIQTI FLSYLF+QH ++GPFL+VVPLST++SWQ EF IWAP +N+++Y GD +SR  IRE EW   + K LKF+  ITTYE+LLKDK  L  I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF  W DFE+ +      +  E     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV M   Q + YK ILT+NY+AL+K TRG TS FLNIVMELKKCCNH  L+ P +E E EN  +    L   I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL ++ + FQRLDGSIKG +RKQA+DHFNA+GS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K ++EE+IIE AK+KMVLDHLVIQRMD+     L   +  + + PF+K+EL  ILKFGA DLF + + E  E QE++I +IL+ AE T  ++ S +  ++LLS FKV N     ++E++    HK     W +I+P++ R+K++EEE QK L E+ + PR R   K  Q            Q   +S   SE ++ +   K                  TD EI+  IK  KKF  PLER++ I  +AE++D +  ++  + + I N C +   E + + K+N +              I  + ++VK+I+Q  ++ ++LH+ +P + EE+ K+ L    K A++   W  EDD+RLL+G++E G  NWE IK D +LKLT KILP    ++PQ   L+TR +YLLK LR
Sbjct:  262 TIEKVLDSRLGKKGATGASTTVYAIEANGDPSGDFDTEKDEGEIQYLIKWKGWSYIHSTWESEESLQQ-QKVKGLKKLENFKKKEDEIKQWLGK-VSPEDVEYFNCQQELASELNKQYQIVERVIAVKTSKSTLGQTDFPAHSRKPAPSNEPEYLCKWMGLPYSECSWEDEALIGKK-FQNCIDSFHSRNNSKTIPTRECKALKQRPRFVALKKQPAYLG-GENLELRDYQLEGLNWLAHSWCKNNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLIVVPLSTLTSWQREFEIWAPEINVVVYIGDLMSRNTIREYEWIHSQTKRLKFNALITTYEILLKDKTVLGSINWAFLGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFEFWEDFEEDHG-----KGRENGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVEMSALQKQYYKWILTRNYKALAKGTRGSTSGFLNIVMELKKCCNHCYLIKPPEENERENGQEI---LLSLIRSSGKLILLDKLLTRLRERGNRVLIFSQMVRMLDILAEYLTIKHYPFQRLDGSIKGEIRKQALDHFNADGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTILENNSGRSNSNPFNKEELTAILKFGAEDLFKELEGEESEPQEMDIDEILRLAE-TRENEVSTSATDELLSQFKVANFATMEDEEELEERPHKD----WDEIIPEEQRKKVEEEERQKELEEIYMLPRIRSSTKKAQTNDSDSDTESKRQAQRSSASESETEDSDDDKKPKRRGRPRSVRKDLVEGFTDAEIRRFIKAYKKFGLPLERLECIARDAELVDKSVADLKRLGELIHNSCVSAMQEYEEQLKENASEGKGPGKRRGPTIKISGVQVNVKSIIQHEEEFEMLHKSIPVDPEEKKKYCLTCRVKAAHFDVEWGVEDDSRLLLGIYEHGYGNWELIKTDPELKLTDKILPVETDKKPQGKQLQTRADYLLKLLR 1322          

HSP 2 Score: 58.9214 bits (141), Expect = 9.948e-8
Identity = 32/93 (34.41%), Postives = 51/93 (54.84%), Query Frame = 2
Query: 4013 FDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            F  C +RM+P+K  LK L+   +  G  ++   +   +CLL IG+ I   +  + + E  + WR  LW FV+ F + F    LH++YK A+KK
Sbjct: 1469 FSICKERMRPVKKALKQLDKPDK--GLNVQEQLEHTRNCLLKIGDRIAECLKAYSDQEHIKLWRRNLWIFVSKFTE-FDARKLHKLYKMAHKK 1558          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Human
Match: CHD1 (chromodomain helicase DNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:1915])

HSP 1 Score: 914.45 bits (2362), Expect = 0.000e+0
Identity = 511/1049 (48.71%), Postives = 689/1049 (65.68%), Query Frame = 2
Query:  671 LNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSL-DYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLD-EETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETG----GK------------------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVY--SECDTEEKKNK------AVFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            ++ RIG  G TG  T+ Y      +     + N +  E QYLIKW+ WSHIH+TWE+E T++  QN  GMKKL  +K+  +  + W K+ ASPED++    ++E  + L +Q    ERII     K++    DY  KW+ L Y   +WE G +I K  F   I E+  R++S   P + C+ L +RP+F  +++QP Y+     ++LRDYQL+G+NWLAH+W +GNS ILADEMGLGKTIQTI FL+YLF++H ++GPFLLVVPLST++SWQ E   WA  MN ++Y GD  SR +IR  EW   + K LKF++ +TTYE+LLKDK +L  ++WAF+GVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF++W DFE+ +      +  E   + L+K LEPFLLRR KKDVEKSLP+K EQI+R+ M   Q + YK ILT+NY+ALSK ++G TS FLNI+MELKKCCNH  L+ P D  E  NK +   HL   I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL  R + FQRLDGSIKG LRKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K S+EE I+E AK+KMVLDHLVIQRMD+     LH  +  + + PF+K+EL+ ILKFGA +LF + E  ++E +   I +IL+RAET  ++       ++LLS FKV N +    DED + +  +   K W +I+P+D R +++EEE QK L E+ + PR R   K             S      ++     GK                   +D EI+  IK  KKF  PLER+ +I  +AE++D +E ++  + + + NGC      S   TE    +        F I  + ++ K ++   ++L  LH+ +P + EER ++ +P  TK A++   W  EDD+ LL+G++E G  +WE IKMD DL LT KILP    ++PQA  L+TR +YL+K L
Sbjct:  278 MDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQ-QNVRGMKKLDNYKKKDQETKRWLKN-ASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKK-FQACIDEYFSRNQSKTTPFKDCKVLKQRPRFVALKKQPSYIGGHEGLELRDYQLNGLNWLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQTWASQMNAVVYLGDINSRNMIRTHEWTHHQTKRLKFNILLTTYEILLKDKAFLGGLNWAFIGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFSSWEDFEEEHG-----KGREYGYASLHKELEPFLLRRVKKDVEKSLPAKVEQILRMEMSALQKQYYKWILTRNYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKPPDNNEFYNKQEALQHL---IRSSGKLILLDKLLIRLRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGSVEEDILERAKKKMVLDHLVIQRMDTTGKTVLHTGSAPSSSTPFNKEELSAILKFGAEELFKEPEGEEQEPQEMDIDEILKRAETHENEPGPLTVGDELLSQFKVANFSNM--DEDDIELEPERNSKNWEEIIPEDQRRRLEEEERQKELEEIYMLPRMRNCAKQISFNGSEGRRSRSRRYSGSDSDSISEGKRPKKRGRPRTIPRENIKGFSDAEIRRFIKSYKKFGGPLERLDAIARDAELVDKSETDLRRLGELVHNGCIKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGSWEMIKMDPDLSLTHKILPDDPDKKPQAKQLQTRADYLIKLL 1313          

HSP 2 Score: 66.2402 bits (160), Expect = 6.055e-10
Identity = 35/101 (34.65%), Postives = 57/101 (56.44%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSE 4297
            E+    F  C +RM+P+K+ LK L+  ++    + +++      CL+ IG+HI   +  + N EQ +QWR  LW FV+ F + F    LH++YK A KK +
Sbjct: 1408 ELDQKTFSICKERMRPVKAALKQLDRPEKGLSEREQLE--HTRQCLIKIGDHITECLKEYTNPEQIKQWRKNLWIFVSKFTE-FDARKLHKLYKHAIKKRQ 1505          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Human
Match: CHD1 (chromodomain helicase DNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:1915])

HSP 1 Score: 914.45 bits (2362), Expect = 0.000e+0
Identity = 511/1049 (48.71%), Postives = 689/1049 (65.68%), Query Frame = 2
Query:  671 LNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSL-DYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLD-EETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETG----GK------------------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVY--SECDTEEKKNK------AVFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            ++ RIG  G TG  T+ Y      +     + N +  E QYLIKW+ WSHIH+TWE+E T++  QN  GMKKL  +K+  +  + W K+ ASPED++    ++E  + L +Q    ERII     K++    DY  KW+ L Y   +WE G +I K  F   I E+  R++S   P + C+ L +RP+F  +++QP Y+     ++LRDYQL+G+NWLAH+W +GNS ILADEMGLGKTIQTI FL+YLF++H ++GPFLLVVPLST++SWQ E   WA  MN ++Y GD  SR +IR  EW   + K LKF++ +TTYE+LLKDK +L  ++WAF+GVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF++W DFE+ +      +  E   + L+K LEPFLLRR KKDVEKSLP+K EQI+R+ M   Q + YK ILT+NY+ALSK ++G TS FLNI+MELKKCCNH  L+ P D  E  NK +   HL   I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL  R + FQRLDGSIKG LRKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K S+EE I+E AK+KMVLDHLVIQRMD+     LH  +  + + PF+K+EL+ ILKFGA +LF + E  ++E +   I +IL+RAET  ++       ++LLS FKV N +    DED + +  +   K W +I+P+D R +++EEE QK L E+ + PR R   K             S      ++     GK                   +D EI+  IK  KKF  PLER+ +I  +AE++D +E ++  + + + NGC      S   TE    +        F I  + ++ K ++   ++L  LH+ +P + EER ++ +P  TK A++   W  EDD+ LL+G++E G  +WE IKMD DL LT KILP    ++PQA  L+TR +YL+K L
Sbjct:  278 MDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQ-QNVRGMKKLDNYKKKDQETKRWLKN-ASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKK-FQACIDEYFSRNQSKTTPFKDCKVLKQRPRFVALKKQPSYIGGHEGLELRDYQLNGLNWLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQTWASQMNAVVYLGDINSRNMIRTHEWTHHQTKRLKFNILLTTYEILLKDKAFLGGLNWAFIGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFSSWEDFEEEHG-----KGREYGYASLHKELEPFLLRRVKKDVEKSLPAKVEQILRMEMSALQKQYYKWILTRNYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKPPDNNEFYNKQEALQHL---IRSSGKLILLDKLLIRLRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGSVEEDILERAKKKMVLDHLVIQRMDTTGKTVLHTGSAPSSSTPFNKEELSAILKFGAEELFKEPEGEEQEPQEMDIDEILKRAETHENEPGPLTVGDELLSQFKVANFSNM--DEDDIELEPERNSKNWEEIIPEDQRRRLEEEERQKELEEIYMLPRMRNCAKQISFNGSEGRRSRSRRYSGSDSDSISEGKRPKKRGRPRTIPRENIKGFSDAEIRRFIKSYKKFGGPLERLDAIARDAELVDKSETDLRRLGELVHNGCIKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGSWEMIKMDPDLSLTHKILPDDPDKKPQAKQLQTRADYLIKLL 1313          

HSP 2 Score: 66.2402 bits (160), Expect = 6.055e-10
Identity = 35/101 (34.65%), Postives = 57/101 (56.44%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSE 4297
            E+    F  C +RM+P+K+ LK L+  ++    + +++      CL+ IG+HI   +  + N EQ +QWR  LW FV+ F + F    LH++YK A KK +
Sbjct: 1408 ELDQKTFSICKERMRPVKAALKQLDRPEKGLSEREQLE--HTRQCLIKIGDHITECLKEYTNPEQIKQWRKNLWIFVSKFTE-FDARKLHKLYKHAIKKRQ 1505          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Human
Match: CHD2 (chromodomain helicase DNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:1917])

HSP 1 Score: 836.254 bits (2159), Expect = 0.000e+0
Identity = 455/838 (54.30%), Postives = 586/838 (69.93%), Query Frame = 2
Query:  656 VIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKN----------------SDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDE-ETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXX-XXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQV 3103
             IE+VL+ R+G  G TG  T+ Y      +  G+ D   DE E QYLIKW+ WS+IHSTWESE ++Q  Q   G+KKL  FK+ +   + W     SPED++    ++E    L +Q    ER+I  + +K+                S+  +YL KW  L Y   +WE   +I K  F N I  F  R+ S  IP R+C+AL +RP+F  +++QP YL    +++LRDYQL+G+NWLAH+W + NSVILADEMGLGKTIQTI FLSYLF+QH ++GPFL+VVPLST++SWQ EF IWAP +N+++Y GD +SR  IRE EW   + K LKF+  ITTYE+LLKDK  L  I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF  W DFE+ +      +  E     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV M   Q + YK ILT+NY+AL+K TRG TS FLNIVMELKKCCNH  L+ P +E E EN  +    L   I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL ++ + FQRLDGSIKG +RKQA+DHFNA+GS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K ++EE+IIE AK+KMVLDHLVIQRMD+     L   +  + + PF+K+EL  ILKFGA DLF + E  + E QE++I +IL+ AE T  ++ S +  ++LLS FKV N     ++E++    HK     W +I+P++ R+K++EEE QK L E+ + PR R   K  Q 
Sbjct:   53 TIEKVLDSRLGKKGATGASTTVYAIEANGDPSGDFDTEKDEGEIQYLIKWKGWSYIHSTWESEESLQQ-QKVKGLKKLENFKKKEDEIKQWLGK-VSPEDVEYFNCQQELASELNKQYQIVERVIAVKTSKSTLGQTDFPAHSRKPAPSNEPEYLCKWMGLPYSECSWEDEALIGKK-FQNCIDSFHSRNNSKTIPTRECKALKQRPRFVALKKQPAYLG-GENLELRDYQLEGLNWLAHSWCKNNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLIVVPLSTLTSWQREFEIWAPEINVVVYIGDLMSRNTIREYEWIHSQTKRLKFNALITTYEILLKDKTVLGSINWAFLGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFEFWEDFEEDHG-----KGRENGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVEMSALQKQYYKWILTRNYKALAKGTRGSTSGFLNIVMELKKCCNHCYLIKPPEENERENGQEI---LLSLIRSSGKLILLDKLLTRLRERGNRVLIFSQMVRMLDILAEYLTIKHYPFQRLDGSIKGEIRKQALDHFNADGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTILENNSGRSNSNPFNKEELTAILKFGAEDLFKELEGEESEPQEMDIDEILRLAE-TRENEVSTSATDELLSQFKVANFATMEDEEELEERPHKD----WDEIIPEEQRKKVEEEERQKELEEIYMLPRIRSSTKKAQT 873          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Celegans
Match: chd-1 (Chromodomain and Helicase Domain protein [Source:UniProtKB/TrEMBL;Acc:O17909])

HSP 1 Score: 881.708 bits (2277), Expect = 0.000e+0
Identity = 492/1047 (46.99%), Postives = 664/1047 (63.42%), Query Frame = 2
Query:  656 VIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQ--RNKNSD---SLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYL--SHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETG--------GKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKAV------------FTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLA-NWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLK 3700
             +E V+ +R G  G TG  T+ YN   K +   ND    D+TE+Q+ +KW  WSH+H+TWESE ++    N  G+KK+  + + QK  E+WK+  A  E ++  + E++  E L ++  + ER++  Q  R++ +D   + +YLIKW  L Y   TWE   ++     P  I  +  R  ++K PN+    L +RPKF      PD+L     S  KLRDYQL+G+NW+ +AW +GNS ILADEMGLGKTIQ+I  L+ LF+++ + GP+L+VVPLST+++WQ EF  WAP MN+++Y GD VSR +IR+ EW+    K +K +  +TTYE+LLKDK +L+ I WA L VDEAHRLKNDES LY  L  F  N +LLITGTP+ NSL+ELWALLHFIMP+KF+ W +FE  +N         + +S L+K LEPFLLRR KKDVEKSLP K+EQI+RV M   Q + YK ILTKNY  LSK  +G  + F+N+VMELKKCCNH  L    D   +   D    L+  +KSSGK++LLDKL+  LK+KGHRVLIFSQMV MLDI+ +YL LR +  QRLDGS++  LRKQA+DH+NA GSTDF FLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAM+RAHRIGQ + V++YR V K S+EE+I+E AKRK+VLDHLVIQRMD+     L +   A+ + PF K EL+ ILKFGA +LF + E  ++E E++I  IL  AET   ++E     N+LLS+FK  N     E++DI     +     W+ I+P++ R +I EEE  K L E+ L PRQRK+     + QV    +   +E+  +TG        G  T  EIK  IK  +KF  PL R++ I  +AE+ +H+  E+  +++ +   C     E D+ EK   A             F      +++K I +S  +L  LH+IL K++E +  F  P   KL   W   W   DD+ LL+GV++ G  +WEAIKMD  L L  KI     +++PQ  +L+ RV+YLLK
Sbjct:  196 TVERVIKWRHGVPGATGSATTCYNIADKGDP--NDQIPGDKTEQQFFVKWTGWSHLHNTWESENSL-ALMNAKGLKKVQNYVKKQKEVEMWKRS-ADKEYIEFFECEQQMAEELCEEYKKVERVVAHQTSRDRAADGSMATEYLIKWSGLPYSDCTWEDEKMVA----PEQIKAYYHRIENLKSPNKNSNVLRKRPKFEKFESMPDFLKTDGESTHKLRDYQLEGLNWMVYAWCKGNSSILADEMGLGKTIQSISLLASLFHRYDLAGPYLVVVPLSTMAAWQKEFAQWAPEMNLVVYMGDVVSRDMIRQYEWFVGGTKKMKINAILTTYEILLKDKAFLSSIDWAALLVDEAHRLKNDESLLYKSLTQFRFNHKLLITGTPLQNSLKELWALLHFIMPEKFDCWEEFETAHN-----ESNHKGISALHKKLEPFLLRRVKKDVEKSLPPKTEQILRVDMTAHQKQFYKWILTKNYRELSKGVKGSINGFVNLVMELKKCCNHASLTRQYDHIYD---DAQGRLQQLLKSSGKLILLDKLLCRLKDKGHRVLIFSQMVMMLDILQEYLQLRRFPSQRLDGSMRADLRKQALDHYNAPGSTDFAFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMSRAHRIGQTKTVNIYRLVTKGSVEEEIVERAKRKLVLDHLVIQRMDTTGKTVLSKNATASGSVPFDKQELSAILKFGAVELFKEKEGEEQEPEVDIDRILMGAETREAEEEVMK-ENELLSSFKYANFA-IDEEKDIAAATDE-----WAAIIPEEDRNRILEEERMKELAEMNLAPRQRKQ----PIPQVVEDDDGDDDEEEDDTGKKKKKKAVGNFTIPEIKRFIKSFRKFSMPLNRLEEIAQDAELEEHSTDEMKKLVESLSEACKKAADEFDSNEKNGDAGAAESEKKDIERKFKFHTCDVNLKQIERSHAELKPLHEIL-KSEETKTSFKPPANAKLQKGWDVDWSRPDDSALLLGVWKYGYGSWEAIKMDPTLGLADKIFIKDKTKKPQGKNLQVRVDYLLK 1214          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Celegans
Match: chd-3 (Chromodomain-helicase-DNA-binding protein 3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22516])

HSP 1 Score: 508.834 bits (1309), Expect = 9.233e-152
Identity = 296/717 (41.28%), Postives = 421/717 (58.72%), Query Frame = 2
Query:  782 ERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWK-----KHHASPEDLDAAQFEEERNESLLQQK-MECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEF---EERSRSVKIPN-----------------RKCEALTRRPKFAPI------REQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYF--------PKKKM------LKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEET---ENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLF 2785
            ER++ +KW+  ++    W SET +  Y  F  + ++   K   +   I++     +HH+   D D  +  E   +  ++ + M+  RII+      S   DYL+KWK L Y ++TWE  D  + N + + II++    ER  + ++P                  ++ E  +RR K   I        QPD++S T    L  YQL+G+NWL H W+ G   ILADEMGLGKT+Q++ FL  L  +    GPFL+  PLSTI +W+ E  +W P   ++ Y GD  SR VIRE E+ F        PK         LKFHV +T+YE +  DK  L+ I WA L VDEAHRLKN++S  +  L  ++   R+L+TGTP+ N+L EL+ LL+F+ PD+FN    F   ++        E+ + +L+ +L P +LRR K DV   +PSK E I+RV +   Q + YK ILT+N++AL+ +  G   S +NI+MELKKCCNH  L      E    +N M   S L   IK++GK +LL K++ +LK+ GHRVLIFSQM  MLDI+ D+  + G+ ++R+DGSI G  R+ AID +NA G+  F FLLSTRAGGLGINLATADTVII+DSDWNP ND+QA +RAHR+GQK +V +YRFV K S+EE+I   AK+KM+L HLV++           A   +  SK EL+++L++G  +LF
Sbjct:  424 EREFFVKWKYLAYWQCEWLSETLMDVY--FTALVRMYWRKVDSENPPIFEESTLSRHHS---DHDPYKLRERFYQYGVKPEWMQIHRIINHLSYAKSQQ-DYLVKWKELSYEHATWERDDTDIAN-YEDAIIKYWHHRERMLNDEVPRNVQKMIAKQREAKGLGPKEDEVTSRRKKREKIDILKKYEVQPDFISETGG-NLHPYQLEGINWLRHCWSNGTDAILADEMGLGKTVQSLTFLYTLMKEGHTKGPFLIAAPLSTIINWEREAELWCPDFYVVTYVGDRESRMVIREHEFSFVDGAVRGGPKVSKIKTLENLKFHVLLTSYECINMDKAILSSIDWAALVVDEAHRLKNNQSTFFKNLREYNIQYRVLLTGTPLQNNLEELFHLLNFLAPDRFNQLESFTAEFS----EISKEDQIEKLHNLLGPHMLRRLKADVLTGMPSKQELIVRVELSAMQKKYYKNILTRNFDALNVKNGGTQMSLINIIMELKKCCNHPYLFMKACLEAPKLKNGMYEGSAL---IKNAGKFVLLQKMLRKLKDGGHRVLIFSQMTMMLDILEDFCDVEGYKYERIDGSITGQQRQDAIDRYNAPGAKQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKGSVEERITSVAKKKMLLTHLVVR-------AGLGAKDGKSMSKTELDDVLRWGTEELF 1118          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Celegans
Match: let-418 (pep chromosome:WBcel235:V:5826833:5832866:1 gene:WBGene00002637.1 transcript:F26F12.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-418)

HSP 1 Score: 495.738 bits (1275), Expect = 7.112e-147
Identity = 295/713 (41.37%), Postives = 418/713 (58.63%), Query Frame = 2
Query:  782 ERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKE------IQKRREIWKKHHASPEDLDAAQFEEERNESLLQQK-MECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEF---EERSRSVKIPN--RKCEALTRRPKFAP---------------IRE----QPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYF--------PK-KKM-----LKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLF 2785
            ER++ +KW+  S+   +W SE  ++ +     M  LL +++       +    +  +HH+   D D  +  E   +  ++ + M+  RII+ Q    S   DYL+KWK L Y  +TWE  D  + N +   II++    E   +  IP   +K  A  R  K  P               IR+    QPDY++ T   KL  YQL+G+NWL H W+ G   ILADEMGLGKT+Q++ FL  L  +    GPFL+  PLSTI +W+ E   W P   ++ Y G   +R V+RE E+ F        PK  KM     +KFHV +T+YE +  DK  L+ I W  L VDEAHRLKN++S  +  L  +  + R+L+TGTP+ N+L EL+ LL+F+  ++FN    F   +N        E+ + +L+ +L P +LRR K DV   +PSKSE I+RV +   Q + YK ILT+N++AL+ +  G   S +N++MELKKCCNH  L    + E   + +        IK+SGK +LL K++ +LK+ GHRVLIFSQM RMLDI+ D     G+ ++R+DGSI G +R+ AID +NA G+  F FLLSTRAGGLGINLATADTVII+DSDWNP ND+QA +RAHR+GQK +V +YRFV K S+EEKI   AK+KM+L+HLV++        KT        SK EL+++L++G  +LF
Sbjct:  412 EREFFVKWKYLSYWQCSWVSEMLLEVHFR---MLILLYWRKNDSDAPPEFEESVTSRHHS---DNDPYKLRERFYQYGIKPEWMQIHRIINHQSYAKSQQ-DYLVKWKELSYDQATWERDDSNIAN-YEEAIIKYWQHRESKLNEDIPKNVQKMIAKHREAKGLPPKEDEKKKKKREKIDIRKKYEVQPDYVTETGG-KLHPYQLEGLNWLRHCWSNGTDAILADEMGLGKTVQSLTFLYSLMKEGHCKGPFLIAAPLSTIINWEREAEQWCPDFYVVTYVGLRDARVVLREHEFSFVEGAVRSGPKASKMKTTENMKFHVLLTSYETINMDKTILSSIEWGALVVDEAHRLKNNQSLFFKNLNEYTIHYRVLLTGTPLQNNLEELFHLLNFLSKERFNQLEAFTAEFN----EISKEDQIEKLHNLLGPHMLRRLKADVLTGMPSKSELIVRVELSAMQKKWYKNILTRNFDALNVKNGGTQMSLMNVLMELKKCCNHPYLFVKAELEAPKEKNGMYEGTALIKNSGKFVLLQKMLRKLKDGGHRVLIFSQMTRMLDIMEDLCEYEGYRYERIDGSIMGQMRQDAIDRYNAPGAQQFIFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKKSVEEKITSVAKKKMLLNHLVVRAGLGGKEGKT-------MSKTELDDVLRWGTEELF 1104          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Celegans
Match: chd-7 (Chromodomain and Helicase Domain protein [Source:UniProtKB/TrEMBL;Acc:O61845])

HSP 1 Score: 447.588 bits (1150), Expect = 5.996e-129
Identity = 297/820 (36.22%), Postives = 446/820 (54.39%), Query Frame = 2
Query:  575 GEKIDNECIEGSYDDQRMSEFI--------SEEVNVIEEVLNFRIGFVGNTGIETSYYNKVL--------------------KNEKYGNDDNNSDETER-----------QYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPK---------KKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQL-YNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKM---DPD------SHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGA-ADLFXXXXXXXXXXXXXIQDILQRAETT 2857
             +  D   +EG+  D    EF+             V+E++LN R+G V     ET                             E  GN +++  +TE            Q+LIKW+  S++H  W               K   +  EI KR E   K     +     + +E+ N   +      +R++D     +      LIKWK+L Y   TWE  ++I     P   +E   R R V  P +  E   +RP+    ++        +   LR+YQ +GV+WL + +    + ILADEMGLGKT+QTI FLS +++ + I GPFL+VVPLSTI +W  EF  W   MN I+Y G A +R+V+++ E ++ K         K  +K    ITT+E ++ D ++L KI W    +DEAHRLKN   +L  N L+ F    R+L+TGTP+ N++ EL++LL+F+ P +F+    F +++     + + ++ V +L ++L+P +LRR K+DVEKSL  K E II V +   Q + Y+ IL +N+  L K T     S +N++MEL+KCCNH  L+N  +E   N      PD      +H +  I++SGK++L++KL+ +L++ GH+VLIFSQMV++LD++ ++L+   + F+R+DG+++G LR+ AID F+ E S  F FLL TRAGGLGINL  ADTVIIFDSDWNPQNDLQA AR HRIGQK+ V VYR +  N+ E ++ + A  K+ LD  V+Q   +AL  +  A      SK ++ E+LK GA   + +++ E  +  E +I+ ILQR   T
Sbjct:  949 ADPTDEAGVEGAKSDDEDDEFLMKIDTPAPDPNAMVVEKILNMRMGKVEKKVPETEVAEGSEENGEEKSEEKVKKEPKENGENGESVGNGESSKSKTESETNEIEEEEVEQFLIKWKGRSYVHCEW---------------KTAAELLEIDKRVEAKIKRFKVKKMSSYIEDDEDFNSDFVI----VDRVVDLITEDDGQEF-VLIKWKSLGYEEVTWEPIEMI-----PADKVELW-RERQVIDPAKIRE--KQRPEPEEWKKMSTSKVWKNGNSLREYQFEGVDWLLYCYYNAQNCILADEMGLGKTVQTITFLSRIYD-YGIHGPFLVVVPLSTIQNWVREFETWT-DMNAIVYHGSAYAREVLQQYEVFYDKRHCGAKNWKKNFVKIDALITTFETVVSDVEFLKKIPWRVCVIDEAHRLKNRNCKLLVNGLLAFRMEHRVLLTGTPLQNNIDELFSLLNFLHPQQFDNSATFLEQFG----SCQTDDQVQKLQEILKPMMLRRLKEDVEKSLGPKEETIIEVQLSDMQKKFYRAILERNFSHLCKGTSA--PSLMNVMMELRKCCNHPFLINGAEEAIMNDFRLAHPDWDEETLAH-KALIQASGKVVLIEKLLPKLRKDGHKVLIFSQMVKVLDLLEEFLISMSYPFERIDGNVRGDLRQAAIDRFSKENSDRFVFLLCTRAGGLGINLTAADTVIIFDSDWNPQNDLQAQARCHRIGQKKLVKVYRLITSNTYEREMFDKASLKLGLDKAVLQST-TALKAEGTA-----LSKKDVEELLKKGAYGSIMDEENESSKFNEEDIETILQRRTQT 1725          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Celegans
Match: isw-1 (Chromatin-remodeling complex ATPase chain isw-1 [Source:UniProtKB/Swiss-Prot;Acc:P41877])

HSP 1 Score: 422.935 bits (1086), Expect = 5.208e-127
Identity = 226/502 (45.02%), Postives = 326/502 (64.94%), Query Frame = 2
Query: 1283 KLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSR-QVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLF 2785
            ++RDYQ+ G+NWLA       + ILADEMGLGKT+QTI  + Y+ +      P L++VP ST+ +W  EF  W P +N ++  GD  +R QV+R+     P+K    F VC TTYE++LK K  L K++W ++ +DEAHR+KN++S+L   +   ++  RLLITGTP+ N+L ELWALL+F++PD F +  DF D +  ++      ++V  L+KVL+PFLLRR K DVEKSL  K E  + V + + Q E Y  +L K+ + ++   +   +  +NI+M L+KC NH  L +    E       D HL   + +SGKM++LDKL+ + KE+G RVLIFSQ  RMLD++ D+   R + + RLDGS     R  AI+ +NA  S  F F+L+TRAGGLGINLATAD VII+DSDWNPQ+DLQAM RAHRIGQK+QV V+R + +N+++E+IIE A+ K+ LD++VIQ+      R ++A K     K ++  +++ GA  +F
Sbjct:  131 EMRDYQVRGLNWLASLQHNKINGILADEMGLGKTLQTISMIGYMKHYKNKASPHLVIVPKSTLQNWANEFKKWCPSINAVVLIGDEAARNQVLRDV--ILPQK----FDVCCTTYEMMLKVKTQLKKLNWRYIIIDEAHRIKNEKSKLSETVRELNSENRLLITGTPLQNNLHELWALLNFLLPDIFTSSDDF-DSWFSNDAMSGNTDLVQRLHKVLQPFLLRRIKSDVEKSLLPKKEVKVYVGLSKMQREWYTKVLMKDIDIINGAGKVEKARLMNILMHLRKCVNHPYLFD--GAEPGPPFTTDQHL---VDNSGKMVVLDKLLMKFKEQGSRVLIFSQFSRMLDLLEDFCWWRHYEYCRLDGSTPHEDRSNAIEAYNAPDSKKFIFMLTTRAGGLGINLATADVVIIYDSDWNPQSDLQAMDRAHRIGQKKQVRVFRLITENTVDERIIEKAEAKLRLDNIVIQQ-----GRMSEAQKT--LGKGDMISMIRHGAEQVF 613          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Fly
Match: Chd1 (gene:FBgn0250786 transcript:FBtr0077674)

HSP 1 Score: 907.516 bits (2344), Expect = 0.000e+0
Identity = 496/1076 (46.10%), Postives = 683/1076 (63.48%), Query Frame = 2
Query:  668 VLNFRIGFVGNTGIETSYY----NKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKN------QPFSKDELNEILKFGAADLFXXXXXXXXXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNI-------TETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKA-------------------------YQVGQVNXXXXXXXXXDNKETGGK----LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKN--------------KAVFTIR--KIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
            +L  R G  G TG +T+ Y    N    +  +        ETE Q+LIKW+ WS+IH+TWESE T++  +   GMKKL  F + +K +  W+++ A PED+D  + + E    LL+     +RII      +  + +YL KW++L Y  STWE   ++++  +     +F +R  S   P+R C  +  RPKF+ I+ QP++LS  S + LRDYQ+DG+NWL H+W + NSVILADEMGLGKTIQTI FL  LF  H ++GPFL VVPLST+++WQ EF++WAP MN++ Y GD  SR++I++ EW F   K LKF+  +TTYE++LKDK +L  + WA L VDEAHRLKND+S LY  L  FDTN RLLITGTP+ NSL+ELWALLHFIMPDKF+TW +FE ++         ++  + L++ LEP++LRR KKDVEKSLP+K EQI+RV M   Q + YK ILTKN++AL K  RG TS+FLNIV+ELKKCCNH  L+ P + E    +  D  L+  +K SGK++LLDKL+  LKE GHRVLIFSQMVRMLD+++DYL  R + FQRLDGSIKG +R+QA+DHFNAEGS DFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQA ARAHRIGQK QV++YR V   S+EE+I+E AK+KMVLDHLVIQRMD+      D + N       PF+KD+L+ ILKFGA +LF  ++E D++   +I +IL+RAET N D E   PA+DLLSAFKV +I       +++   +D    G +   K W DI+P+  R+ I ++E  K + +L L PR++                              Y++G   S  +    +  + T  +     TD E++  I+  KKFP PL R+++I  +AE+ +    E+  + + + + C     E   EE K               +A F+++   +  + K +L    +L  L++I+P   EER ++    +T+   +   W  E+D +LL G+++ G+ +WE +K+D  LKLT KIL +  + +PQA  L+TR EYLLK ++
Sbjct:  323 ILAQRAGKRGCTGNQTTIYAIEENGFDPHAGFDEKQTPDAETEAQFLIKWKGWSYIHNTWESEATLRDMK-AKGMKKLDNFIKKEKEQAYWRRY-AGPEDIDYFECQLELQHELLKSYNNVDRIIAKGSKPDDGTEEYLCKWQSLPYAESTWEDAALVLRK-WQRCAEQFNDRESSKCTPSRHCRVIKYRPKFSRIKNQPEFLS--SGLTLRDYQMDGLNWLLHSWCKENSVILADEMGLGKTIQTICFLYSLFKIHHLYGPFLCVVPLSTMTAWQREFDLWAPDMNVVTYLGDIKSRELIQQYEWQFESSKRLKFNCILTTYEIVLKDKQFLGTLQWAALLVDEAHRLKNDDSLLYKSLKEFDTNHRLLITGTPLQNSLKELWALLHFIMPDKFDTWENFEVQHG-----NAEDKGYTRLHQQLEPYILRRVKKDVEKSLPAKVEQILRVEMTSLQKQYYKWILTKNFDALRKGKRGSTSTFLNIVIELKKCCNHAALIRPSEFELMG-LQQDEALQTLLKGSGKLVLLDKLLCRLKETGHRVLIFSQMVRMLDVLADYLQKRHFPFQRLDGSIKGEMRRQALDHFNAEGSQDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAQARAHRIGQKNQVNIYRLVTARSVEEQIVERAKQKMVLDHLVIQRMDTTGRTVLDKSGNGHSSNSNPFNKDDLSAILKFGAEELFKDEQEHDDDLVCDIDEILRRAETRNEDPEM--PADDLLSAFKVASIAAFEEEPSDSVSKQDQNAAGEEDDSKDWDDIIPEGFRKAIDDQERAKEMEDLYLPPRRKTAANQNEGKRGAGKGGKGKQQADDSGGDSDYELGSDGSGDDGRPRKRGRPTMKEKITGFTDAELRRFIRSYKKFPAPLHRMEAIACDAELQEKPLAELKRLGEMLHDRCVQFLHEHKEEESKTAATDETPGAKQRRARATFSVKLGGVSFNAKKLLACEQELQPLNEIMPSMPEERQQWSFNIKTRAPVFDVDWGIEEDTKLLCGIYQYGIGSWEQMKLDPTLKLTDKILLND-TRKPQAKQLQTRAEYLLKIIK 1384          

HSP 2 Score: 55.4546 bits (132), Expect = 4.890e-7
Identity = 33/94 (35.11%), Postives = 55/94 (58.51%), Query Frame = 2
Query: 4010 LFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            +F++C ++M+P+K  LK L+        + ++  +   DCLL IG  I  V LN   + +K++WR+ LW FV+ F ++  K  L +IYK A K+
Sbjct: 1509 IFNECKEKMRPVKKALKALDQPDVSLSDQDQL--QHTRDCLLQIGKQI-DVCLNPYAETEKKEWRSNLWYFVSKFTELDAKR-LFKIYKHALKQ 1598          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Fly
Match: Chd1 (gene:FBgn0250786 transcript:FBtr0331654)

HSP 1 Score: 907.131 bits (2343), Expect = 0.000e+0
Identity = 496/1076 (46.10%), Postives = 683/1076 (63.48%), Query Frame = 2
Query:  668 VLNFRIGFVGNTGIETSYY----NKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKN------QPFSKDELNEILKFGAADLFXXXXXXXXXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNI-------TETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKA-------------------------YQVGQVNXXXXXXXXXDNKETGGK----LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKN--------------KAVFTIR--KIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
            +L  R G  G TG +T+ Y    N    +  +        ETE Q+LIKW+ WS+IH+TWESE T++  +   GMKKL  F + +K +  W+++ A PED+D  + + E    LL+     +RII      +  + +YL KW++L Y  STWE   ++++  +     +F +R  S   P+R C  +  RPKF+ I+ QP++LS  S + LRDYQ+DG+NWL H+W + NSVILADEMGLGKTIQTI FL  LF  H ++GPFL VVPLST+++WQ EF++WAP MN++ Y GD  SR++I++ EW F   K LKF+  +TTYE++LKDK +L  + WA L VDEAHRLKND+S LY  L  FDTN RLLITGTP+ NSL+ELWALLHFIMPDKF+TW +FE ++         ++  + L++ LEP++LRR KKDVEKSLP+K EQI+RV M   Q + YK ILTKN++AL K  RG TS+FLNIV+ELKKCCNH  L+ P + E    +  D  L+  +K SGK++LLDKL+  LKE GHRVLIFSQMVRMLD+++DYL  R + FQRLDGSIKG +R+QA+DHFNAEGS DFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQA ARAHRIGQK QV++YR V   S+EE+I+E AK+KMVLDHLVIQRMD+      D + N       PF+KD+L+ ILKFGA +LF  ++E D++   +I +IL+RAET N D E   PA+DLLSAFKV +I       +++   +D    G +   K W DI+P+  R+ I ++E  K + +L L PR++                              Y++G   S  +    +  + T  +     TD E++  I+  KKFP PL R+++I  +AE+ +    E+  + + + + C     E   EE K               +A F+++   +  + K +L    +L  L++I+P   EER ++    +T+   +   W  E+D +LL G+++ G+ +WE +K+D  LKLT KIL +  + +PQA  L+TR EYLLK ++
Sbjct:  323 ILAQRAGKRGCTGNQTTIYAIEENGFDPHAGFDEKQTPDAETEAQFLIKWKGWSYIHNTWESEATLRDMK-AKGMKKLDNFIKKEKEQAYWRRY-AGPEDIDYFECQLELQHELLKSYNNVDRIIAKGSKPDDGTEEYLCKWQSLPYAESTWEDAALVLRK-WQRCAEQFNDRESSKCTPSRHCRVIKYRPKFSRIKNQPEFLS--SGLTLRDYQMDGLNWLLHSWCKENSVILADEMGLGKTIQTICFLYSLFKIHHLYGPFLCVVPLSTMTAWQREFDLWAPDMNVVTYLGDIKSRELIQQYEWQFESSKRLKFNCILTTYEIVLKDKQFLGTLQWAALLVDEAHRLKNDDSLLYKSLKEFDTNHRLLITGTPLQNSLKELWALLHFIMPDKFDTWENFEVQHG-----NAEDKGYTRLHQQLEPYILRRVKKDVEKSLPAKVEQILRVEMTSLQKQYYKWILTKNFDALRKGKRGSTSTFLNIVIELKKCCNHAALIRPSEFELMG-LQQDEALQTLLKGSGKLVLLDKLLCRLKETGHRVLIFSQMVRMLDVLADYLQKRHFPFQRLDGSIKGEMRRQALDHFNAEGSQDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAQARAHRIGQKNQVNIYRLVTARSVEEQIVERAKQKMVLDHLVIQRMDTTGRTVLDKSGNGHSSNSNPFNKDDLSAILKFGAEELFKDEQEHDDDLVCDIDEILRRAETRNEDPEM--PADDLLSAFKVASIAAFEEEPSDSVSKQDQNAAGEEDDSKDWDDIIPEGFRKAIDDQERAKEMEDLYLPPRRKTAANQNEGKRGAGKGGKGKQQADDSGGDSDYELGSDGSGDDGRPRKRGRPTMKEKITGFTDAELRRFIRSYKKFPAPLHRMEAIACDAELQEKPLAELKRLGEMLHDRCVQFLHEHKEEESKTAATDETPGAKQRRARATFSVKLGGVSFNAKKLLACEQELQPLNEIMPSMPEERQQWSFNIKTRAPVFDVDWGIEEDTKLLCGIYQYGIGSWEQMKLDPTLKLTDKILLND-TRKPQAKQLQTRAEYLLKIIK 1384          

HSP 2 Score: 55.4546 bits (132), Expect = 4.930e-7
Identity = 33/94 (35.11%), Postives = 55/94 (58.51%), Query Frame = 2
Query: 4010 LFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            +F++C ++M+P+K  LK L+        + ++  +   DCLL IG  I  V LN   + +K++WR+ LW FV+ F ++  K  L +IYK A K+
Sbjct: 1509 IFNECKEKMRPVKKALKALDQPDVSLSDQDQL--QHTRDCLLQIGKQI-DVCLNPYAETEKKEWRSNLWYFVSKFTELDAKR-LFKIYKHALKQ 1598          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Fly
Match: Chd1 (gene:FBgn0250786 transcript:FBtr0305980)

HSP 1 Score: 907.131 bits (2343), Expect = 0.000e+0
Identity = 496/1076 (46.10%), Postives = 683/1076 (63.48%), Query Frame = 2
Query:  668 VLNFRIGFVGNTGIETSYY----NKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKN------QPFSKDELNEILKFGAADLFXXXXXXXXXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNI-------TETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKA-------------------------YQVGQVNXXXXXXXXXDNKETGGK----LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKN--------------KAVFTIR--KIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
            +L  R G  G TG +T+ Y    N    +  +        ETE Q+LIKW+ WS+IH+TWESE T++  +   GMKKL  F + +K +  W+++ A PED+D  + + E    LL+     +RII      +  + +YL KW++L Y  STWE   ++++  +     +F +R  S   P+R C  +  RPKF+ I+ QP++LS  S + LRDYQ+DG+NWL H+W + NSVILADEMGLGKTIQTI FL  LF  H ++GPFL VVPLST+++WQ EF++WAP MN++ Y GD  SR++I++ EW F   K LKF+  +TTYE++LKDK +L  + WA L VDEAHRLKND+S LY  L  FDTN RLLITGTP+ NSL+ELWALLHFIMPDKF+TW +FE ++         ++  + L++ LEP++LRR KKDVEKSLP+K EQI+RV M   Q + YK ILTKN++AL K  RG TS+FLNIV+ELKKCCNH  L+ P + E    +  D  L+  +K SGK++LLDKL+  LKE GHRVLIFSQMVRMLD+++DYL  R + FQRLDGSIKG +R+QA+DHFNAEGS DFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQA ARAHRIGQK QV++YR V   S+EE+I+E AK+KMVLDHLVIQRMD+      D + N       PF+KD+L+ ILKFGA +LF  ++E D++   +I +IL+RAET N D E   PA+DLLSAFKV +I       +++   +D    G +   K W DI+P+  R+ I ++E  K + +L L PR++                              Y++G   S  +    +  + T  +     TD E++  I+  KKFP PL R+++I  +AE+ +    E+  + + + + C     E   EE K               +A F+++   +  + K +L    +L  L++I+P   EER ++    +T+   +   W  E+D +LL G+++ G+ +WE +K+D  LKLT KIL +  + +PQA  L+TR EYLLK ++
Sbjct:  340 ILAQRAGKRGCTGNQTTIYAIEENGFDPHAGFDEKQTPDAETEAQFLIKWKGWSYIHNTWESEATLRDMKA-KGMKKLDNFIKKEKEQAYWRRY-AGPEDIDYFECQLELQHELLKSYNNVDRIIAKGSKPDDGTEEYLCKWQSLPYAESTWEDAALVLRK-WQRCAEQFNDRESSKCTPSRHCRVIKYRPKFSRIKNQPEFLS--SGLTLRDYQMDGLNWLLHSWCKENSVILADEMGLGKTIQTICFLYSLFKIHHLYGPFLCVVPLSTMTAWQREFDLWAPDMNVVTYLGDIKSRELIQQYEWQFESSKRLKFNCILTTYEIVLKDKQFLGTLQWAALLVDEAHRLKNDDSLLYKSLKEFDTNHRLLITGTPLQNSLKELWALLHFIMPDKFDTWENFEVQHG-----NAEDKGYTRLHQQLEPYILRRVKKDVEKSLPAKVEQILRVEMTSLQKQYYKWILTKNFDALRKGKRGSTSTFLNIVIELKKCCNHAALIRPSEFELMG-LQQDEALQTLLKGSGKLVLLDKLLCRLKETGHRVLIFSQMVRMLDVLADYLQKRHFPFQRLDGSIKGEMRRQALDHFNAEGSQDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAQARAHRIGQKNQVNIYRLVTARSVEEQIVERAKQKMVLDHLVIQRMDTTGRTVLDKSGNGHSSNSNPFNKDDLSAILKFGAEELFKDEQEHDDDLVCDIDEILRRAETRNEDPEM--PADDLLSAFKVASIAAFEEEPSDSVSKQDQNAAGEEDDSKDWDDIIPEGFRKAIDDQERAKEMEDLYLPPRRKTAANQNEGKRGAGKGGKGKQQADDSGGDSDYELGSDGSGDDGRPRKRGRPTMKEKITGFTDAELRRFIRSYKKFPAPLHRMEAIACDAELQEKPLAELKRLGEMLHDRCVQFLHEHKEEESKTAATDETPGAKQRRARATFSVKLGGVSFNAKKLLACEQELQPLNEIMPSMPEERQQWSFNIKTRAPVFDVDWGIEEDTKLLCGIYQYGIGSWEQMKLDPTLKLTDKILLND-TRKPQAKQLQTRAEYLLKIIK 1401          

HSP 2 Score: 55.4546 bits (132), Expect = 5.237e-7
Identity = 33/94 (35.11%), Postives = 55/94 (58.51%), Query Frame = 2
Query: 4010 LFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            +F++C ++M+P+K  LK L+        + ++  +   DCLL IG  I  V LN   + +K++WR+ LW FV+ F ++  K  L +IYK A K+
Sbjct: 1526 IFNECKEKMRPVKKALKALDQPDVSLSDQDQL--QHTRDCLLQIGKQI-DVCLNPYAETEKKEWRSNLWYFVSKFTELDAKR-LFKIYKHALKQ 1615          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Fly
Match: Chd3 (gene:FBgn0023395 transcript:FBtr0074998)

HSP 1 Score: 500.745 bits (1288), Expect = 1.120e-156
Identity = 296/737 (40.16%), Postives = 426/737 (57.80%), Query Frame = 2
Query:  776 ETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSV---KIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPK---------KKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLFX-XXXXXXXXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDED 2947
            E  R+Y IKW   S+ H  W  E  +  +               Q+R ++ +      +D D    E      +  + +  +R+I+     N  ++ YL+KW+ L Y  S+WE     +  L  N  I   ++ RS    +  +R    +    K+    +QP +L   + +KL  +Q++GV+WL ++W +G   ILADEMGLGKTIQT+ FL  LF +    GPFL+ VPLST+++W+ E  +WAP +  + Y G   +R VIR+ E  F +         +   KF+V +T+YE +  D  +L  I WA L VDEAHRL++++S+ +  L  +    +LL+TGTP+ N+L EL+ LL+F+   KFN    F+  +     +   EE V  L+++LEP +LRR K DV KS+P KSE I+RV +   Q + YK ILTKN++AL+++  G   S LNI+M+L+KCCNH  L     EE          +    K+SGK+ LL K++ +LK   HRVL+FSQM +ML+++  +L   G+ + R+DGSIKG LR++AID FN   S  F FLLSTRAGGLGINLATADTVIIFDSDWNP ND+QA +RAHR+GQK++V +YRFV  NS+EE+I++ AK KM+L HLV+        R         FSKDEL +IL+FG  DLF     E     +  + D+L R  T    +E  + AN+ LS+FKV +   T ED +
Sbjct:  108 EKRREYFIKWHGMSYWHCEWIPEGQMLLHH-------ASMVASFQRRSDMEEPSLEELDDQDGNLHERFYRYGIKPEWLLVQRVINHSEEPNGGTM-YLVKWRELSYNDSSWERESDSIPGL--NQAIALYKKLRSSNKGRQRDRPAPTIDLNKKY---EDQPVFLKE-AGLKLHPFQIEGVSWLRYSWGQGIPTILADEMGLGKTIQTVVFLYSLFKEGHCRGPFLISVPLSTLTNWERELELWAPELYCVTYVGGKTARAVIRKHEISFEEVTTKTMRENQTQYKFNVMLTSYEFISVDAAFLGCIDWAALVVDEAHRLRSNQSKFFRILSKYRIGYKLLLTGTPLQNNLEELFHLLNFLSSGKFNDLQTFQAEFT----DVSKEEQVKRLHEILEPHMLRRLKADVLKSMPPKSEFIVRVELSSMQKKFYKHILTKNFKALNQKGGGRVCSLLNIMMDLRKCCNHPYLFPSAAEEATISPSGLYEMSSLTKASGKLDLLSKMLKQLKADNHRVLLFSQMTKMLNVLEHFLEGEGYQYDRIDGSIKGDLRQKAIDRFNDPVSEHFVFLLSTRAGGLGINLATADTVIIFDSDWNPHNDVQAFSRAHRMGQKKKVMIYRFVTHNSVEERIMQVAKHKMMLTHLVV--------RPGMGGMTTNFSKDELEDILRFGTEDLFKDGKSEAIHYDDKAVADLLDR--TNRGIEEKESWANEYLSSFKVASYA-TKEDHE 815          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Fly
Match: Mi-2 (gene:FBgn0262519 transcript:FBtr0100394)

HSP 1 Score: 514.998 bits (1325), Expect = 7.860e-153
Identity = 309/778 (39.72%), Postives = 450/778 (57.84%), Query Frame = 2
Query:  767 NSDETERQYLIKWREWSHIHSTWESET--------TVQTYQNFDGMKKLLKFKE------IQKRREIWKKHHASPEDLDAAQFEEER--NESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIP------------------------NRKCEALTRRPKFAPI------REQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKM------------LKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXX--XXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVN 2920
            NS+   R+Y IKW   S+ H  W  E          ++++Q    M++  KF+E       + +R    K     +  D A+  EER     +  + +  +R+I+ +  ++  ++ YL+KW+ L Y  STWE     ++ L     I++ +  R+V                           +R  +  T  P+           +QP +L  T  M+L  YQ++G+NWL ++W +G   ILADEMGLGKTIQT+ FL  L+ +    GPFL+ VPLST+ +W+ EF +WAP    I Y GD  SR VIRE E  F +  +             KF+V +T+YEL+  D   L  I WA L VDEAHRLK+++S+ +  L ++    +LL+TGTP+ N+L EL+ LL+F+  DKFN    F+  +     +   EE V  L+++L P +LRR K DV K++PSKSE I+RV +   Q + YK ILTKNYEAL+ ++ G + S +NI+M+LKKCCNH  L     EE          +    K++GK++LL K++ +LK + HRVLIFSQM +MLDI+ D+L    + ++R+DG I G+LR++AID FNA G+  F FLLSTRAGGLGINLATADTVII+DSDWNP ND+QA +RAHRIGQ  +V +YRFV +NS+EE++ + AKRKM+L HLV+        R     K   F+K EL++IL+FG  DLF +D++ +     +  + ++L R  T    +E  + AN+ LS+FKV +
Sbjct:  516 NSNSRVREYFIKWHNMSYWHCEWVPEVQLDVHHPLMIRSFQRKYDMEEPPKFEESLDEADTRYKRIQRHKDKVGMKANDDAEVLEERFYKNGVKPEWLIVQRVINHRTARDGSTM-YLVKWRELPYDKSTWEEEGDDIQGL--RQAIDYYQDLRAVCTSETTQSRSKKSKKGRKSKLKVEDDEDRPVKHYTPPPEKPTTDLKKKYEDQPAFLEGTG-MQLHPYQIEGINWLRYSWGQGIDTILADEMGLGKTIQTVTFLYSLYKEGHCRGPFLVAVPLSTLVNWEREFELWAPDFYCITYIGDKDSRAVIRENELSFEEGAIRGSKVSRLRTTQYKFNVLLTSYELISMDAACLGSIDWAVLVVDEAHRLKSNQSKFFRILNSYTIAYKLLLTGTPLQNNLEELFHLLNFLSRDKFNDLQAFQGEF----ADVSKEEQVKRLHEMLGPHMLRRLKTDVLKNMPSKSEFIVRVELSAMQKKFYKFILTKNYEALNSKSGGGSCSLINIMMDLKKCCNHPYLFPSAAEEATTAAGGLYEINSLTKAAGKLVLLSKMLKQLKAQNHRVLIFSQMTKMLDILEDFLEGEQYKYERIDGGITGTLRQEAIDRFNAPGAQQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRNSVEERVTQVAKRKMMLTHLVV--------RPGMGGKGANFTKQELDDILRFGTEDLFKEDDKEEAIHYDDKAVAELLDR--TNRGIEEKESWANEYLSSFKVAS 1275          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Zebrafish
Match: chd1 (chromodomain helicase DNA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7120])

HSP 1 Score: 975.696 bits (2521), Expect = 0.000e+0
Identity = 525/1063 (49.39%), Postives = 702/1063 (66.04%), Query Frame = 2
Query:  644 EEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSL-DYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDE-ETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDN---------------------------KETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSE--CDTEEKKNK------AVFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            +E   +E V+  RIG  G TG  T+ Y      +   N D N    E QYLIKW+ WSHIH+TWE+E T++  QN  GMKKL  FK+ ++ ++ W K  ASPED++    ++E  + L  Q    ERII     K++    DYL KW+ L Y   +WE G +I K  F   I E+  R++   IP+R C+ L +RP+F P+++QP Y+     ++LRDYQLDG+NW+AH+W +GNS ILADEMGLGKTIQTI FL+YLF++H ++GPFLLVVPLST++SWQ E  +WAP MN+++Y GD  SR +IR  EW  P+ K LK ++ +TTYE+LLKDK +L  +SWAF+GVDEAHRLKND+S LY  +I F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF++W  FE+ +      +  +   + L+K LEPFLLRR KKDVEKSLP+K EQI+RV M   Q + YK ILT+NY+ALSK T+G TS FLNI+MELKKCCNH  L+ P D+ E  N+ +   HL   ++SSGK++LLDKL+  LKE+GHRVLIFSQMVRMLDI+++YL  R + FQRLDGSIKG +RKQA+DHFNA+GS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K S+EE+IIE AK+KMVLDHLVIQRMD+     LH     + + PF+K+EL+ ILKFGA +LF + E  ++E +   I +IL+RAET  +D        +LLS FKV N +   EDE+I     +   + W DI+P+D R +++EEE QK L E+ L PR RK  K     Q+N    E     N                           +E     TD EI+  IK  KKF  PLER+ +I  +AE++D +E ++  + + + NGC     E  C  E    +        F I  + ++ K ++   ++L  LH+ +P + EER ++++P  +K A++   W  EDD+ LL+G++E G  +WE IKMD DL LT K+LP    ++PQA  L+TR +YL+K L
Sbjct:  257 DEFETLERVMEMRIGRKGVTGAVTTVYAVEADGDPNANFDPNRQPGEVQYLIKWKNWSHIHNTWETEETLKQ-QNVKGMKKLDNFKKKEQEKKKWLKA-ASPEDVEYFNCQQELMDDLHSQYQLVERIIGHSNQKSAAGYPDYLCKWQGLPYSECSWEDGALISKK-FQKCIDEYMSRNQCKTIPSRDCKVLKQRPRFVPMKKQPHYIG-GEGLELRDYQLDGLNWMAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQLWAPLMNVVVYLGDINSRNMIRTHEWMHPQTKRLKLNILLTTYEILLKDKSFLGNVSWAFIGVDEAHRLKNDDSLLYKTMIEFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFHSWEMFEEEHG-----KGRDSGYTSLHKELEPFLLRRVKKDVEKSLPAKVEQILRVEMSAVQKQYYKWILTRNYKALSKGTKGSTSGFLNIMMELKKCCNHCYLIKPPDDNEFYNRQEGLQHL---VRSSGKLILLDKLLVRLKERGHRVLIFSQMVRMLDILAEYLKYRQFLFQRLDGSIKGEMRKQALDHFNADGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGSVEEEIIERAKKKMVLDHLVIQRMDTTGKTVLHTGAAPSSSTPFNKEELSAILKFGAEELFKEPEGEEQEPQEMDIDEILKRAETRENDPGPSTVGEELLSQFKVANFS-MMEDEEIDMDTERND-RNWDDIIPEDHRRRLEEEERQKELAEIYLLPRMRKCAK-----QMNFNGNEGRRSRNRRYSASDSDSVSDRKRPKKRGRPRTIPRENIKGFTDAEIRRFIKSYKKFGGPLERLDAIARDAELVDKSEHDLRRLAETVHNGCLRTLKENPCGPERTSGRRGKVKGPTFRISGVQVNAKLVISHEEELAPLHKAIPADPEERKRYIIPCHSKAAHFDIEWGKEDDSSLLIGIYEYGYGSWEMIKMDPDLNLTHKLLPDDPDKKPQAKQLQTRADYLIKLL 1300          

HSP 2 Score: 70.0922 bits (170), Expect = 2.263e-11
Identity = 52/205 (25.37%), Postives = 96/205 (46.83%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSEVXXXXXXXXXXXXXXXXGKHDSFINKGSESVKESKTQSDKVKCNFEARSYQEYIKMKNWNGETTKTFDDNNRNEKYKPYSRSSFNDKRNDKTYKSYHDRDDKSD 4609
            E+    F  C +RM+P+K+ LK L+  ++    + +++      CL+ IG+HI   +  + N EQ +QWR  LW FV+ F + F    LH++YK A KK +  +   + + +     + KH + + +  ES ++  ++         +  Y E+ K  + +    K+ D   R     PYS  S      ++    Y +R ++ D
Sbjct: 1396 ELDQKTFSVCKERMRPVKAALKQLDRPEKGLSEREQLE--HTRQCLIKIGDHITECLREYTNPEQIKQWRKNLWIFVSKFTE-FDARKLHKLYKHAIKKRQENAQAAEQNTSTVNTQSFKH-ADVERLKESQQDESSRDSYSSDRHHSSRYHEHSKEHHASDSYRKSSDSRKR-----PYSSFSNGKDHRERERDQYRERGERPD 1591          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Zebrafish
Match: chd1 (chromodomain helicase DNA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7120])

HSP 1 Score: 974.926 bits (2519), Expect = 0.000e+0
Identity = 526/1064 (49.44%), Postives = 702/1064 (65.98%), Query Frame = 2
Query:  644 EEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSL-DYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDE-ETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDN---------------------------KETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSE--CDTEE-------KKNKAVFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            +E   +E V+  RIG  G TG  T+ Y      +   N D N    E QYLIKW+ WSHIH+TWE+E T++  QN  GMKKL  FK+ ++ ++ W K  ASPED++    ++E  + L  Q    ERII     K++    DYL KW+ L Y   +WE G +I K  F   I E+  R++   IP+R C+ L +RP+F P+++QP Y+     ++LRDYQLDG+NW+AH+W +GNS ILADEMGLGKTIQTI FL+YLF++H ++GPFLLVVPLST++SWQ E  +WAP MN+++Y GD  SR +IR  EW  P+ K LK ++ +TTYE+LLKDK +L  +SWAF+GVDEAHRLKND+S LY  +I F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF++W  FE+ +      +  +   + L+K LEPFLLRR KKDVEKSLP+K EQI+RV M   Q + YK ILT+NY+ALSK T+G TS FLNI+MELKKCCNH  L+ P D+ E  N+ +   HL   ++SSGK++LLDKL+  LKE+GHRVLIFSQMVRMLDI+++YL  R + FQRLDGSIKG +RKQA+DHFNA+GS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K S+EE+IIE AK+KMVLDHLVIQRMD+     LH     + + PF+K+EL+ ILKFGA +LF + E  ++E +   I +IL+RAET  +D        +LLS FKV N +   EDE+I     +   + W DI+P+D R +++EEE QK L E+ L PR RK  K     Q+N    E     N                           +E     TD EI+  IK  KKF  PLER+ +I  +AE++D +E ++  + + + NGC     E  C  E        K     F I  + ++ K ++   ++L  LH+ +P + EER ++++P  +K A++   W  EDD+ LL+G++E G  +WE IKMD DL LT K+LP    ++PQA  L+TR +YL+K L
Sbjct:  257 DEFETLERVMEMRIGRKGVTGAVTTVYAVEADGDPNANFDPNRQPGEVQYLIKWKNWSHIHNTWETEETLKQ-QNVKGMKKLDNFKKKEQEKKKWLKA-ASPEDVEYFNCQQELMDDLHSQYQLVERIIGHSNQKSAAGYPDYLCKWQGLPYSECSWEDGALISKK-FQKCIDEYMSRNQCKTIPSRDCKVLKQRPRFVPMKKQPHYIG-GEGLELRDYQLDGLNWMAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQLWAPLMNVVVYLGDINSRNMIRTHEWMHPQTKRLKLNILLTTYEILLKDKSFLGNVSWAFIGVDEAHRLKNDDSLLYKTMIEFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFHSWEMFEEEHG-----KGRDSGYTSLHKELEPFLLRRVKKDVEKSLPAKVEQILRVEMSAVQKQYYKWILTRNYKALSKGTKGSTSGFLNIMMELKKCCNHCYLIKPPDDNEFYNRQEGLQHL---VRSSGKLILLDKLLVRLKERGHRVLIFSQMVRMLDILAEYLKYRQFLFQRLDGSIKGEMRKQALDHFNADGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGSVEEEIIERAKKKMVLDHLVIQRMDTTGKTVLHTGAAPSSSTPFNKEELSAILKFGAEELFKEPEGEEQEPQEMDIDEILKRAETRENDPGPSTVGEELLSQFKVANFS-MMEDEEIDMDTERND-RNWDDIIPEDHRRRLEEEERQKELAEIYLLPRMRKCAK-----QMNFNGNEGRRSRNRRYSASDSDSVSDRKRPKKRGRPRTIPRENIKGFTDAEIRRFIKSYKKFGGPLERLDAIARDAELVDKSEHDLRRLAETVHNGCLRTLKENPCGPERTSGGRRGKVKGPTFRISGVQVNAKLVISHEEELAPLHKAIPADPEERKRYIIPCHSKAAHFDIEWGKEDDSSLLIGIYEYGYGSWEMIKMDPDLNLTHKLLPDDPDKKPQAKQLQTRADYLIKLL 1301          

HSP 2 Score: 70.4774 bits (171), Expect = 2.014e-11
Identity = 52/205 (25.37%), Postives = 96/205 (46.83%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSEVXXXXXXXXXXXXXXXXGKHDSFINKGSESVKESKTQSDKVKCNFEARSYQEYIKMKNWNGETTKTFDDNNRNEKYKPYSRSSFNDKRNDKTYKSYHDRDDKSD 4609
            E+    F  C +RM+P+K+ LK L+  ++    + +++      CL+ IG+HI   +  + N EQ +QWR  LW FV+ F + F    LH++YK A KK +  +   + + +     + KH + + +  ES ++  ++         +  Y E+ K  + +    K+ D   R     PYS  S      ++    Y +R ++ D
Sbjct: 1480 ELDQKTFSVCKERMRPVKAALKQLDRPEKGLSEREQLE--HTRQCLIKIGDHITECLREYTNPEQIKQWRKNLWIFVSKFTE-FDARKLHKLYKHAIKKRQENAQAAEQNTSTVNTQSFKH-ADVERLKESQQDESSRDSYSSDRHHSSRYHEHSKEHHASDSYRKSSDSRKR-----PYSSFSNGKDHRERERDQYRERGERPD 1675          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Zebrafish
Match: chd2 (chromodomain helicase DNA binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-050419-256])

HSP 1 Score: 934.095 bits (2413), Expect = 0.000e+0
Identity = 515/1085 (47.47%), Postives = 695/1085 (64.06%), Query Frame = 2
Query:  593 ECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGND-DNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLV-NPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKP-KLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETGGK---------------------------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKAV-----------FTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
            E  EG+ + Q       ++   IE+V++ R G  G TG  T+ Y  + +N   G D D   +E E Q+LIKW+ WS+IH+TWES  ++ T Q   GMKKL  FK+  +    W K  ASPEDL+    ++E    L +Q    ER+I      +S   +YL KW  L Y   TWE   +I K  F   I  F  R+ S  +P++ C+ L +RP+F P+++QP Y+    +++LRDYQLDGVNWLAH+W R NSVILADEMGLGKTIQTI FLSYLF+QH ++GPF++VVPLST++SWQ EF+ WAP MN+++Y GD  SR+ IR+ EW  P+ K +KF+  +TTYE+LLKDK  L  I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHF+M DKF +W DFED +      +  +     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV M  +Q + YK ILT+N++ALSK TRG +S FLNIVMELKKCCNH  L+  P D E +    P  HL+  ++  GK++LLDKL+  LK++G+RVLIFSQMVRMLDI++DYL ++ + FQRLDGSIKG LRKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K ++EE IIE AK+KMVLDHLVIQRMD+     L   +  + + PF+K+EL+ ILKFGA DLF + E  + E +   I +IL+ AE T   D+  +  ++LLS FKV N T      D+       KP + W +I+P++ R K++EE+ QK + ++ + PR R   K  Q    +S      +  ++ +G                              TD EI+  IK  KKF  PLER+++I  ++E+++ +  ++  + + + N C     E +   K+N                I  + ++ K+I+Q  ++ + LH+ +P N  ER KF L    K  ++   W+  DD +LL+G++E G  NW+ IK D DLKL+ KIL     ++PQ   L+ R +YLLK L+
Sbjct:  256 EMAEGAEEQQ------DDDSETIEKVVDTRTGKKGATGASTTLY-AIEENGDPGADFDPEKEEGETQFLIKWKGWSYIHNTWESVDSL-TQQKVKGMKKLENFKKKNEELNAWLKK-ASPEDLEYYNCQQELTNDLSKQFQIIERVI--AHKSSSGEPEYLCKWMGLPYAECTWEDSALIKKK-FQACIDSFHNRNSSKTVPSKDCKVLKQRPRFVPLKKQPSYIG-DENLELRDYQLDGVNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFIVVVPLSTLTSWQREFDTWAPDMNVVVYLGDVTSRKTIRDYEWINPQTKRIKFNALLTTYEILLKDKGVLGNINWAFLGVDEAHRLKNDDSLLYKTLIDFRSNHRLLITGTPLQNSLKELWSLLHFLMSDKFESWEDFEDEHG-----KGRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMSAQQKQFYKWILTRNFKALSKGTRGSSSGFLNIVMELKKCCNHAFLIKQPEDGENDA---PQEHLQSLVRGGGKLVLLDKLLTRLKDRGNRVLIFSQMVRMLDILADYLSMKRYQFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEDIIERAKKKMVLDHLVIQRMDTTGRTVLDNSSANSNSNPFNKEELSAILKFGAEDLFKEAEGEESEPQEMDIDEILRLAE-TRESDQGSSATDELLSQFKVANFTMDESTPDL-----DEKPGRDWDEIIPEEQRRKVEEEQKQKEMEDIYMLPRSRSSNKKAQANDSDSDVGSKLK--HRSSGSDSETDDSEDDKRPKRRGRPRARKNNVEGFTDAEIRRFIKAYKKFGAPLERLEAIARDSELVEKSIADLKRLGELVHNSCVTAVQEHEEHLKENPVEAKGPGKRRGINIKISGVQVNAKSIIQHEEEFEPLHKAVPSNPAERNKFQLTCRVKTPHFDVDWDIHDDTQLLLGIYEHGYGNWDLIKTDPDLKLSEKILLDDPEKKPQGKQLQMRTDYLLKMLK 1311          

HSP 2 Score: 58.9214 bits (141), Expect = 5.897e-8
Identity = 34/99 (34.34%), Postives = 53/99 (53.54%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            E+    F  C +RM+P+K  LK L+  +   G  ++   +    CLL IG+ I   + ++ + E  + WR  LW FV+ F + F  + LHR+YK A KK
Sbjct: 1441 ELDQETFSICKERMRPVKKALKQLD--KPDEGLSVQDQLQHTRTCLLKIGDRITECLKSYSDPEHIKIWRRNLWIFVSKFTE-FGAQKLHRLYKKAQKK 1536          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Zebrafish
Match: chd2 (chromodomain helicase DNA binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-050419-256])

HSP 1 Score: 933.71 bits (2412), Expect = 0.000e+0
Identity = 515/1085 (47.47%), Postives = 695/1085 (64.06%), Query Frame = 2
Query:  593 ECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGND-DNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLV-NPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKP-KLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETGGK---------------------------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKAV-----------FTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
            E  EG+ + Q       ++   IE+V++ R G  G TG  T+ Y  + +N   G D D   +E E Q+LIKW+ WS+IH+TWES  ++ T Q   GMKKL  FK+  +    W K  ASPEDL+    ++E    L +Q    ER+I      +S   +YL KW  L Y   TWE   +I K  F   I  F  R+ S  +P++ C+ L +RP+F P+++QP Y+    +++LRDYQLDGVNWLAH+W R NSVILADEMGLGKTIQTI FLSYLF+QH ++GPF++VVPLST++SWQ EF+ WAP MN+++Y GD  SR+ IR+ EW  P+ K +KF+  +TTYE+LLKDK  L  I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHF+M DKF +W DFED +      +  +     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV M  +Q + YK ILT+N++ALSK TRG +S FLNIVMELKKCCNH  L+  P D E +    P  HL+  ++  GK++LLDKL+  LK++G+RVLIFSQMVRMLDI++DYL ++ + FQRLDGSIKG LRKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K ++EE IIE AK+KMVLDHLVIQRMD+     L   +  + + PF+K+EL+ ILKFGA DLF + E  + E +   I +IL+ AE T   D+  +  ++LLS FKV N T      D+       KP + W +I+P++ R K++EE+ QK + ++ + PR R   K  Q    +S      +  ++ +G                              TD EI+  IK  KKF  PLER+++I  ++E+++ +  ++  + + + N C     E +   K+N                I  + ++ K+I+Q  ++ + LH+ +P N  ER KF L    K  ++   W+  DD +LL+G++E G  NW+ IK D DLKL+ KIL     ++PQ   L+ R +YLLK L+
Sbjct:  260 EMAEGAEEQQ------DDDSETIEKVVDTRTGKKGATGASTTLY-AIEENGDPGADFDPEKEEGETQFLIKWKGWSYIHNTWESVDSL-TQQKVKGMKKLENFKKKNEELNAWLKK-ASPEDLEYYNCQQELTNDLSKQFQIIERVI--AHKSSSGEPEYLCKWMGLPYAECTWEDSALIKKK-FQACIDSFHNRNSSKTVPSKDCKVLKQRPRFVPLKKQPSYIG-DENLELRDYQLDGVNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFIVVVPLSTLTSWQREFDTWAPDMNVVVYLGDVTSRKTIRDYEWINPQTKRIKFNALLTTYEILLKDKGVLGNINWAFLGVDEAHRLKNDDSLLYKTLIDFRSNHRLLITGTPLQNSLKELWSLLHFLMSDKFESWEDFEDEHG-----KGRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMSAQQKQFYKWILTRNFKALSKGTRGSSSGFLNIVMELKKCCNHAFLIKQPEDGENDA---PQEHLQSLVRGGGKLVLLDKLLTRLKDRGNRVLIFSQMVRMLDILADYLSMKRYQFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEDIIERAKKKMVLDHLVIQRMDTTGRTVLDNSSANSNSNPFNKEELSAILKFGAEDLFKEAEGEESEPQEMDIDEILRLAE-TRESDQGSSATDELLSQFKVANFTMDESTPDL-----DEKPGRDWDEIIPEEQRRKVEEEQKQKEMEDIYMLPRSRSSNKKAQANDSDSDVGSKLK--HRSSGSDSETDDSEDDKRPKRRGRPRARKNNVEGFTDAEIRRFIKAYKKFGAPLERLEAIARDSELVEKSIADLKRLGELVHNSCVTAVQEHEEHLKENPVEAKGPGKRRGINIKISGVQVNAKSIIQHEEEFEPLHKAVPSNPAERNKFQLTCRVKTPHFDVDWDIHDDTQLLLGIYEHGYGNWDLIKTDPDLKLSEKILLDDPEKKPQGKQLQMRTDYLLKMLK 1315          

HSP 2 Score: 59.3066 bits (142), Expect = 5.062e-8
Identity = 34/99 (34.34%), Postives = 53/99 (53.54%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            E+    F  C +RM+P+K  LK L+  +   G  ++   +    CLL IG+ I   + ++ + E  + WR  LW FV+ F + F  + LHR+YK A KK
Sbjct: 1445 ELDQETFSICKERMRPVKKALKQLD--KPDEGLSVQDQLQHTRTCLLKIGDRITECLKSYSDPEHIKIWRRNLWIFVSKFTE-FGAQKLHRLYKKAQKK 1540          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Zebrafish
Match: chd5 (chromodomain helicase DNA binding protein 5 [Source:ZFIN;Acc:ZDB-GENE-120314-2])

HSP 1 Score: 523.857 bits (1348), Expect = 2.135e-158
Identity = 311/787 (39.52%), Postives = 437/787 (55.53%), Query Frame = 2
Query:  782 ERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQK------ME--------------CERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNL---------FPNGIIEFEERSRSVKIPNRKCEALTRRPKFAP---------IREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYF--------------PKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXX---------------XXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAED 2941
            ERQ  +KW   S+ H +W SE  ++ Y         + ++  Q++ ++       P   D    EEE N    + K      ME                RI++   +K+ D + YLIKW+ L Y   +WE+ D  V +            N ++    +    +   R  E + RR                +QP Y+  T    L  YQL+G+NWL  +W +G   ILADEMGLGKT+QTI FL  L+ +    GPFL+  PLSTI +W+ EF +WAP   ++ YTGD  SR +IRE E+ F               K   +KFHV +T+YEL+  D+  L  I+WA L VDEAHRLKN++S+ +  L  +    +LL+TGTP+ N+L EL+ LL+F+ P++FN    F + +     +   E+ + +L+ +L P +LRR K DV K++P+K+E I+RV +   Q + YK ILT+N+EAL+ +  G+  S LNI+M+LKKCCNH  L      E     +        +KSSGK+ LL K++ +LK+ GHRVLIFSQM +MLD++ D+L   G+ ++R+DG I G LR++AID FNA G+  FCFLLSTRAGGLGINLATADTVII+DSDWNP ND+QA +RAHRIGQ ++V +YRFV + S+EE+I + AKRKM+L HLV+        R    +K    SK EL++ILKFG  +LF  D E                       I  +L R++    D E  N  N+ LS+FKV       ED
Sbjct:   93 ERQLFVKWAGLSYWHCSWVSELQLELYHT-------VMYRNYQRKNDM-----DEPPPYDYGSGEEELNNEKRRSKDPQYAAMEERFYRYGIKPEWLIIHRILNHSFDKDGD-VQYLIKWRDLPYDQCSWEADDFDVPDYDSLKQAYWDHRNQVLGENHQPLLFRKGKRPKEEMKRREPPPDTPVVDPTIKFEQQPWYIDDTGGT-LHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRAIIRENEFTFEDSAVKSGRKVFRMKKDTPIKFHVLLTSYELITIDQAILGSITWACLVVDEAHRLKNNQSKFFRILNGYKIYYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEF----ADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNLLVKSSGKLTLLQKMLIKLKDGGHRVLIFSQMTKMLDLLEDFLEFEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVV--------RPGLGSKTGSMSKQELDDILKFGTEELFKDDVEAARTMGDNKEGEEVSVIHYDDNAISKLLDRSQDATEDTEIQN-MNEYLSSFKVAQYVVREED 852          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000053481.1 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:100497210])

HSP 1 Score: 996.497 bits (2575), Expect = 0.000e+0
Identity = 567/1280 (44.30%), Postives = 788/1280 (61.56%), Query Frame = 2
Query:  629 SEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNS----------------DSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQ----PFSKDELNEILKFGAADLFXXXXXXX-XXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQR----------------KKVKAYQVGQVNXXXXXXXXXDNKETGGK-----------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKA-----------VFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNHVTNPKSAEFVESSDNSSRXXXXXXXXXXXXXXXXXXXXXXXXXRESKSHGDDDHEHLFYEMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            +E + +    IE+VL+ RIG  G  G  T+ Y      +     +  +DE E+QYLIKW+ WS+IH TWESE ++Q  Q   G+KKL  FK+ ++  + W     SPED++    ++E    L +Q    ER+I  + +K+S                +  +YL KW  L Y   +WE G ++ K  F + I  F  R+ S   P + C+ L +RP+F  +++QP Y+     ++LRDYQL+G+NWLAH+W + NSVILADEMGLGKTIQTI FLSYLF+ H ++GPFLLVVPLST++SWQ EF +WAP +N+++Y GD  SR  IRE EW   + K +KF+  +TTYE+LLKDK  L+ I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF  W DFED++      +  +     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV MC  Q + Y+ ILT+NY+ALSK TRG TS FLNIVMELKKCCNH  L+ P + E E+++D    L+  I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL ++ + FQRLDGSIKG LRKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V + ++EE IIE AK+KMVLDHLVIQRMD+      D N       PF+KDEL  ILKFGAADLF + E  + E QE++I +IL+ AE T  ++ S +  ++LLS FKV N     E+ ++V      + + W DI+P+  R+K++EE  QK L E+ + PR R                 K KA +     S S++S ++   +  G+            TD EI+  IK  KKF  PLER++ I  +AE+++ +  ++  + + + N C +   E + + K+N A              I  + ++VK I+Q  +D ++L + +P + EE+ KF +    K A++   W  EDD+ LL+G++E G  NWE IK D +LKL+ KILP    ++PQA HL+TR +YLLK L+         +   K   +  +   +         N +++P+       SDN+S + + K K        K++         + S      E    ++    F  C +RM+P+K  LK L++  +  G  ++   +    CLL IG+ I   +  + + E  + WR  LW FV+ F + F    LH++YK A+KK
Sbjct:  256 AEELEDSHETIEKVLDSRIGKKGAIGASTTVYATEENGDPNSEFNPETDEREQQYLIKWKGWSYIHGTWESEDSLQQ-QKVKGLKKLENFKKKEEEIKQWLSK-VSPEDVEYFSCQQELASELNKQYQIVERVIAVKTSKSSSGHSDFPVHSRKTSSSNEPEYLCKWMGLPYSECSWEDGALVGKK-FQHCIDSFNCRNNSKTTPVKDCKVLRQRPRFVTLKKQPSYIG-GEGLELRDYQLEGLNWLAHSWCKNNSVILADEMGLGKTIQTISFLSYLFHLHLLYGPFLLVVPLSTLTSWQREFEVWAPDINVVVYIGDLGSRNTIREYEWVHQQSKKMKFNALLTTYEILLKDKAVLSSINWAFLGVDEAHRLKNDDSLLYKTLIEFKSNARLLITGTPLQNSLKELWSLLHFIMPEKFECWEDFEDQHG-----KGRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVEMCVMQKQYYRWILTRNYKALSKGTRGSTSGFLNIVMELKKCCNHCFLIKPEETEKESRLD---SLQSLIRSSGKLVLLDKLLTRLRERGNRVLIFSQMVRMLDILAEYLAIKHYPFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTRGTVEEDIIERAKKKMVLDHLVIQRMDTTGRTVLDNNSGSSNCNPFNKDELAAILKFGAADLFKETEGEELEPQEMDIDEILRLAE-TRENEPSSSATDELLSQFKVANFATMEEEPEMVL----KREQEWDDIIPEGQRKKVEEEARQKELQEIYMLPRIRSLNKKPQANDSESDLESKQKAQRSSGSESDSDDSDDDKKPKRRGRPRSVRKDNVEGFTDAEIRRFIKAYKKFASPLERLECIARDAELVEKSVADLKRLGELLHNSCASAMQEFEEQLKENPADGKGPGKRRGPTIKISGVQVNVKAIIQHEEDFEVLSKSIPADPEEKKKFNVVSRVKAAHFDVEWAIEDDSHLLLGIYEHGYGNWEHIKSDPELKLSEKILPVDTEKKPQAKHLQTRADYLLKMLKKEMEKETGAAEEPKSKKRKPRAKKDSGKTKDEHGNDISSPR------HSDNNSEEGEEKAKRGEAKPGGKNRKNQGPVHITAGSEPVPIGEEEEDDLDQETFSICKERMRPVKKALKQLDNADK--GLSVQEQLEHTRTCLLKIGDRISECLKMYSDQEHVKLWRRNLWIFVSKFTE-FDARKLHKLYKMAHKK 1509          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000053510.1 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:100497210])

HSP 1 Score: 975.696 bits (2521), Expect = 0.000e+0
Identity = 564/1240 (45.48%), Postives = 773/1240 (62.34%), Query Frame = 2
Query:  167 LLDEIKENPDLYTTRRSERNRKEPSRFNILSERGSQGNRLSRKIYSGSTXXXXXXXXXXXXXFVYSKRNKKYNQKQKMEFRKRAHVSYKEVVTSDEDVGSDDSGQPKKKVAKINNSNGFTNVRDNPLLNKPLILIRGEKIDNECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNS----------------DSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQ----PFSKDELNEILKFGAADLFXXXXXXX-XXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQR----------------KKVKAYQVGQVNXXXXXXXXXDNKETGGK-----------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKA-----------VFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
            +L   +E PD+Y  RRS R+R+EPSRFNI +E   +   L +K+   ST++              S R KK         RK+A    ++    D+D       Q +++ AK   +  +    D    +  LI + GE  + E +E S++              IE+VL+ RIG  G  G  T+ Y      +     +  +DE E+QYLIKW+ WS+IH TWESE ++Q  Q   G+KKL  FK+ ++  + W     SPED++    ++E    L +Q    ER+I  + +K+S                +  +YL KW  L Y   +WE G ++ K  F + I  F  R+ S   P + C+ L +RP+F  +++QP Y+     ++LRDYQL+G+NWLAH+W + NSVILADEMGLGKTIQTI FLSYLF+ H ++GPFLLVVPLST++SWQ EF +WAP +N+++Y GD  SR  IRE EW   + K +KF+  +TTYE+LLKDK  L+ I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF  W DFED++      +  +     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV MC  Q + Y+ ILT+NY+ALSK TRG TS FLNIVMELKKCCNH  L+ P + E E+++D    L+  I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL ++ + FQRLDGSIKG LRKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V + ++EE IIE AK+KMVLDHLVIQRMD+      D N       PF+KDEL  ILKFGAADLF + E  + E QE++I +IL+ AE T  ++ S +  ++LLS FKV N     E+ ++V      + + W DI+P+  R+K++EE  QK L E+ + PR R                 K KA +     S S++S ++   +  G+            TD EI+  IK  KKF  PLER++ I  +AE+++ +  ++  + + + N C +   E + + K+N A              I  + ++VK I+Q  +D ++L + +P + EE+ KF +    K A++   W  EDD+ LL+G++E G  NWE IK D +LKL+ KILP    ++PQA HL+TR +YLLK L+
Sbjct:   41 VLQMWEEYPDVYGVRRSNRSRQEPSRFNIKAE--VRKKNLPKKLAKSSTNK-----------LKRSLRGKK---------RKQASSEEEDDDDDDDDDDETPKRQTRRRAAK---NVSYKEDDDFETDSDDLIEMVGE--EAEELEDSHE-------------TIEKVLDSRIGKKGAIGASTTVYATEENGDPNSEFNPETDEREQQYLIKWKGWSYIHGTWESEDSLQQ-QKVKGLKKLENFKKKEEEIKQWLSK-VSPEDVEYFSCQQELASELNKQYQIVERVIAVKTSKSSSGHSDFPVHSRKTSSSNEPEYLCKWMGLPYSECSWEDGALVGKK-FQHCIDSFNCRNNSKTTPVKDCKVLRQRPRFVTLKKQPSYIG-GEGLELRDYQLEGLNWLAHSWCKNNSVILADEMGLGKTIQTISFLSYLFHLHLLYGPFLLVVPLSTLTSWQREFEVWAPDINVVVYIGDLGSRNTIREYEWVHQQSKKMKFNALLTTYEILLKDKAVLSSINWAFLGVDEAHRLKNDDSLLYKTLIEFKSNARLLITGTPLQNSLKELWSLLHFIMPEKFECWEDFEDQHG-----KGRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVEMCVMQKQYYRWILTRNYKALSKGTRGSTSGFLNIVMELKKCCNHCFLIKPEETEKESRLD---SLQSLIRSSGKLVLLDKLLTRLRERGNRVLIFSQMVRMLDILAEYLAIKHYPFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTRGTVEEDIIERAKKKMVLDHLVIQRMDTTGRTVLDNNSGSSNCNPFNKDELAAILKFGAADLFKETEGEELEPQEMDIDEILRLAE-TRENEPSSSATDELLSQFKVANFATMEEEPEMVL----KREQEWDDIIPEGQRKKVEEEARQKELQEIYMLPRIRSLNKKPQANDSESDLESKQKAQRSSGSESDSDDSDDDKKPKRRGRPRSVRKDNVEGFTDAEIRRFIKAYKKFASPLERLECIARDAELVEKSVADLKRLGELLHNSCASAMQEFEEQLKENPADGKGPGKRRGPTIKISGVQVNVKAIIQHEEDFEVLSKSIPADPEEKKKFNVVSRVKAAHFDVEWAIEDDSHLLLGIYEHGYGNWEHIKSDPELKLSEKILPVDTEKKPQAKHLQTRADYLLKMLK 1223          

HSP 2 Score: 59.3066 bits (142), Expect = 6.752e-8
Identity = 32/93 (34.41%), Postives = 51/93 (54.84%), Query Frame = 2
Query: 4013 FDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            F  C +RM+P+K  LK L++  +  G  ++   +    CLL IG+ I   +  + + E  + WR  LW FV+ F + F    LH++YK A+KK
Sbjct: 1364 FSICKERMRPVKKALKQLDNADK--GLSVQEQLEHTRTCLLKIGDRISECLKMYSDQEHVKLWRRNLWIFVSKFTE-FDARKLHKLYKMAHKK 1453          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000053494.1 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:100497210])

HSP 1 Score: 970.304 bits (2507), Expect = 0.000e+0
Identity = 563/1239 (45.44%), Postives = 771/1239 (62.23%), Query Frame = 2
Query:  185 ENPDLYTTRRSERNRKEPSRFNILSERGSQGNRLSRKIYSGSTXXXXXXXXXXXXXFVYSKRNKKYNQKQKMEFRKRAHVSYKEVVTSDEDVGSDDSGQPKKKVAKINNSNGFTNVRDNPLLNKPLILIRGEKIDNECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNT-----GIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNS----------------DSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQ----PFSKDELNEILKFGAADLFXXXXXXX-XXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQR----------------KKVKAYQVGQVNXXXXXXXXXDNKETGGK-----------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKA-----------VFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
            E PD+Y  RRS R+R+EPSRFNI +E   +   L +K+   ST++              S R KK         RK+A    ++    D+D       Q +++ AK   +  +    D    +  LI + GE  + E +E S++              IE+VL+ RIG  G+      G  T+ Y      +     +  +DE E+QYLIKW+ WS+IH TWESE ++Q  Q   G+KKL  FK+ ++  + W     SPED++    ++E    L +Q    ER+I  + +K+S                +  +YL KW  L Y   +WE G ++ K  F + I  F  R+ S   P + C+ L +RP+F  +++QP Y+     ++LRDYQL+G+NWLAH+W + NSVILADEMGLGKTIQTI FLSYLF+ H ++GPFLLVVPLST++SWQ EF +WAP +N+++Y GD  SR  IRE EW   + K +KF+  +TTYE+LLKDK  L+ I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF  W DFED++      +  +     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV MC  Q + Y+ ILT+NY+ALSK TRG TS FLNIVMELKKCCNH  L+ P + E E+++D    L+  I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL ++ + FQRLDGSIKG LRKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V + ++EE IIE AK+KMVLDHLVIQRMD+      D N       PF+KDEL  ILKFGAADLF + E  + E QE++I +IL+ AE T  ++ S +  ++LLS FKV N     E+ ++V      + + W DI+P+  R+K++EE  QK L E+ + PR R                 K KA +     S S++S ++   +  G+            TD EI+  IK  KKF  PLER++ I  +AE+++ +  ++  + + + N C +   E + + K+N A              I  + ++VK I+Q  +D ++L + +P + EE+ KF +    K A++   W  EDD+ LL+G++E G  NWE IK D +LKL+ KILP    ++PQA HL+TR +YLLK L+
Sbjct:   25 EYPDVYGVRRSNRSRQEPSRFNIKAE--VRKKNLPKKLAKSSTNK-----------LKRSLRGKK---------RKQASSEEEDDDDDDDDDDETPKRQTRRRAAK---NVSYKEDDDFETDSDDLIEMVGE--EAEELEDSHE-------------TIEKVLDSRIGKKGDMNTAAIGASTTVYATEENGDPNSEFNPETDEREQQYLIKWKGWSYIHGTWESEDSLQQ-QKVKGLKKLENFKKKEEEIKQWLSK-VSPEDVEYFSCQQELASELNKQYQIVERVIAVKTSKSSSGHSDFPVHSRKTSSSNEPEYLCKWMGLPYSECSWEDGALVGKK-FQHCIDSFNCRNNSKTTPVKDCKVLRQRPRFVTLKKQPSYIG-GEGLELRDYQLEGLNWLAHSWCKNNSVILADEMGLGKTIQTISFLSYLFHLHLLYGPFLLVVPLSTLTSWQREFEVWAPDINVVVYIGDLGSRNTIREYEWVHQQSKKMKFNALLTTYEILLKDKAVLSSINWAFLGVDEAHRLKNDDSLLYKTLIEFKSNARLLITGTPLQNSLKELWSLLHFIMPEKFECWEDFEDQHG-----KGRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVEMCVMQKQYYRWILTRNYKALSKGTRGSTSGFLNIVMELKKCCNHCFLIKPEETEKESRLD---SLQSLIRSSGKLVLLDKLLTRLRERGNRVLIFSQMVRMLDILAEYLAIKHYPFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTRGTVEEDIIERAKKKMVLDHLVIQRMDTTGRTVLDNNSGSSNCNPFNKDELAAILKFGAADLFKETEGEELEPQEMDIDEILRLAE-TRENEPSSSATDELLSQFKVANFATMEEEPEMVL----KREQEWDDIIPEGQRKKVEEEARQKELQEIYMLPRIRSLNKKPQANDSESDLESKQKAQRSSGSESDSDDSDDDKKPKRRGRPRSVRKDNVEGFTDAEIRRFIKAYKKFASPLERLECIARDAELVEKSVADLKRLGELLHNSCASAMQEFEEQLKENPADGKGPGKRRGPTIKISGVQVNVKAIIQHEEDFEVLSKSIPADPEEKKKFNVVSRVKAAHFDVEWAIEDDSHLLLGIYEHGYGNWEHIKSDPELKLSEKILPVDTEKKPQAKHLQTRADYLLKMLK 1206          

HSP 2 Score: 59.3066 bits (142), Expect = 6.856e-8
Identity = 32/93 (34.41%), Postives = 51/93 (54.84%), Query Frame = 2
Query: 4013 FDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            F  C +RM+P+K  LK L++  +  G  ++   +    CLL IG+ I   +  + + E  + WR  LW FV+ F + F    LH++YK A+KK
Sbjct: 1347 FSICKERMRPVKKALKQLDNADK--GLSVQEQLEHTRTCLLKIGDRISECLKMYSDQEHVKLWRRNLWIFVSKFTE-FDARKLHKLYKMAHKK 1436          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000053518.1 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:100497210])

HSP 1 Score: 963.755 bits (2490), Expect = 0.000e+0
Identity = 523/1069 (48.92%), Postives = 708/1069 (66.23%), Query Frame = 2
Query:  614 DDQRMSEFISEEVN-------VIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERII-DAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQ----PFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQR---KKVKAYQVGQVNXXXXXXXXXDNKETGGK-----------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKA----------VFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
            D   + E + EE          IE+VL+ RIG  G  G  T+ Y      +     +  +DE E+QYLIKW+ WS+IH TWESE ++Q  Q   G+KKL  FK+ ++  + W     SPED++    ++E    L +Q    ER+I  +++  +S+  +YL KW  L Y   +WE G ++ K  F + I  F  R+ S   P + C+ L +RP+F  +++QP Y+     ++LRDYQL+G+NWLAH+W + NSVILADEMGLGKTIQTI FLSYLF+ H ++GPFLLVVPLST++SWQ EF +WAP +N+++Y GD  SR  IRE EW   + K +KF+  +TTYE+LLKDK  L+ I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF  W DFED++      +  +     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV MC  Q + Y+ ILT+NY+ALSK TRG TS FLNIVMELKKCCNH  L+ P + E E+++D    L+  I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL ++ + FQRLDGSIKG LRKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V + ++EE IIE AK+KMVLDHLVIQRMD+      D N       PF+KDEL  ILKFGAADLF + E  + E +   I +IL+ AE T  ++ S +  ++LLS FKV N     E+ ++V      + + W DI+P+  R+K++EE  QK L E+ + PR R   KKV+A +     S S++S ++   +  G+            TD EI+  IK  KKF  PLER++ I  +AE+++ +  ++  + + + N C +   E + + K+N A             I  + ++VK I+Q  +D ++L + +P + EE+   V     K A++   W  EDD+ LL+G++E G  NWE IK D +LKL+ KILP    ++PQA HL+TR +YLLK L+
Sbjct:    4 DSDDLIEMVGEEAEELEDSHETIEKVLDSRIGKKGAIGASTTVYATEENGDPNSEFNPETDEREQQYLIKWKGWSYIHGTWESEDSLQQ-QKVKGLKKLENFKKKEEEIKQWLSK-VSPEDVEYFSCQQELASELNKQYQIVERVIVHSRKTSSSNEPEYLCKWMGLPYSECSWEDGALVGKK-FQHCIDSFNCRNNSKTTPVKDCKVLRQRPRFVTLKKQPSYIG-GEGLELRDYQLEGLNWLAHSWCKNNSVILADEMGLGKTIQTISFLSYLFHLHLLYGPFLLVVPLSTLTSWQREFEVWAPDINVVVYIGDLGSRNTIREYEWVHQQSKKMKFNALLTTYEILLKDKAVLSSINWAFLGVDEAHRLKNDDSLLYKTLIEFKSNARLLITGTPLQNSLKELWSLLHFIMPEKFECWEDFEDQHG-----KGRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVEMCVMQKQYYRWILTRNYKALSKGTRGSTSGFLNIVMELKKCCNHCFLIKPEETEKESRLDS---LQSLIRSSGKLVLLDKLLTRLRERGNRVLIFSQMVRMLDILAEYLAIKHYPFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTRGTVEEDIIERAKKKMVLDHLVIQRMDTTGRTVLDNNSGSSNCNPFNKDELAAILKFGAADLFKETEGEELEPQEMDIDEILRLAE-TRENEPSSSATDELLSQFKVANFATMEEEPEMVL----KREQEWDDIIPEGQRKKVEEEARQKELQEIYMLPRIRSLNKKVRARRSSGSESDSDDSDDDKKPKRRGRPRSVRKDNVEGFTDAEIRRFIKAYKKFASPLERLECIARDAELVEKSVADLKRLGELLHNSCASAMQEFEEQLKENPADGMFGKRRGPTIKISGVQVNVKAIIQHEEDFEVLSKSIPADPEEKKNRV-----KAAHFDVEWAIEDDSHLLLGIYEHGYGNWEHIKSDPELKLSEKILPVDTEKKPQAKHLQTRADYLLKMLK 1050          

HSP 2 Score: 59.3066 bits (142), Expect = 7.535e-8
Identity = 32/93 (34.41%), Postives = 51/93 (54.84%), Query Frame = 2
Query: 4013 FDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            F  C +RM+P+K  LK L++  +  G  ++   +    CLL IG+ I   +  + + E  + WR  LW FV+ F + F    LH++YK A+KK
Sbjct: 1131 FSICKERMRPVKKALKQLDNADK--GLSVQEQLEHTRTCLLKIGDRISECLKMYSDQEHVKLWRRNLWIFVSKFTE-FDARKLHKLYKMAHKK 1220          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000053490.1 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:100497210])

HSP 1 Score: 963.755 bits (2490), Expect = 0.000e+0
Identity = 523/1086 (48.16%), Postives = 709/1086 (65.29%), Query Frame = 2
Query:  629 SEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNS----------------DSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQ----PFSKDELNEILKFGAADLFXXXXXXX-XXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQR----------------KKVKAYQVGQVNXXXXXXXXXDNKETGGK-----------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKA-----------VFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
            +E + +    IE+VL+ RIG  G  G  T+ Y      +     +  +DE E+QYLIKW+ WS+IH TWESE ++Q  Q   G+KKL  FK+ ++  + W     SPED++    ++E    L +Q    ER+I  + +K+S                +  +YL KW  L Y   +WE G ++ K  F + I  F  R+ S   P + C+ L +RP+F  +++QP Y+     ++LRDYQL+G+NWLAH+W + NSVILADEMGLGKTIQTI FLSYLF+ H ++GPFLLVVPLST++SWQ EF +WAP +N+++Y GD  SR  IRE EW   + K +KF+  +TTYE+LLKDK  L+ I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF  W DFED++      +  +     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV MC  Q + Y+ ILT+NY+ALSK TRG TS FLNIVMELKKCCNH  L+ P + E E+++D    L+  I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL ++ + FQRLDGSIKG LRKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V + ++EE IIE AK+KMVLDHLVIQRMD+      D N       PF+KDEL  ILKFGAADLF + E  + E QE++I +IL+ AE T  ++ S +  ++LLS FKV N     E+ ++V      + + W DI+P+  R+K++EE  QK L E+ + PR R                 K KA +     S S++S ++   +  G+            TD EI+  IK  KKF  PLER++ I  +AE+++ +  ++  + + + N C +   E + + K+N A              I  + ++VK I+Q  +D ++L + +P + EE+ KF +    K A++   W  EDD+ LL+G++E G  NWE IK D +LKL+ KILP    ++PQA HL+TR +YLLK L+
Sbjct:  179 AEELEDSHETIEKVLDSRIGKKGAIGASTTVYATEENGDPNSEFNPETDEREQQYLIKWKGWSYIHGTWESEDSLQQ-QKVKGLKKLENFKKKEEEIKQWLSK-VSPEDVEYFSCQQELASELNKQYQIVERVIAVKTSKSSSGHSDFPVHSRKTSSSNEPEYLCKWMGLPYSECSWEDGALVGKK-FQHCIDSFNCRNNSKTTPVKDCKVLRQRPRFVTLKKQPSYIG-GEGLELRDYQLEGLNWLAHSWCKNNSVILADEMGLGKTIQTISFLSYLFHLHLLYGPFLLVVPLSTLTSWQREFEVWAPDINVVVYIGDLGSRNTIREYEWVHQQSKKMKFNALLTTYEILLKDKAVLSSINWAFLGVDEAHRLKNDDSLLYKTLIEFKSNARLLITGTPLQNSLKELWSLLHFIMPEKFECWEDFEDQHG-----KGRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVEMCVMQKQYYRWILTRNYKALSKGTRGSTSGFLNIVMELKKCCNHCFLIKPEETEKESRLD---SLQSLIRSSGKLVLLDKLLTRLRERGNRVLIFSQMVRMLDILAEYLAIKHYPFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTRGTVEEDIIERAKKKMVLDHLVIQRMDTTGRTVLDNNSGSSNCNPFNKDELAAILKFGAADLFKETEGEELEPQEMDIDEILRLAE-TRENEPSSSATDELLSQFKVANFATMEEEPEMVL----KREQEWDDIIPEGQRKKVEEEARQKELQEIYMLPRIRSLNKKPQANDSESDLESKQKAQRSSGSESDSDDSDDDKKPKRRGRPRSVRKDNVEGFTDAEIRRFIKAYKKFASPLERLECIARDAELVEKSVADLKRLGELLHNSCASAMQEFEEQLKENPADGKGPGKRRGPTIKISGVQVNVKAIIQHEEDFEVLSKSIPADPEEKKKFNVVSRVKAAHFDVEWAIEDDSHLLLGIYEHGYGNWEHIKSDPELKLSEKILPVDTEKKPQAKHLQTRADYLLKMLK 1247          

HSP 2 Score: 59.3066 bits (142), Expect = 6.940e-8
Identity = 32/93 (34.41%), Postives = 51/93 (54.84%), Query Frame = 2
Query: 4013 FDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            F  C +RM+P+K  LK L++  +  G  ++   +    CLL IG+ I   +  + + E  + WR  LW FV+ F + F    LH++YK A+KK
Sbjct: 1387 FSICKERMRPVKKALKQLDNADK--GLSVQEQLEHTRTCLLKIGDRISECLKMYSDQEHVKLWRRNLWIFVSKFTE-FDARKLHKLYKMAHKK 1476          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Mouse
Match: Chd2 (chromodomain helicase DNA binding protein 2 [Source:MGI Symbol;Acc:MGI:2448567])

HSP 1 Score: 949.503 bits (2453), Expect = 0.000e+0
Identity = 529/1078 (49.07%), Postives = 703/1078 (65.21%), Query Frame = 2
Query:  656 VIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKN----------------SDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVN-PLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXX-XXXXXXXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXD---------------------------NKETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVY-----------SECDTEEKKNKAVFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
             IE+VL+ R+G  G TG  T+ Y      +   + D   +E E QYLIKW+ WS+IHSTWESE ++Q  Q   G+KKL  FK+ +   + W     SPED++    ++E    L +Q    ER+I  + +K+                S+  +YL KW  L Y   +WE   +I K  F N I  F  R+ S  IP R+C+AL +RP+F  +++QP YL   S ++LRDYQL+G+NWLAH+W + NSVILADEMGLGKTIQTI FLSYLF+QH ++GPFL+VVPLST++SWQ EF IWAP +N+++Y GD +SR  IRE EW   + K LKF+  ITTYE+LLKDK  L  I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF  W DFE+ +      +  E     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV M   Q + YK ILT+NY+AL+K TRG TS FLNIVMELKKCCNH  L+  P D E E+  +    L+  I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL ++ + FQRLDGSIKG +RKQA+DHFNA+GS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K ++EE+IIE AK+KMVLDHLVIQRMD+     L   +  + + PF+K+EL  ILKFGA DLF + + E  E QE++I +IL+ AE T  ++ S +  ++LLS FKV N     ++E++    HK     W +I+P++ R+K++EEE QK L E+ + PR R   K  Q    +S +E   +                              K+     TD EI+  IK  KKF  PLER++ I  +AE++D +  ++  + + I N C +             SE     K+      I  + ++VK+I+Q  ++ ++LH+ +P + EE+ K+ L    K A++   W  EDD+RLL+G++E G  NWE IK D +LKLT KILP    ++PQ   L+TRV+YLLK LR
Sbjct:  262 TIEKVLDSRLGKKGATGASTTVYAVEANGDPSDDFDTEREEGEVQYLIKWKGWSYIHSTWESEDSLQQ-QKVKGLKKLENFKKKEDEVKQWLGK-VSPEDVEYFSCQQELASELNKQYQIVERVIAVKTSKSTLGQTDFPAHSRKPAPSNEPEYLCKWMGLPYSECSWEDEALIGKK-FQNCIDSFHSRNNSKTIPTRECKALKQRPRFVALKKQPAYLGGES-LELRDYQLEGLNWLAHSWCKSNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLIVVPLSTLTSWQREFEIWAPEINVVVYIGDLMSRNTIREYEWIHSQTKRLKFNALITTYEILLKDKTVLGSINWAFLGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFEFWEDFEEDHG-----KGRENGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVEMSALQKQYYKWILTRNYKALAKGTRGSTSGFLNIVMELKKCCNHCYLIKAPEDSERESGQEV---LQSLIRSSGKLILLDKLLTRLRERGNRVLIFSQMVRMLDILAEYLTIKHYPFQRLDGSIKGEIRKQALDHFNADGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTVLENNSGRSNSNPFNKEELTAILKFGAEDLFKEIEGEESEPQEMDIDEILRLAE-TRENEVSTSATDELLSQFKVANFATMEDEEELEERPHKD----WDEIIPEEQRKKVEEEERQKELEEIYMLPRIRSSTKKAQTNDSDSDTESKRQAQRSSASESETDDSDDDKKPKRRGRPRSVRKDLVEGFTDAEIRRFIKAYKKFGLPLERLECIARDAELVDKSVADLKRLGELIHNSCVSAMQEYEEQLKESTSEGKGPGKRRGPTIKISGVQVNVKSIIQHEEEFEMLHKSIPVDPEEKKKYCLTCRVKAAHFDVEWGVEDDSRLLLGIYEHGYGNWELIKTDPELKLTDKILPVETDKKPQGKQLQTRVDYLLKLLR 1322          

HSP 2 Score: 58.9214 bits (141), Expect = 6.220e-8
Identity = 32/93 (34.41%), Postives = 51/93 (54.84%), Query Frame = 2
Query: 4013 FDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            F  C +RM+P+K  LK L+   +  G  ++   +   +CLL IG+ I   +  + + E  + WR  LW FV+ F + F    LH++YK A+KK
Sbjct: 1469 FSICKERMRPVKKALKQLDKPDK--GLSVQEQLEHTRNCLLKIGDRIAECLKAYSDQEHIKLWRRNLWIFVSKFTE-FDARKLHKLYKMAHKK 1558          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Mouse
Match: Chd1 (chromodomain helicase DNA binding protein 1 [Source:MGI Symbol;Acc:MGI:88393])

HSP 1 Score: 929.087 bits (2400), Expect = 0.000e+0
Identity = 515/1058 (48.68%), Postives = 695/1058 (65.69%), Query Frame = 2
Query:  644 EEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSL-DYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLD-EETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDN----------------------KETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVY--SECDTEEKKNK------AVFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            EE   IE V++ R+G  G TG  T+ Y      +     + N +  + QYLIKW+ WSHIH+TWE+E T++  QN  GMKKL  +K+  +  + W K+ ASPED++    ++E  + L +Q    ERII     K++  L DY  KW+ L Y   +WE G +I K  F   I E+  R++S   P + C+ L +RP+F  +++QP Y+     ++LRDYQL+G+NWLAH+W +GNS ILADEMGLGKTIQTI FL+YLF++H ++GPFLLVVPLST++SWQ E   WA  MN ++Y GD  SR +IR  EW  P+ K LKF++ +TTYE+LLKDK +L  ++WAF+GVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF++W DFE+ +      +  E   + L+K LEPFLLRR KKDVEKSLP+K EQI+R+ M   Q + YK ILT+NY+ALSK ++G TS FLNI+MELKKCCNH  L+ P D  E  NK +   HL   I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL  R + FQRLDGSIKG LRKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K S+EE I+E AK+KMVLDHLVIQRMD+     LH  +  + + PF+K+EL+ ILKFGA +LF + E  ++E +   I +IL+RAET  ++    +  ++LLS FKV N +    DED + +  +   K W +I+P++ R +++EEE QK L E+ + PR R   K             S                           +E     +D EI+  IK  KKF  PLER+ +I  +AE++D +E ++  + + + NGC      S   TE    +        F I  + ++ K ++   D+L  LH+ +P + EER ++ +P  TK A++   W  EDD+ LL+G++E G  +WE IKMD DL LT KILP    ++PQA  L+TR +YL+K L
Sbjct:  267 EEFETIERVMDCRVGRKGATGATTTIYAVEADGDPNAGFERNKEPGDIQYLIKWKGWSHIHNTWETEETLKQ-QNVRGMKKLDNYKKKDQETKRWLKN-ASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGLPDYYCKWQGLPYSECSWEDGALISKK-FQTCIDEYFSRNQSKTTPFKDCKVLKQRPRFVALKKQPSYIGGHEGLELRDYQLNGLNWLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQTWASQMNAVVYLGDINSRNMIRTHEWMHPQTKRLKFNILLTTYEILLKDKAFLGGLNWAFIGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFSSWEDFEEEHG-----KGREYGYASLHKELEPFLLRRVKKDVEKSLPAKVEQILRMEMSALQKQYYKWILTRNYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKPPDNNEFYNKQEALQHL---IRSSGKLILLDKLLIRLRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGSVEEDILERAKKKMVLDHLVIQRMDTTGKTVLHTGSAPSSSTPFNKEELSAILKFGAEELFKEPEGEEQEPQEMDIDEILKRAETHENEPGPLSVGDELLSQFKVANFSNM--DEDDIELEPERNSKNWEEIIPEEQRRRLEEEERQKELEEIYMLPRMRNCAKQISFNGSEGRRSRSRRYSGSDSDSISERKRPKKRGRPRTIPRENIKGFSDAEIRRFIKSYKKFGGPLERLDAIARDAELVDKSETDLRRLGELVHNGCVKALKDSSSGTERAGGRLGKVKGPTFRISGVQVNAKLVIAHEDELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGSWEMIKMDPDLSLTHKILPDDPDKKPQAKQLQTRADYLIKLL 1311          

HSP 2 Score: 66.6254 bits (161), Expect = 3.311e-10
Identity = 35/101 (34.65%), Postives = 57/101 (56.44%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSE 4297
            E+    F  C +RM+P+K+ LK L+  ++    + +++      CL+ IG+HI   +  + N EQ +QWR  LW FV+ F + F    LH++YK A KK +
Sbjct: 1408 ELDQKTFSICKERMRPVKAALKQLDRPEKGLSEREQLE--HTRQCLIKIGDHITECLKEYSNPEQIKQWRKNLWIFVSKFTE-FDARKLHKLYKHAIKKRQ 1505          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Mouse
Match: Chd1 (chromodomain helicase DNA binding protein 1 [Source:MGI Symbol;Acc:MGI:88393])

HSP 1 Score: 813.527 bits (2100), Expect = 0.000e+0
Identity = 430/793 (54.22%), Postives = 564/793 (71.12%), Query Frame = 2
Query:  644 EEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSL-DYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLD-EETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVP 3001
            EE   IE V++ R+G  G TG  T+ Y      +     + N +  + QYLIKW+ WSHIH+TWE+E T++  QN  GMKKL  +K+  +  + W K+ ASPED++    ++E  + L +Q    ERII     K++  L DY  KW+ L Y   +WE G +I K  F   I E+  R++S   P + C+ L +RP+F  +++QP Y+     ++LRDYQL+G+NWLAH+W +GNS ILADEMGLGKTIQTI FL+YLF++H ++GPFLLVVPLST++SWQ E   WA  MN ++Y GD  SR +IR  EW  P+ K LKF++ +TTYE+LLKDK +L  ++WAF+GVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF++W DFE+ +      +  E   + L+K LEPFLLRR KKDVEKSLP+K EQI+R+ M   Q + YK ILT+NY+ALSK ++G TS FLNI+MELKKCCNH  L+ P D  E  NK +   HL   I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL  R + FQRLDGSIKG LRKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K S+EE I+E AK+KMVLDHLVIQRMD+     LH  +  + + PF+K+EL+ ILKFGA +LF + E  ++E +   I +IL+RAET  ++    +  ++LLS FKV N +    DED + +  +   K W +I+P
Sbjct:  267 EEFETIERVMDCRVGRKGATGATTTIYAVEADGDPNAGFERNKEPGDIQYLIKWKGWSHIHNTWETEETLKQ-QNVRGMKKLDNYKKKDQETKRWLKN-ASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGLPDYYCKWQGLPYSECSWEDGALISKK-FQTCIDEYFSRNQSKTTPFKDCKVLKQRPRFVALKKQPSYIGGHEGLELRDYQLNGLNWLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQTWASQMNAVVYLGDINSRNMIRTHEWMHPQTKRLKFNILLTTYEILLKDKAFLGGLNWAFIGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFSSWEDFEEEHG-----KGREYGYASLHKELEPFLLRRVKKDVEKSLPAKVEQILRMEMSALQKQYYKWILTRNYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKPPDNNEFYNKQEALQHL---IRSSGKLILLDKLLIRLRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGSVEEDILERAKKKMVLDHLVIQRMDTTGKTVLHTGSAPSSSTPFNKEELSAILKFGAEELFKEPEGEEQEPQEMDIDEILKRAETHENEPGPLSVGDELLSQFKVANFSNM--DEDDIELEPERNSKNWEEIIP 1046          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Mouse
Match: Chd3 (chromodomain helicase DNA binding protein 3 [Source:MGI Symbol;Acc:MGI:1344395])

HSP 1 Score: 522.702 bits (1345), Expect = 7.844e-156
Identity = 307/766 (40.08%), Postives = 447/766 (58.36%), Query Frame = 2
Query:  779 TERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREI--------------WKKHHASPEDLDAAQFEEERNESLLQQK-MECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNG--------IIEFEERSRSVKIPNRKCEALTRRPKFAPIRE-------QPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYF--------------PKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXX---------XXIQDILQRAETTNHDDESHNPANDLLSAFKVV 2917
            +ER++ +KW   S+ H +W  E  ++ +        L+ ++  Q++ ++               K      +D   A+ EE+     ++ + M   RII+   +K  +   YL+KWK L Y  STWE  ++ +     +         +I  E+ ++  K   +K E     P  +P  +       QP +++ T    L  YQL+G+NWL  +W +G   ILADEMGLGKTIQTI FL  L+ +    GPFL+  PLSTI +W+ EF +WAP   ++ YTGD  SR +IRE E+ F               ++  +KFHV +T+YEL+  D+  L  I WA L VDEAHRLKN++S+ +  L  +  + +LL+TGTP+ N+L EL+ LL+F+ P++FN    F + +     +   E+ + +L+ +L P +LRR K DV K++P+K+E I+RV +   Q + YK ILT+N+EAL+    G+  S LNI+M+LKKCCNH  L      E+             IKSSGK++LL K++ +LKE+GHRVLIFSQM +MLD++ D+L   G+ ++R+DG I G+LR++AID FNA G+  FCFLLSTRAGGLGINLATADTVIIFDSDWNP ND+QA +RAHRIGQ  +V +YRFV + S+EE+I + AKRKM+L HLV+        R    +K    SK EL++ILKFG  +LF  + E + ++E           I  +L R +    D +  N  N+ LS+FKV 
Sbjct:  505 SEREFFVKWVGLSYWHCSWAKELQLEIFH-------LVMYRNYQRKNDMDEPPPLDYGSGEDDGKSDKRKVKDPHYAEMEEKYYRFGIKPEWMTVHRIINHSMDKKGN-YHYLVKWKDLPYDQSTWEEDEMNIPEYDDHKQSYWRHRELIMGEDPAQPRKYKKKKKELQGDGPPSSPTNDPTVKYETQPRFITATGGT-LHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLYSLYKEGHTKGPFLVSAPLSTIINWEREFQMWAPKFYVVTYTGDKDSRAIIRENEFSFEDNAIKGGKKAFKMKREAQVKFHVLLTSYELITIDQAALGSIRWACLVVDEAHRLKNNQSKFFRVLNGYKIDHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEF----ADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKYILTRNFEALNSRGGGNQVSLLNIMMDLKKCCNHPYLFPVAAMESPKLPSGAYEGGALIKSSGKLLLLQKMLRKLKEQGHRVLIFSQMTKMLDLLEDFLDYEGYKYERIDGGITGALRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASVEERITQVAKRKMMLTHLVV--------RPGLGSKAGSMSKQELDDILKFGTEELFKDENEGENKEEDSSVIHYDNEAIARLLDRNQDATEDTDVQN-MNEYLSSFKVA 1248          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Mouse
Match: Chd5 (chromodomain helicase DNA binding protein 5 [Source:MGI Symbol;Acc:MGI:3036258])

HSP 1 Score: 521.931 bits (1343), Expect = 1.961e-155
Identity = 309/780 (39.62%), Postives = 450/780 (57.69%), Query Frame = 2
Query:  782 ERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAA----QFEEERNESLLQQKME--------------CERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIV-------KNLFPNGIIEFEERSR----SVKIPNRKCEALTRRPKFAPIRE-------QPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFP--------------KKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLFX----------XXXXXXXXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAED 2941
            ER++ +KW   S+ H +W  E  ++ Y         + ++  Q++ ++       P D  +     + E+ +N+  L  KME                RI++   +K  D + YLIKWK L Y   TWE  +I +       +  + +  +   E +R     VK   +  +    +P   PI +       QP Y+  T    L  YQL+G+NWL  +W +G   ILADEMGLGKT+QTI FL  L+ +    GP+L+  PLSTI +W+ EF +WAP   ++ YTGD  SR VIRE E+ F               K+  +KFHV +T+YEL+  D+  L  I WA L VDEAHRLKN++S+ +  L ++  + +LL+TGTP+ N+L EL+ LL+F+ P++FN    F + +     +   E+ + +L+ +L P +LRR K DV K++P+K+E I+RV + + Q + YK ILT+N+EAL+ +  G+  S LNI+M+LKKCCNH  L      E     +        +KSSGK+MLL K++ +L+++GHRVLIFSQM +MLD++ D+L   G+ ++R+DG I G LR++AID FNA G+  FCFLLSTRAGGLGINLATADTVII+DSDWNP ND+QA +RAHRIGQ ++V +YRFV + S+EE+I + AKRKM+L HLV+        R    +K+   +K EL++ILKFG  +LF           +D  +    +  I  +L R +    D E  N  N+ LS+FKV       ED
Sbjct:  510 EREFFVKWAGLSYWHCSWVKELQLELYHT-------VMYRNYQRKNDM---DEPPPFDYGSGDEDGKSEKRKNKDPLYAKMEERFYRYGIKPEWMMVHRILNHSFDKKGD-IHYLIKWKDLPYDQCTWEIDEIDIPYYDNLKQAYWGHRELMLGEDARLPKRLVKKGKKLKDDKQEKPPDTPIVDPTVKFDKQPWYIDATGGT-LHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRGGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEF----ADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVV--------RPGLGSKSGSMTKQELDDILKFGTEELFKDDVEGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTELQN-MNEYLSSFKVAQYVVREED 1264          
BLAST of Chromodomain-helicase-DNA-binding protein vs. UniProt/SwissProt
Match: sp|O14647|CHD2_HUMAN (Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2 PE=1 SV=2)

HSP 1 Score: 953.74 bits (2464), Expect = 0.000e+0
Identity = 532/1078 (49.35%), Postives = 708/1078 (65.68%), Query Frame = 2
Query:  656 VIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKN----------------SDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDE-ETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXX-XXXXXXXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVG----------QVNXXXXXXXXXDNKETGGK-----------------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKA-----------VFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
             IE+VL+ R+G  G TG  T+ Y      +  G+ D   DE E QYLIKW+ WS+IHSTWESE ++Q  Q   G+KKL  FK+ +   + W     SPED++    ++E    L +Q    ER+I  + +K+                S+  +YL KW  L Y   +WE   +I K  F N I  F  R+ S  IP R+C+AL +RP+F  +++QP YL    +++LRDYQL+G+NWLAH+W + NSVILADEMGLGKTIQTI FLSYLF+QH ++GPFL+VVPLST++SWQ EF IWAP +N+++Y GD +SR  IRE EW   + K LKF+  ITTYE+LLKDK  L  I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF  W DFE+ +      +  E     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV M   Q + YK ILT+NY+AL+K TRG TS FLNIVMELKKCCNH  L+ P +E E EN  +    L   I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL ++ + FQRLDGSIKG +RKQA+DHFNA+GS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K ++EE+IIE AK+KMVLDHLVIQRMD+     L   +  + + PF+K+EL  ILKFGA DLF + + E  E QE++I +IL+ AE T  ++ S +  ++LLS FKV N     ++E++    HK     W +I+P++ R+K++EEE QK L E+ + PR R   K  Q            Q   +S   SE ++ +   K                  TD EI+  IK  KKF  PLER++ I  +AE++D +  ++  + + I N C +   E + + K+N +              I  + ++VK+I+Q  ++ ++LH+ +P + EE+ K+ L    K A++   W  EDD+RLL+G++E G  NWE IK D +LKLT KILP    ++PQ   L+TR +YLLK LR
Sbjct:  262 TIEKVLDSRLGKKGATGASTTVYAIEANGDPSGDFDTEKDEGEIQYLIKWKGWSYIHSTWESEESLQQ-QKVKGLKKLENFKKKEDEIKQWLGK-VSPEDVEYFNCQQELASELNKQYQIVERVIAVKTSKSTLGQTDFPAHSRKPAPSNEPEYLCKWMGLPYSECSWEDEALIGKK-FQNCIDSFHSRNNSKTIPTRECKALKQRPRFVALKKQPAYLG-GENLELRDYQLEGLNWLAHSWCKNNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLIVVPLSTLTSWQREFEIWAPEINVVVYIGDLMSRNTIREYEWIHSQTKRLKFNALITTYEILLKDKTVLGSINWAFLGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFEFWEDFEEDHG-----KGRENGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVEMSALQKQYYKWILTRNYKALAKGTRGSTSGFLNIVMELKKCCNHCYLIKPPEENERENGQEI---LLSLIRSSGKLILLDKLLTRLRERGNRVLIFSQMVRMLDILAEYLTIKHYPFQRLDGSIKGEIRKQALDHFNADGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTILENNSGRSNSNPFNKEELTAILKFGAEDLFKELEGEESEPQEMDIDEILRLAE-TRENEVSTSATDELLSQFKVANFATMEDEEELEERPHKD----WDEIIPEEQRKKVEEEERQKELEEIYMLPRIRSSTKKAQTNDSDSDTESKRQAQRSSASESETEDSDDDKKPKRRGRPRSVRKDLVEGFTDAEIRRFIKAYKKFGLPLERLECIARDAELVDKSVADLKRLGELIHNSCVSAMQEYEEQLKENASEGKGPGKRRGPTIKISGVQVNVKSIIQHEEEFEMLHKSIPVDPEEKKKYCLTCRVKAAHFDVEWGVEDDSRLLLGIYEHGYGNWELIKTDPELKLTDKILPVETDKKPQGKQLQTRADYLLKLLR 1322          

HSP 2 Score: 58.9214 bits (141), Expect = 4.896e-7
Identity = 32/93 (34.41%), Postives = 51/93 (54.84%), Query Frame = 2
Query: 4013 FDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            F  C +RM+P+K  LK L+   +  G  ++   +   +CLL IG+ I   +  + + E  + WR  LW FV+ F + F    LH++YK A+KK
Sbjct: 1469 FSICKERMRPVKKALKQLDKPDK--GLNVQEQLEHTRNCLLKIGDRIAECLKAYSDQEHIKLWRRNLWIFVSKFTE-FDARKLHKLYKMAHKK 1558          
BLAST of Chromodomain-helicase-DNA-binding protein vs. UniProt/SwissProt
Match: sp|E9PZM4|CHD2_MOUSE (Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus OX=10090 GN=Chd2 PE=1 SV=1)

HSP 1 Score: 949.503 bits (2453), Expect = 0.000e+0
Identity = 529/1078 (49.07%), Postives = 703/1078 (65.21%), Query Frame = 2
Query:  656 VIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKN----------------SDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVN-PLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXX-XXXXXXXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXD---------------------------NKETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVY-----------SECDTEEKKNKAVFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
             IE+VL+ R+G  G TG  T+ Y      +   + D   +E E QYLIKW+ WS+IHSTWESE ++Q  Q   G+KKL  FK+ +   + W     SPED++    ++E    L +Q    ER+I  + +K+                S+  +YL KW  L Y   +WE   +I K  F N I  F  R+ S  IP R+C+AL +RP+F  +++QP YL   S ++LRDYQL+G+NWLAH+W + NSVILADEMGLGKTIQTI FLSYLF+QH ++GPFL+VVPLST++SWQ EF IWAP +N+++Y GD +SR  IRE EW   + K LKF+  ITTYE+LLKDK  L  I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF  W DFE+ +      +  E     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV M   Q + YK ILT+NY+AL+K TRG TS FLNIVMELKKCCNH  L+  P D E E+  +    L+  I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL ++ + FQRLDGSIKG +RKQA+DHFNA+GS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K ++EE+IIE AK+KMVLDHLVIQRMD+     L   +  + + PF+K+EL  ILKFGA DLF + + E  E QE++I +IL+ AE T  ++ S +  ++LLS FKV N     ++E++    HK     W +I+P++ R+K++EEE QK L E+ + PR R   K  Q    +S +E   +                              K+     TD EI+  IK  KKF  PLER++ I  +AE++D +  ++  + + I N C +             SE     K+      I  + ++VK+I+Q  ++ ++LH+ +P + EE+ K+ L    K A++   W  EDD+RLL+G++E G  NWE IK D +LKLT KILP    ++PQ   L+TRV+YLLK LR
Sbjct:  262 TIEKVLDSRLGKKGATGASTTVYAVEANGDPSDDFDTEREEGEVQYLIKWKGWSYIHSTWESEDSLQQ-QKVKGLKKLENFKKKEDEVKQWLGK-VSPEDVEYFSCQQELASELNKQYQIVERVIAVKTSKSTLGQTDFPAHSRKPAPSNEPEYLCKWMGLPYSECSWEDEALIGKK-FQNCIDSFHSRNNSKTIPTRECKALKQRPRFVALKKQPAYLGGES-LELRDYQLEGLNWLAHSWCKSNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLIVVPLSTLTSWQREFEIWAPEINVVVYIGDLMSRNTIREYEWIHSQTKRLKFNALITTYEILLKDKTVLGSINWAFLGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFEFWEDFEEDHG-----KGRENGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVEMSALQKQYYKWILTRNYKALAKGTRGSTSGFLNIVMELKKCCNHCYLIKAPEDSERESGQEV---LQSLIRSSGKLILLDKLLTRLRERGNRVLIFSQMVRMLDILAEYLTIKHYPFQRLDGSIKGEIRKQALDHFNADGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTVLENNSGRSNSNPFNKEELTAILKFGAEDLFKEIEGEESEPQEMDIDEILRLAE-TRENEVSTSATDELLSQFKVANFATMEDEEELEERPHKD----WDEIIPEEQRKKVEEEERQKELEEIYMLPRIRSSTKKAQTNDSDSDTESKRQAQRSSASESETDDSDDDKKPKRRGRPRSVRKDLVEGFTDAEIRRFIKAYKKFGLPLERLECIARDAELVDKSVADLKRLGELIHNSCVSAMQEYEEQLKESTSEGKGPGKRRGPTIKISGVQVNVKSIIQHEEEFEMLHKSIPVDPEEKKKYCLTCRVKAAHFDVEWGVEDDSRLLLGIYEHGYGNWELIKTDPELKLTDKILPVETDKKPQGKQLQTRVDYLLKLLR 1322          

HSP 2 Score: 58.9214 bits (141), Expect = 4.351e-7
Identity = 32/93 (34.41%), Postives = 51/93 (54.84%), Query Frame = 2
Query: 4013 FDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            F  C +RM+P+K  LK L+   +  G  ++   +   +CLL IG+ I   +  + + E  + WR  LW FV+ F + F    LH++YK A+KK
Sbjct: 1469 FSICKERMRPVKKALKQLDKPDK--GLSVQEQLEHTRNCLLKIGDRIAECLKAYSDQEHIKLWRRNLWIFVSKFTE-FDARKLHKLYKMAHKK 1558          
BLAST of Chromodomain-helicase-DNA-binding protein vs. UniProt/SwissProt
Match: sp|B6ZLK2|CHD1_CHICK (Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus OX=9031 GN=CHD1 PE=1 SV=1)

HSP 1 Score: 930.628 bits (2404), Expect = 0.000e+0
Identity = 513/1058 (48.49%), Postives = 697/1058 (65.88%), Query Frame = 2
Query:  644 EEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSL-DYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDE-ETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDN----------------------KETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGC-NAVYSECDTEEKKN-------KAVFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            +E   IE+ ++ RIG  G TG  T+ Y   +  +     + + +  E QYLIKW+ WSHIH+TWE+E T++  QN  GMKKL  +K+  +  + W K+ ASPED++    ++E  + L +Q    ERII     K++    DY  KW+ L Y   +WE G +I K  F   I E+  R++S   P + C+ L +RP+F  +++QP Y+     ++LRDYQL+G+NWLAH+W +GNS ILADEMGLGKTIQTI FL+YLF++H ++GPFLLVVPLST++SWQ E   WAP MN ++Y GD  SR +IR  EW  P+ K LKF++ +TTYE+LLKDK +L  ++WAF+GVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF++W DFE+ +      +  E   + L+K LEPFLLRR KKDVEKSLP+K EQI+R+ M   Q + YK ILT+NY+ALSK ++G TS FLNI+MELKKCCNH  L+ P D+ E  NK +   HL   I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL  R + FQRLDGSIKG LRKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K S+EE I+E AK+KMVLDHLVIQRMD+     LH  +  + + PF+K+EL+ ILKFGA +LF + E  ++E +   I +IL+RAET  ++       ++LLS FKV N +    DED + +  +   + W +I+P+  R +I+EEE QK L E+ + PR R   K             S                           +E     +D EI+  IK  KKF  PLER+ ++  +AE++D +E ++  + + + NGC  A+      +E+            F I  + ++ K ++   ++L  LH+ +P + EER ++V+P  TK A++   W  EDD+ LLVG++E G  +WE IKMD DL LT KILP    ++PQA  L+TR +YL+K L
Sbjct:  265 DEFETIEKFMDSRIGRKGATGASTTIYAVEVDGDPNAGFEKSKELGEIQYLIKWKGWSHIHNTWETEETLKQ-QNVKGMKKLDNYKKKDQETKRWLKN-ASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALIAKK-FQARIDEYFSRNQSKTTPFKDCKVLKQRPRFVALKKQPSYIGGHESLELRDYQLNGLNWLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQTWAPQMNAVVYLGDITSRNMIRTHEWMHPQTKRLKFNILLTTYEILLKDKSFLGGLNWAFIGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFSSWEDFEEEHG-----KGREYGYASLHKELEPFLLRRVKKDVEKSLPAKVEQILRMEMSALQKQYYKWILTRNYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKPPDDNEFYNKQEALQHL---IRSSGKLILLDKLLIRLRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGSVEEDILERAKKKMVLDHLVIQRMDTTGKTVLHTGSTPSSSTPFNKEELSAILKFGAEELFKEPEGEEQEPQEMDIDEILKRAETRENEPGPLTVGDELLSQFKVANFSNM--DEDDIELEPERNSRNWEEIIPESQRRRIEEEERQKELEEIYMLPRMRNCAKQISFNGSEGRRSRSRRYSGSDSDSITERKRPKKRGRPRTIPRENIKGFSDAEIRRFIKSYKKFGGPLERLDAVARDAELVDKSETDLRRLGELVHNGCIKALKDNSSGQERAGGRLGKVKGPTFRISGVQVNAKLVISHEEELAPLHKSIPSDPEERKRYVIPCHTKAAHFDIDWGKEDDSNLLVGIYEYGYGSWEMIKMDPDLSLTQKILPDDPDKKPQAKQLQTRADYLIKLL 1309          

HSP 2 Score: 66.6254 bits (161), Expect = 2.438e-9
Identity = 35/101 (34.65%), Postives = 57/101 (56.44%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSE 4297
            E+    F  C +RM+P+K+ LK L+  ++    + +++      CL+ IG+HI   +  + N EQ +QWR  LW FV+ F + F    LH++YK A KK +
Sbjct: 1409 ELDQKTFSVCKERMRPVKAALKQLDRPEKGLSEREQLE--HTRQCLIKIGDHITECLKEYTNPEQIKQWRKNLWIFVSKFTE-FDARKLHKLYKHAIKKRQ 1506          
BLAST of Chromodomain-helicase-DNA-binding protein vs. UniProt/SwissProt
Match: sp|P40201|CHD1_MOUSE (Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus OX=10090 GN=Chd1 PE=1 SV=3)

HSP 1 Score: 929.087 bits (2400), Expect = 0.000e+0
Identity = 515/1058 (48.68%), Postives = 695/1058 (65.69%), Query Frame = 2
Query:  644 EEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSL-DYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLD-EETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDN----------------------KETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVY--SECDTEEKKNK------AVFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            EE   IE V++ R+G  G TG  T+ Y      +     + N +  + QYLIKW+ WSHIH+TWE+E T++  QN  GMKKL  +K+  +  + W K+ ASPED++    ++E  + L +Q    ERII     K++  L DY  KW+ L Y   +WE G +I K  F   I E+  R++S   P + C+ L +RP+F  +++QP Y+     ++LRDYQL+G+NWLAH+W +GNS ILADEMGLGKTIQTI FL+YLF++H ++GPFLLVVPLST++SWQ E   WA  MN ++Y GD  SR +IR  EW  P+ K LKF++ +TTYE+LLKDK +L  ++WAF+GVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF++W DFE+ +      +  E   + L+K LEPFLLRR KKDVEKSLP+K EQI+R+ M   Q + YK ILT+NY+ALSK ++G TS FLNI+MELKKCCNH  L+ P D  E  NK +   HL   I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL  R + FQRLDGSIKG LRKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K S+EE I+E AK+KMVLDHLVIQRMD+     LH  +  + + PF+K+EL+ ILKFGA +LF + E  ++E +   I +IL+RAET  ++    +  ++LLS FKV N +    DED + +  +   K W +I+P++ R +++EEE QK L E+ + PR R   K             S                           +E     +D EI+  IK  KKF  PLER+ +I  +AE++D +E ++  + + + NGC      S   TE    +        F I  + ++ K ++   D+L  LH+ +P + EER ++ +P  TK A++   W  EDD+ LL+G++E G  +WE IKMD DL LT KILP    ++PQA  L+TR +YL+K L
Sbjct:  267 EEFETIERVMDCRVGRKGATGATTTIYAVEADGDPNAGFERNKEPGDIQYLIKWKGWSHIHNTWETEETLKQ-QNVRGMKKLDNYKKKDQETKRWLKN-ASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGLPDYYCKWQGLPYSECSWEDGALISKK-FQTCIDEYFSRNQSKTTPFKDCKVLKQRPRFVALKKQPSYIGGHEGLELRDYQLNGLNWLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQTWASQMNAVVYLGDINSRNMIRTHEWMHPQTKRLKFNILLTTYEILLKDKAFLGGLNWAFIGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFSSWEDFEEEHG-----KGREYGYASLHKELEPFLLRRVKKDVEKSLPAKVEQILRMEMSALQKQYYKWILTRNYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKPPDNNEFYNKQEALQHL---IRSSGKLILLDKLLIRLRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGSVEEDILERAKKKMVLDHLVIQRMDTTGKTVLHTGSAPSSSTPFNKEELSAILKFGAEELFKEPEGEEQEPQEMDIDEILKRAETHENEPGPLSVGDELLSQFKVANFSNM--DEDDIELEPERNSKNWEEIIPEEQRRRLEEEERQKELEEIYMLPRMRNCAKQISFNGSEGRRSRSRRYSGSDSDSISERKRPKKRGRPRTIPRENIKGFSDAEIRRFIKSYKKFGGPLERLDAIARDAELVDKSETDLRRLGELVHNGCVKALKDSSSGTERAGGRLGKVKGPTFRISGVQVNAKLVIAHEDELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGSWEMIKMDPDLSLTHKILPDDPDKKPQAKQLQTRADYLIKLL 1311          

HSP 2 Score: 66.6254 bits (161), Expect = 2.316e-9
Identity = 35/101 (34.65%), Postives = 57/101 (56.44%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSE 4297
            E+    F  C +RM+P+K+ LK L+  ++    + +++      CL+ IG+HI   +  + N EQ +QWR  LW FV+ F + F    LH++YK A KK +
Sbjct: 1408 ELDQKTFSICKERMRPVKAALKQLDRPEKGLSEREQLE--HTRQCLIKIGDHITECLKEYSNPEQIKQWRKNLWIFVSKFTE-FDARKLHKLYKHAIKKRQ 1505          
BLAST of Chromodomain-helicase-DNA-binding protein vs. UniProt/SwissProt
Match: sp|O14646|CHD1_HUMAN (Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=CHD1 PE=1 SV=2)

HSP 1 Score: 914.45 bits (2362), Expect = 0.000e+0
Identity = 511/1049 (48.71%), Postives = 689/1049 (65.68%), Query Frame = 2
Query:  671 LNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSL-DYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLD-EETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETG----GK------------------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVY--SECDTEEKKNK------AVFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            ++ RIG  G TG  T+ Y      +     + N +  E QYLIKW+ WSHIH+TWE+E T++  QN  GMKKL  +K+  +  + W K+ ASPED++    ++E  + L +Q    ERII     K++    DY  KW+ L Y   +WE G +I K  F   I E+  R++S   P + C+ L +RP+F  +++QP Y+     ++LRDYQL+G+NWLAH+W +GNS ILADEMGLGKTIQTI FL+YLF++H ++GPFLLVVPLST++SWQ E   WA  MN ++Y GD  SR +IR  EW   + K LKF++ +TTYE+LLKDK +L  ++WAF+GVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF++W DFE+ +      +  E   + L+K LEPFLLRR KKDVEKSLP+K EQI+R+ M   Q + YK ILT+NY+ALSK ++G TS FLNI+MELKKCCNH  L+ P D  E  NK +   HL   I+SSGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI+++YL  R + FQRLDGSIKG LRKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K S+EE I+E AK+KMVLDHLVIQRMD+     LH  +  + + PF+K+EL+ ILKFGA +LF + E  ++E +   I +IL+RAET  ++       ++LLS FKV N +    DED + +  +   K W +I+P+D R +++EEE QK L E+ + PR R   K             S      ++     GK                   +D EI+  IK  KKF  PLER+ +I  +AE++D +E ++  + + + NGC      S   TE    +        F I  + ++ K ++   ++L  LH+ +P + EER ++ +P  TK A++   W  EDD+ LL+G++E G  +WE IKMD DL LT KILP    ++PQA  L+TR +YL+K L
Sbjct:  278 MDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQ-QNVRGMKKLDNYKKKDQETKRWLKN-ASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKK-FQACIDEYFSRNQSKTTPFKDCKVLKQRPRFVALKKQPSYIGGHEGLELRDYQLNGLNWLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQTWASQMNAVVYLGDINSRNMIRTHEWTHHQTKRLKFNILLTTYEILLKDKAFLGGLNWAFIGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFSSWEDFEEEHG-----KGREYGYASLHKELEPFLLRRVKKDVEKSLPAKVEQILRMEMSALQKQYYKWILTRNYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKPPDNNEFYNKQEALQHL---IRSSGKLILLDKLLIRLRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGSVEEDILERAKKKMVLDHLVIQRMDTTGKTVLHTGSAPSSSTPFNKEELSAILKFGAEELFKEPEGEEQEPQEMDIDEILKRAETHENEPGPLTVGDELLSQFKVANFSNM--DEDDIELEPERNSKNWEEIIPEDQRRRLEEEERQKELEEIYMLPRMRNCAKQISFNGSEGRRSRSRRYSGSDSDSISEGKRPKKRGRPRTIPRENIKGFSDAEIRRFIKSYKKFGGPLERLDAIARDAELVDKSETDLRRLGELVHNGCIKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGSWEMIKMDPDLSLTHKILPDDPDKKPQAKQLQTRADYLIKLL 1313          

HSP 2 Score: 66.2402 bits (160), Expect = 2.908e-9
Identity = 35/101 (34.65%), Postives = 57/101 (56.44%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSE 4297
            E+    F  C +RM+P+K+ LK L+  ++    + +++      CL+ IG+HI   +  + N EQ +QWR  LW FV+ F + F    LH++YK A KK +
Sbjct: 1408 ELDQKTFSICKERMRPVKAALKQLDRPEKGLSEREQLE--HTRQCLIKIGDHITECLKEYTNPEQIKQWRKNLWIFVSKFTE-FDARKLHKLYKHAIKKRQ 1505          
BLAST of Chromodomain-helicase-DNA-binding protein vs. TrEMBL
Match: A0A075ADF9 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_00038 PE=4 SV=1)

HSP 1 Score: 1181.78 bits (3056), Expect = 0.000e+0
Identity = 634/1227 (51.67%), Postives = 820/1227 (66.83%), Query Frame = 2
Query:  161 RSLLDEIKENPDLYTTRRSERNRKEPSRFNILSERGSQGNRLSRKIYSGSTXXXXXXXXXXXXXFVYSKRNKKYNQKQKMEFRKRAHVSYKEVVTSDEDVGSDDSGQPKKKVAKINNSNGFTNVRDNPLLNKP-LILIR---------------------GEKIDNECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQN---FDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFP------KKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXX---LYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDE-LNEILKFGAADLFXXXXXXXXXXXXXIQDILQRAETTNHD--DESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNA---VYSECDTEEKK---NKA-VFTIRKIVISVKNILQSLDDLDILHQILPK-NKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            R L DE ++ P+LY  RRS R RKEP RF       ++  R  R     S  E    +++ D     S+ N K  +  +    +   V+YK     D    S+  G  ++  A        T         KP   L+R                      +  D E  +  Y D    E  +EE +VIEEVL   +   G  G  T+ YN  L+ +   + D +S+  E Q+LIKWR WSHIHSTWE+E ++++        G KKL  ++   K++E      A  EDL+   +EEERNE +L  KM+ ERI+   R+  +++ DYLIKW  LDYR+ +WESG  +V+ L+P  +  +E R RS ++PN KCE L  RPKFAP+ EQPDYL  ++D+KLRDYQL+G+NW+  AW R NSVILADEMGLGKTIQTIGFLS LF+++ ++GPFL+VVPLST+SSWQ E  +WAP MN +IYTGD VSRQ+IRE EW         ++++LKF+VCITTYE+LLKDK WL ++SWAFLGVDEAHRLKND SQLY  L TFDTNTRLLITGTP+ N+++ELWALLHFIMP++F  W +FE  Y+++ ++            L+KVL PFLLRR KKDVE SLP K E+I+RV M ++Q  +Y+LIL +NY+ L K TRGH +SF+NIVMELKKCCNH  L+ P  E  +     D +L   I+ SGKM LLDKL+  LK KGHRVLIFSQMVRMLD+ISDYL LRGWGFQRLDGSI+G+LRKQA+DHFNA+GSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQA ARAHRIGQ +QVSVYR V + S+EEKIIE A RKMVLDHLVIQRMDSA   ++  ++    SK + L EIL++GA  LFN+++E   E E++I DIL RAET + D   E+H PAN LLS+FKVV +    +D D  +    G  K W +I+P + R ++K EE QK L+ELELGPR+RK+VKA+Q G   S+ + S E+D K    +L++KEI+++++ +K+F RPLERI +I  +AE+ D TEKE+ +V+  ++ GC +   + ++   EE +   NK  VF   ++ I+ K +LQSL+ L+ LHQ LP+  KE R+ F LPF  KL  WSC W+  DD RLL GV+E G DNWEAIK+D DL L SK+LP SASERPQASH+R+RV+YLL+ L
Sbjct:   58 RELRDEFEDYPELYGIRRSGRCRKEPFRFKPSDAAAARIRRKKRDSDGDSDGEGQTTDDSSD-----SQWNGKAKRPNRSVRTRGNRVNYKNAFLDDSSDESEAEGYDRRPAANNRTLQTSTQNSQQTTFQKPKGPLVRKLCSSRLAARTDFDGKQSGGSPQLSDEELADTPYQDADWGE--AEEADVIEEVLTHAVRRKGALGNPTTLYNTKLEKDLNADFDPSSEPGELQFLIKWRNWSHIHSTWETEASLKSPDRGCPVYGFKKLAAYQASLKQKEE-NMRFAEREDLETMAYEEERNEQILSDKMQVERIVAHSRDPETNTFDYLIKWCRLDYRFCSWESGK-VVRALYPPAVENYEARCRSTELPNNKCEVLHTRPKFAPLTEQPDYLGDSADLKLRDYQLEGINWMLRAWCRNNSVILADEMGLGKTIQTIGFLSCLFHEYKLYGPFLIVVPLSTVSSWQKELQLWAPRMNALIYTGDHVSRQLIREHEWSAGSSGGSRRQQVLKFNVCITTYEILLKDKSWLGQVSWAFLGVDEAHRLKNDASQLYKTLKTFDTNTRLLITGTPLQNTMKELWALLHFIMPERFPVWEEFEGSYSVAEDDPAARVDGEAFHHLHKVLRPFLLRRVKKDVESSLPEKIERILRVDMTKEQANIYRLILARNYDGLMKVTRGHKASFINIVMELKKCCNHAHLIAPPQENDKRLWTNDEYLWSLIRGSGKMTLLDKLLQRLKSKGHRVLIFSQMVRMLDLISDYLTLRGWGFQRLDGSIRGALRKQALDHFNADGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAQARAHRIGQTKQVSVYRLVTQESVEEKIIESATRKMVLDHLVIQRMDSAGGSRSAVSRKGETSKGQLLTEILRYGAEGLFNRNDEDVAELEVDIDDILNRAETRDTDATAEAH-PANALLSSFKVVTLDTVDDDMDSNHPLAVGPEKSWDEIIPSEFRGQLKAEEIQKTLVELELGPRRRKQVKAFQAGMDYSSDDSSEEQDGKAAPTQLSEKEIRALVRAIKRFARPLERIDAIAADAELPDRTEKELLEVVDAVLKGCQSAMEIANQAVNEEAQKPTNKGPVFQYGRVSIAAKPLLQSLEYLETLHQCLPEGGKEARMNFELPFVPKLVTWSCPWDASDDVRLLAGVYEHGYDNWEAIKLDADLGLGSKLLPMSASERPQASHIRSRVDYLLRML 1274          

HSP 2 Score: 65.855 bits (159), Expect = 1.262e-6
Identity = 37/106 (34.91%), Postives = 56/106 (52.83%), Query Frame = 2
Query: 3980 EHLFYEMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSE 4297
            E  F +M+GPLF KC +++ PIK   K LE ++       + D KQ S  +L IG++I +++    + + K  W+ Y W FV  F      E  H IYK A K+ +
Sbjct: 1419 EEEFRKMRGPLFLKCKEKLLPIKKHFKHLEHLE----DSPEEDAKQFSKVVLRIGDYIHNLVHEITDKKNKHLWKGYFWEFVQIFSKKSTDELRH-IYKHAAKRRQ 1519          
BLAST of Chromodomain-helicase-DNA-binding protein vs. TrEMBL
Match: A0A1S8WHI8 (Protein, SNF2 family (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_10301 PE=4 SV=1)

HSP 1 Score: 1181.39 bits (3055), Expect = 0.000e+0
Identity = 634/1233 (51.42%), Postives = 821/1233 (66.59%), Query Frame = 2
Query:  161 RSLLDEIKENPDLYTTRRSERNRKEPSRFNILSERGSQGNRLSRKIYSGSTXXXXXXXXXXXXXFVYSKRNKKYNQKQKMEFRKRA------HVSYKEVVTSDEDVGSDDSGQPKKKVAKINNSNGFTNVRDNPLLNKP-LILIR---------------------GEKIDNECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQN---FDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFP------KKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXX---LYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDE-LNEILKFGAADLFXXXXXXXXXXXXXIQDILQRAETTNHD--DESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNA---VYSECDTEEKK---NKA-VFTIRKIVISVKNILQSLDDLDILHQILPK-NKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            R L DE ++ P+LY  RRS R RKEP RF       ++  R  R     S  E    +++          + ++N K K+    R+       V+YK     D    S+  G  ++  A        T         KP   L+R                      +  D E  +  Y D    E  +EE +VIEEVL   +   G  G  T+ YN  L+ +   + D +S+  E Q+LIKWR WSHIHSTWE+E ++++        G KKL  ++   K++E      A  EDL+   +EEERNE +L  KM+ ERI+   R+  +++ DYLIKW  LDYR+ +WESG  +V+ L+P  +  +E R RS ++PN KCE L  RPKFAP+ EQPDYL  ++D+KLRDYQL+G+NW+  AW R NSVILADEMGLGKTIQTIGFLS LF+++ ++GPFL+VVPLST+SSWQ E  +WAP MN +IYTGD VSRQ+IRE EW         ++++LKF+VCITTYE+LLKDK WL ++SWAFLGVDEAHRLKND SQLY  L TFDTNTRLLITGTP+ N+++ELWALLHFIMP++F  W +FE  Y+++ ++            L+KVL PFLLRR KKDVE SLP K E+I+RV M ++Q  +Y+LIL +NY+ L K TRGH +SF+NIVMELKKCCNH  L+ P  E  +     D +L   I+ SGKM LLDKL+  LK KGHRVLIFSQMVRMLD+ISDYL LRGWGFQRLDGSI+G+LRKQA+DHFNA+GSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQA ARAHRIGQ +QVSVYR V + S+EEKIIE A RKMVLDHLVIQRMDSA   ++  ++    SK + L EIL++GA  LFN+++E   E E++I DIL RAET + D   E+H PAN LLS+FKVV +    +D D  +    G  K W +I+P + R ++K EE QK L+ELELGPR+RK+VKA+Q G   S+ + S E+D K    +L++KEI+++++ +K+F RPLERI +I  +AE+ D TEKE+ +V+  ++ GC +   + ++   EE +   NK  VF   ++ I+ K +LQSL+ L+ LHQ LP+  KE R+ F LPF  KL  WSC W+  DD RLL GV+E G DNWEAIK+D DL L SK+LP SASERPQASH+R+RV+YLL+ L
Sbjct:   38 RELRDEFEDYPELYGIRRSGRCRKEPFRFKPSDAAAARIRRKKRDSDGDSDGEGQTTDDSS---------DSQWNGKAKVPRPNRSVRTRGNRVNYKNAFLDDSSDESEAEGYDRRPAANNRTLQTSTQNSQQTTFQKPKGPLVRKLCSSRLAARTDFDGKQSGGSPQLSDEELADTPYQDADWGE--AEEADVIEEVLTHAVRRKGALGNPTTLYNTKLEKDLNADFDPSSEPGELQFLIKWRNWSHIHSTWETEASLKSPDRGCPVYGFKKLAAYQASLKQKEE-NMRFAEREDLETMAYEEERNEQILSDKMQVERIVAHSRDPETNTFDYLIKWCRLDYRFCSWESGK-VVRALYPPAVENYEARCRSTELPNNKCEVLHTRPKFAPLTEQPDYLGDSADLKLRDYQLEGINWMLRAWCRNNSVILADEMGLGKTIQTIGFLSCLFHEYKLYGPFLIVVPLSTVSSWQKELQLWAPRMNALIYTGDHVSRQLIREHEWSAGSSGGSRRQQVLKFNVCITTYEILLKDKSWLGQVSWAFLGVDEAHRLKNDASQLYKTLKTFDTNTRLLITGTPLQNTMKELWALLHFIMPERFPVWEEFEGSYSVAEDDPAARVDGEAFHHLHKVLRPFLLRRVKKDVESSLPEKIERILRVDMTKEQANIYRLILARNYDGLMKVTRGHKASFINIVMELKKCCNHAHLIAPPQENDKRLWTNDEYLWSLIRGSGKMTLLDKLLQRLKSKGHRVLIFSQMVRMLDLISDYLTLRGWGFQRLDGSIRGALRKQALDHFNADGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAQARAHRIGQTKQVSVYRLVTQESVEEKIIESATRKMVLDHLVIQRMDSAGGSRSAVSRKGETSKGQLLTEILRYGAEGLFNRNDEDVAELEVDIDDILNRAETRDTDATAEAH-PANALLSSFKVVTLDTVDDDMDSNHPLAVGPEKSWDEIIPSEFRGQLKAEEIQKTLVELELGPRRRKQVKAFQAGMDYSSDDSSEEQDGKAAPTQLSEKEIRALVRAIKRFARPLERIDAIAADAELPDRTEKELLEVVDAVLKGCQSAMEIANQAVNEEAQKPTNKGPVFQYGRVSIAAKPLLQSLEYLETLHQCLPEGGKEARMNFELPFVPKLVTWSCPWDASDDVRLLAGVYEHGYDNWEAIKLDADLGLGSKLLPMSASERPQASHIRSRVDYLLRML 1256          

HSP 2 Score: 65.855 bits (159), Expect = 1.223e-6
Identity = 37/106 (34.91%), Postives = 56/106 (52.83%), Query Frame = 2
Query: 3980 EHLFYEMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSE 4297
            E  F +M+GPLF KC +++ PIK   K LE ++       + D KQ S  +L IG++I +++    + + K  W+ Y W FV  F      E  H IYK A K+ +
Sbjct: 1401 EEEFRKMRGPLFLKCKEKLLPIKKHFKHLEHLE----DSPEEDAKQFSKVVLRIGDYIHNLVHEITDKKNKHLWKGYFWEFVQIFSKKSTDELRH-IYKHAAKRRQ 1501          
BLAST of Chromodomain-helicase-DNA-binding protein vs. TrEMBL
Match: A0A4S2LRS0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005288 PE=4 SV=1)

HSP 1 Score: 1177.16 bits (3044), Expect = 0.000e+0
Identity = 623/1205 (51.70%), Postives = 814/1205 (67.55%), Query Frame = 2
Query:  161 RSLLDEIKENPDLYTTRRSERNRKEPSRFNILSERGSQGNRLSRKIYSGSTXXXXXXXXXXXXXFVYSKRNKKYNQKQKMEFRKRAHVSYKEVVTSDEDVGSDDSGQPKKKVAKINNSNGFTNVRDNPLLNKPLILIRGEKIDNECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQN---FDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFP------KKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXX---LYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDE-LNEILKFGAADLFXXXXXXXXXXXXXIQDILQRAETTNHD--DESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSEC------DTEEKKNKA-VFTIRKIVISVKNILQSLDDLDILHQILPK-NKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            R L DE ++ P+LY  RRS R RKEP RF       ++  R  ++   G +  E    ++       S+ N K  +  +    +   V+YK     D     +  G  ++     NN    ++ ++    +        +  D E  +  Y D    E  +EE +VIEEVL   +   G  G  T+ YN  L+ +   + D +S+  E Q+LIKWR WSHIHSTWE+E ++++        G KKL  ++   K +E      A  EDL+   +EEERNE +L  KM+ ERI+   R+  +++ DYLIKW  LDYR+ +WESG + V++L+   +  +E R RS ++PN KCE L  RPKFAP+ EQPDYL  ++D+KLRDYQL+G+NW+  AW R NSVILADEMGLGKTIQTIGFL  LF+++ ++GPFL+VVPLST+SSWQ E  +WAP MN +IYTGD VSRQ+IRE EW         ++++LKF+VCITTYE+LLKDK WL ++SWAFLGVDEAHRLKND SQLY  L TFDTNTRLLITGTP+ N+++ELWALLHF MP++F  W +FE  Y+++ ++            L+KVL PFLLRR KKDVE SLP K E+I+RV M ++Q  +Y+LIL +NY+ L K TRGH +SF+NIVMELKKCCNH  L+ P  E        D +L   I+ SGKM LLDKL+  LK KGHRVLIFSQMVRMLD+ISDYL LRGWGFQRLDGSI+G+LRKQA+DHFNA+GSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQA ARAHRIGQ +QVSVYR V + S+EEKIIE A RKMVLDHLVIQRMDSA   ++ A++    SK + L EIL++GA  LFN+++E   E E++I DIL RAET + D   E+H PAN LLS+FKVV +    +D D  ++   G  K W +I+P + R ++K EE QK L+ELELGPR+RK+VKA+Q G   S+ + S E+D K    +L++KEI+++++ +K+F RPLERI +I  +AE+ D TEKE+ +V+  ++ GC +           + ++  NK  VF   ++ I+ K +LQSL+ L+ LHQ LP+  KE R+ F LPF  KL  WSC W+  DD RLL GV+E G DNWEAIK+D DL L SK+LP SASERPQASH+R+RV+YLL+ L
Sbjct:   58 RELRDEFEDYPELYGIRRSGRCRKEPFRFKPSDAAAARIRRKKQRDSDGDSDGEGQTSDDSSD----SQWNGKTKRPNRSVRTRGNRVNYKNAFLDDSSDEYEAEGYDRRPAT--NNRTLQSSTQNRTDFDGKQSAGSPQLSDEELADTPYQDADWGE--AEEADVIEEVLTHAVRRKGALGNPTTLYNTKLEKDLNADFDPSSEPGELQFLIKWRNWSHIHSTWETEASLKSPDRGCPVYGFKKLAAYQASLKEKEE-NMRFAEREDLETMAYEEERNEQILSDKMQVERIVAHSRDPETNTFDYLIKWCRLDYRFCSWESGKV-VRSLYLPAVESYEARCRSTELPNSKCEVLHTRPKFAPLTEQPDYLGDSTDLKLRDYQLEGINWMLRAWCRNNSVILADEMGLGKTIQTIGFLCCLFHEYKLYGPFLIVVPLSTVSSWQKELQLWAPRMNALIYTGDHVSRQLIREHEWSAGSSGGSRRQQVLKFNVCITTYEILLKDKSWLGQVSWAFLGVDEAHRLKNDASQLYKTLKTFDTNTRLLITGTPLQNTMKELWALLHFSMPERFPVWEEFEGSYSVAEDDPATRVDGEAFHHLHKVLRPFLLRRVKKDVESSLPEKIERILRVDMTKEQANIYRLILARNYDGLMKVTRGHKASFINIVMELKKCCNHAHLIAPPQENDRRLWTNDEYLWSLIRGSGKMTLLDKLLQRLKPKGHRVLIFSQMVRMLDLISDYLTLRGWGFQRLDGSIRGALRKQALDHFNADGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAQARAHRIGQTKQVSVYRLVTQESVEEKIIESATRKMVLDHLVIQRMDSAGGSRSAASRKGETSKGQLLTEILRYGAEGLFNRNDEDFAELEVDIDDILNRAETRDTDATAEAH-PANALLSSFKVVTLDTVDDDMDSNHLLAVGPEKSWDEIIPSEFRGQLKAEEIQKTLVELELGPRRRKQVKAFQAGMDYSSDDSSEEQDGKAAPTQLSEKEIRALVRAIKRFARPLERIDAIAADAELPDRTEKELLEVVDAVLKGCQSAMEIANQAVNDEAQKPPNKGPVFQYGRVSIAAKPLLQSLEYLETLHQCLPEGGKEARMNFELPFVPKLVTWSCPWDASDDVRLLAGVYEHGYDNWEAIKLDADLGLGSKLLPMSASERPQASHIRSRVDYLLRML 1251          

HSP 2 Score: 65.855 bits (159), Expect = 1.109e-6
Identity = 37/106 (34.91%), Postives = 56/106 (52.83%), Query Frame = 2
Query: 3980 EHLFYEMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSE 4297
            E  F +M+GPLF KC +++ PIK   K LE ++       + D KQ S  +L IG++I +++    + + K  W+ Y W FV  F      E  H IYK A K+ +
Sbjct: 1396 EEEFRKMRGPLFLKCKEKLLPIKKHFKHLEHLE----DSPEEDAKQFSKVVLRIGDYIHNLVREITDKKNKHLWKGYFWEFVQIFSKKSTDELRH-IYKHAAKRRQ 1496          
BLAST of Chromodomain-helicase-DNA-binding protein vs. TrEMBL
Match: A0A4S2LXI3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005288 PE=4 SV=1)

HSP 1 Score: 1172.92 bits (3033), Expect = 0.000e+0
Identity = 626/1227 (51.02%), Postives = 813/1227 (66.26%), Query Frame = 2
Query:  161 RSLLDEIKENPDLYTTRRSERNRKEPSRFNILSERGSQGNRLSRKIYSGSTXXXXXXXXXXXXXFVYSKRNKKYNQKQKMEFRKRAHVSYKEVVTSDEDVGSDDSGQPKKKVAKINNSNGFTNVRDNPLLNKPL-ILIR---------------------GEKIDNECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQN---FDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFP------KKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXX---LYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDE-LNEILKFGAADLFXXXXXXXXXXXXXIQDILQRAETTNHD--DESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSEC------DTEEKKNKA-VFTIRKIVISVKNILQSLDDLDILHQILPK-NKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            R L DE ++ P+LY  RRS R RKEP RF       ++  R  ++   G +  E    ++       S+ N K  +  +    +   V+YK     D     +  G  ++           T         KP   L+R                      +  D E  +  Y D    E  +EE +VIEEVL   +   G  G  T+ YN  L+ +   + D +S+  E Q+LIKWR WSHIHSTWE+E ++++        G KKL  ++   K +E      A  EDL+   +EEERNE +L  KM+ ERI+   R+  +++ DYLIKW  LDYR+ +WESG + V++L+   +  +E R RS ++PN KCE L  RPKFAP+ EQPDYL  ++D+KLRDYQL+G+NW+  AW R NSVILADEMGLGKTIQTIGFL  LF+++ ++GPFL+VVPLST+SSWQ E  +WAP MN +IYTGD VSRQ+IRE EW         ++++LKF+VCITTYE+LLKDK WL ++SWAFLGVDEAHRLKND SQLY  L TFDTNTRLLITGTP+ N+++ELWALLHF MP++F  W +FE  Y+++ ++            L+KVL PFLLRR KKDVE SLP K E+I+RV M ++Q  +Y+LIL +NY+ L K TRGH +SF+NIVMELKKCCNH  L+ P  E        D +L   I+ SGKM LLDKL+  LK KGHRVLIFSQMVRMLD+ISDYL LRGWGFQRLDGSI+G+LRKQA+DHFNA+GSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQA ARAHRIGQ +QVSVYR V + S+EEKIIE A RKMVLDHLVIQRMDSA   ++ A++    SK + L EIL++GA  LFN+++E   E E++I DIL RAET + D   E+H PAN LLS+FKVV +    +D D  ++   G  K W +I+P + R ++K EE QK L+ELELGPR+RK+VKA+Q G   S+ + S E+D K    +L++KEI+++++ +K+F RPLERI +I  +AE+ D TEKE+ +V+  ++ GC +           + ++  NK  VF   ++ I+ K +LQSL+ L+ LHQ LP+  KE R+ F LPF  KL  WSC W+  DD RLL GV+E G DNWEAIK+D DL L SK+LP SASERPQASH+R+RV+YLL+ L
Sbjct:   58 RELRDEFEDYPELYGIRRSGRCRKEPFRFKPSDAAAARIRRKKQRDSDGDSDGEGQTSDDSSD----SQWNGKTKRPNRSVRTRGNRVNYKNAFLDDSSDEYEAEGYDRRPATNNRTLQSSTQNSQQTTFQKPKGPLVRKLCSSRLAARTDFDGKQSAGSPQLSDEELADTPYQDADWGE--AEEADVIEEVLTHAVRRKGALGNPTTLYNTKLEKDLNADFDPSSEPGELQFLIKWRNWSHIHSTWETEASLKSPDRGCPVYGFKKLAAYQASLKEKEE-NMRFAEREDLETMAYEEERNEQILSDKMQVERIVAHSRDPETNTFDYLIKWCRLDYRFCSWESGKV-VRSLYLPAVESYEARCRSTELPNSKCEVLHTRPKFAPLTEQPDYLGDSTDLKLRDYQLEGINWMLRAWCRNNSVILADEMGLGKTIQTIGFLCCLFHEYKLYGPFLIVVPLSTVSSWQKELQLWAPRMNALIYTGDHVSRQLIREHEWSAGSSGGSRRQQVLKFNVCITTYEILLKDKSWLGQVSWAFLGVDEAHRLKNDASQLYKTLKTFDTNTRLLITGTPLQNTMKELWALLHFSMPERFPVWEEFEGSYSVAEDDPATRVDGEAFHHLHKVLRPFLLRRVKKDVESSLPEKIERILRVDMTKEQANIYRLILARNYDGLMKVTRGHKASFINIVMELKKCCNHAHLIAPPQENDRRLWTNDEYLWSLIRGSGKMTLLDKLLQRLKPKGHRVLIFSQMVRMLDLISDYLTLRGWGFQRLDGSIRGALRKQALDHFNADGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAQARAHRIGQTKQVSVYRLVTQESVEEKIIESATRKMVLDHLVIQRMDSAGGSRSAASRKGETSKGQLLTEILRYGAEGLFNRNDEDFAELEVDIDDILNRAETRDTDATAEAH-PANALLSSFKVVTLDTVDDDMDSNHLLAVGPEKSWDEIIPSEFRGQLKAEEIQKTLVELELGPRRRKQVKAFQAGMDYSSDDSSEEQDGKAAPTQLSEKEIRALVRAIKRFARPLERIDAIAADAELPDRTEKELLEVVDAVLKGCQSAMEIANQAVNDEAQKPPNKGPVFQYGRVSIAAKPLLQSLEYLETLHQCLPEGGKEARMNFELPFVPKLVTWSCPWDASDDVRLLAGVYEHGYDNWEAIKLDADLGLGSKLLPMSASERPQASHIRSRVDYLLRML 1275          

HSP 2 Score: 65.855 bits (159), Expect = 1.179e-6
Identity = 37/106 (34.91%), Postives = 56/106 (52.83%), Query Frame = 2
Query: 3980 EHLFYEMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSE 4297
            E  F +M+GPLF KC +++ PIK   K LE ++       + D KQ S  +L IG++I +++    + + K  W+ Y W FV  F      E  H IYK A K+ +
Sbjct: 1420 EEEFRKMRGPLFLKCKEKLLPIKKHFKHLEHLE----DSPEEDAKQFSKVVLRIGDYIHNLVREITDKKNKHLWKGYFWEFVQIFSKKSTDELRH-IYKHAAKRRQ 1520          
BLAST of Chromodomain-helicase-DNA-binding protein vs. TrEMBL
Match: A0A4S2LYW4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005288 PE=4 SV=1)

HSP 1 Score: 1171.38 bits (3029), Expect = 0.000e+0
Identity = 627/1227 (51.10%), Postives = 815/1227 (66.42%), Query Frame = 2
Query:  161 RSLLDEIKENPDLYTTRRSERNRKEPSRFNILSERGSQGNRLSRKIYSGSTXXXXXXXXXXXXXFVYSKRNKKYNQKQKMEFRKRAHVSYKEVVTSDEDVGSDDSGQPKKKVAKINNSNGFTNVRDNPLLNKPL-ILIR--------------GEKI-------DNECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQN---FDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFP------KKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXX---LYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDE-LNEILKFGAADLFXXXXXXXXXXXXXIQDILQRAETTNHD--DESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSEC------DTEEKKNKA-VFTIRKIVISVKNILQSLDDLDILHQILPK-NKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            R L DE ++ P+LY  RRS R RKEP RF       ++  R  ++   G +  E    ++       S+ N K  +  +    +   V+YK     D     +  G  ++           T         KP   L+R              G++        D E  +  Y D    E  +EE +VIEEVL   +   G  G  T+ YN  L+ +   + D +S+  E Q+LIKWR WSHIHSTWE+E ++++        G KKL  ++   K +E      A  EDL+   +EEERNE +L  KM+ ERI+   R+  +++ DYLIKW  LDYR+ +WESG + V++L+   +  +E R RS ++PN KCE L  RPKFAP+ EQPDYL  ++D+KLRDYQL+G+NW+  AW R NSVILADEMGLGKTIQTIGFL  LF+++ ++GPFL+VVPLST+SSWQ E  +WAP MN +IYTGD VSRQ+IRE EW         ++++LKF+VCITTYE+LLKDK WL ++SWAFLGVDEAHRLKND SQLY  L TFDTNTRLLITGTP+ N+++ELWALLHF MP++F  W +FE  Y+++ ++            L+KVL PFLLRR KKDVE SLP K E+I+RV M ++Q  +Y+LIL +NY+ L K TRGH +SF+NIVMELKKCCNH  L+ P  E        D +L   I+ SGKM LLDKL+  LK KGHRVLIFSQMVRMLD+ISDYL LRGWGFQRLDGSI+G+LRKQA+DHFNA+GSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQA ARAHRIGQ +QVSVYR V + S+EEKIIE A RKMVLDHLVIQRMDSA   ++ A++    SK + L EIL++GA  LFN+++E   E E++I DIL RAET + D   E+H PAN LLS+FKVV +    +D D  ++   G  K W +I+P + R ++K EE QK L+ELELGPR+RK+VKA+Q G   S+ + S E+D K    +L++KEI+++++ +K+F RPLERI +I  +AE+ D TEKE+ +V+  ++ GC +           + ++  NK  VF   ++ I+ K +LQSL+ L+ LHQ LP+  KE R+ F LPF  KL  WSC W+  DD RLL GV+E G DNWEAIK+D DL L SK+LP SASERPQASH+R+RV+YLL+ L
Sbjct:   58 RELRDEFEDYPELYGIRRSGRCRKEPFRFKPSDAAAARIRRKKQRDSDGDSDGEGQTSDDSSD----SQWNGKTKRPNRSVRTRGNRVNYKNAFLDDSSDEYEAEGYDRRPATNNRTLQSSTQNSQQTTFQKPKGPLVRKLCSSRLAARTDFDGKQSAGSPQLSDEELADTPYQDADWGE--AEEADVIEEVLTHAVRRKGALGNPTTLYNTKLEKDLNADFDPSSEPGELQFLIKWRNWSHIHSTWETEASLKSPDRGCPVYGFKKLAAYQASLKEKEE-NMRFAEREDLETMAYEEERNEQILSDKMQVERIVAHSRDPETNTFDYLIKWCRLDYRFCSWESGKV-VRSLYLPAVESYEARCRSTELPNSKCEVLHTRPKFAPLTEQPDYLGDSTDLKLRDYQLEGINWMLRAWCRNNSVILADEMGLGKTIQTIGFLCCLFHEYKLYGPFLIVVPLSTVSSWQKELQLWAPRMNALIYTGDHVSRQLIREHEWSAGSSGGSRRQQVLKFNVCITTYEILLKDKSWLGQVSWAFLGVDEAHRLKNDASQLYKTLKTFDTNTRLLITGTPLQNTMKELWALLHFSMPERFPVWEEFEGSYSVAEDDPATRVDGEAFHHLHKVLRPFLLRRVKKDVESSLPEKIERILRVDMTKEQANIYRLILARNYDGLMKVTRGHKASFINIVMELKKCCNHAHLIAPPQENDRRLWTNDEYLWSLIRGSGKMTLLDKLLQRLKPKGHRVLIFSQMVRMLDLISDYLTLRGWGFQRLDGSIRGALRKQALDHFNADGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAQARAHRIGQTKQVSVYRLVTQESVEEKIIESATRKMVLDHLVIQRMDSAGGSRSAASRKGETSKGQLLTEILRYGAEGLFNRNDEDFAELEVDIDDILNRAETRDTDATAEAH-PANALLSSFKVVTLDTVDDDMDSNHLLAVGPEKSWDEIIPSEFRGQLKAEEIQKTLVELELGPRRRKQVKAFQAGMDYSSDDSSEEQDGKAAPTQLSEKEIRALVRAIKRFARPLERIDAIAADAELPDRTEKELLEVVDAVLKGCQSAMEIANQAVNDEAQKPPNKGPVFQYGRVSIAAKPLLQSLEYLETLHQCLPEGGKEARMNFELPFVPKLVTWSCPWDASDDVRLLAGVYEHGYDNWEAIKLDADLGLGSKLLPMSASERPQASHIRSRVDYLLRML 1275          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Cavefish
Match: chd2 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:103032281])

HSP 1 Score: 952.199 bits (2460), Expect = 0.000e+0
Identity = 561/1254 (44.74%), Postives = 769/1254 (61.32%), Query Frame = 2
Query:  155 RQRSLLDEIK----ENPDLYTTRRSERNRKEPSRFNILSERGSQGNRLSRKIYSGSTXXXXXXXXXXXXXFVYSKRNKKYNQKQKMEFRKRAHVSYKEVVTSDEDVGSDDSGQPKK--------KVAKINNSNGFTNVRDNPLLNKPLILIRGEKIDNECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKN------------SDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLV-NPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKP-KLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETGGK---------------------------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKAV-----------FTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
            +++  L E+K    E+PD+Y  RRS R+R EP+R NI    G++G+  S     G + +    ++        S   K+ NQ QK    K+   S +E    D+    DD   PK+        KV+   + N F    D+        LI       E  EG+ + Q       ++   IE+V++ R G  G TG  T+ Y    K +   + D   DE E Q+LIKW+ WS+IH+TWES  ++ T Q   GMKKL  FK+       W +  ASPEDL+    ++E    L +Q    ER+I  +  K+            S+  +YL KW  L Y   TWE G +I K  F + +  F  R+ S  +P+++C+ L +RP+F  +++QP Y+    +++LRDYQLDGVNWLAH+W R NSVILADEMGLGKTIQTI FLSYLF+QH ++GPFLLVVPLST++SWQ EF  WAP MN+++Y GD +SR+ IR+ EW   + K +KF+  +TTYE+LLKDK  L  I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHF+MPDKF +W DFED +      +  +     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV M  +Q + YK ILT+NY+ALSK TRG +S FLNIVMELKKCCNH  L+  P D + E    P   L+  ++ SGK++LLDKL+  LKE+G+RVL+FSQMVRMLDI++DYL ++ + FQRLDGSIKG +RKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K ++EE+IIE AK+KMVLDHLVIQRMD+     L   +  + + PF+K+EL  ILKFGA +LF + E  + E +   I +IL+ AE T   D+  +  ++LLS FKV N T    DE+   +  +GK  + W DI+P+D R +++EEE QK + ++ + PR R   K  Q    +S      +  N+ +G                              TD EI+  IK  KKF  PLER+++I  ++E++D +  ++  + + + N C     E + + K+N                I  + ++ K+I+Q  ++ + LH+ +P N  ER KF L    K+ ++   W+  DD +LL+G++E G  NW+ +K D DLKL+ KIL    +++PQA  L+ R +YLLK L+
Sbjct:   89 KKKESLAEVKKMWEEHPDVYGVRRSNRSRTEPARLNI----GAEGSSDS----EGESPKRKAPQQKKKQPQTKSSAAKQ-NQSQKGRKTKKQETSEEEDDDDDD---DDDEDTPKRQTRRRAATKVSYKEDQNDFETDSDD--------LI-------EMAEGAEEAQ------DDDSETIEKVMDTRTGKKGATGAATTLYAVEEKGDPGADFDLEKDEGETQFLIKWKGWSYIHNTWESIDSL-TQQKVKGMKKLENFKKKNDELNAWLRR-ASPEDLEYYNCQQELTTDLNKQFQIVERVIATKTGKSQVPSDFPSHKTTSNEPEYLCKWMGLPYAECTWEDGALISKK-FQSCVDSFNSRNSSKTVPSKECKVLKQRPRFVALKKQPSYIG-GENLELRDYQLDGVNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLLVVPLSTLTSWQREFCTWAPDMNVVVYLGDVLSRKTIRDYEWIHQQSKRIKFNALLTTYEILLKDKSVLGNINWAFLGVDEAHRLKNDDSLLYKTLIDFRSNHRLLITGTPLQNSLKELWSLLHFLMPDKFESWEDFEDEHG-----KGRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMSAQQKQFYKWILTRNYKALSKGTRGSSSGFLNIVMELKKCCNHGFLIKQPEDGDGET---PLERLQILVRGSGKLVLLDKLLTRLKERGNRVLVFSQMVRMLDILADYLTIKHYPFQRLDGSIKGEIRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTVLDNGSGNSNSNPFNKEELTAILKFGAEELFKEPEGEESEPQEMDIDEILRLAE-TRESDQGSSATDELLSQFKVANFT---MDENTPEL--EGKTVRDWDDIIPEDQRRRVEEEEKQKEMEDIYMLPRSRSSNKKLQANDSDSDVGSKLKLKNRSSGSDSETDDSDDDKKPKRRGRPRARKNNVEGFTDAEIRRFIKAYKKFGAPLERLEAIARDSELVDKSIADLKRLGELVHNTCVTAIQEHEEQMKENPTEAKGPGKRRGINIKISGVQVNAKSIIQHEEEFEPLHKAVPPNPAERNKFQLTCRLKVPHFDVDWDIHDDTQLLLGIYEHGYGNWDLLKTDADLKLSEKILLDDPNKKPQAKQLQMRADYLLKMLK 1291          

HSP 2 Score: 58.151 bits (139), Expect = 1.002e-7
Identity = 33/99 (33.33%), Postives = 52/99 (52.53%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            E+    F  C +RM+P+K  LK L+  +   G  ++   +    CLL IG+ I   + ++ + E  + WR  LW FV+ F + F    LH++YK A KK
Sbjct: 1424 ELDQETFSICKERMRPVKKALKQLD--KPDEGLSVQEQLQHTRACLLKIGDRITECLKSYSDPEHVKTWRRNLWIFVSKFTE-FGARKLHKLYKMAQKK 1519          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Cavefish
Match: chd2 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:103032281])

HSP 1 Score: 946.806 bits (2446), Expect = 0.000e+0
Identity = 563/1273 (44.23%), Postives = 772/1273 (60.64%), Query Frame = 2
Query:  155 RQRSLLDEIK----ENPDLYTTRRSERNRKEPSRFNILSERG---------------SQGNRLSRKIYSGSTXXXXXXXXXXXXXFVYSKRNK----KYNQKQKMEFRKRAHVSYKEVVTSDEDVGSDDSGQPKK--------KVAKINNSNGFTNVRDNPLLNKPLILIRGEKIDNECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKN------------SDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLV-NPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKP-KLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETGGK---------------------------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKAV-----------FTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
            +++  L E+K    E+PD+Y  RRS R+R EP+R NI +E G                QG+R+ R + S    +++              + K    K NQ QK    K+   S +E    D+    DD   PK+        KV+   + N F    D+      LI         E  EG+ + Q       ++   IE+V++ R G  G TG  T+ Y    K +   + D   DE E Q+LIKW+ WS+IH+TWES  ++ T Q   GMKKL  FK+       W +  ASPEDL+    ++E    L +Q    ER+I  +  K+            S+  +YL KW  L Y   TWE G +I K  F + +  F  R+ S  +P+++C+ L +RP+F  +++QP Y+    +++LRDYQLDGVNWLAH+W R NSVILADEMGLGKTIQTI FLSYLF+QH ++GPFLLVVPLST++SWQ EF  WAP MN+++Y GD +SR+ IR+ EW   + K +KF+  +TTYE+LLKDK  L  I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHF+MPDKF +W DFED +      +  +     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV M  +Q + YK ILT+NY+ALSK TRG +S FLNIVMELKKCCNH  L+  P D + E    P   L+  ++ SGK++LLDKL+  LKE+G+RVL+FSQMVRMLDI++DYL ++ + FQRLDGSIKG +RKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K ++EE+IIE AK+KMVLDHLVIQRMD+     L   +  + + PF+K+EL  ILKFGA +LF + E  + E +   I +IL+ AE T   D+  +  ++LLS FKV N T    DE+   +  +GK  + W DI+P+D R +++EEE QK + ++ + PR R   K  Q    +S      +  N+ +G                              TD EI+  IK  KKF  PLER+++I  ++E++D +  ++  + + + N C     E + + K+N                I  + ++ K+I+Q  ++ + LH+ +P N  ER K+ L    K+ ++   W+  DD +LL+G++E G  NW+ +K D DLKL+ KIL    +++PQA  L+ R +YLLK L+
Sbjct:   92 KKKESLAEVKKMWEEHPDVYGVRRSNRSRTEPARLNIGAEVGCLLIGVLMNRYTVLKGQGSRM-RDVLSSVVLQKHACFCLCVCACCIRPQTKSSAAKQNQSQKGRKTKKQETSEEEDDDDDD---DDDEDTPKRQTRRRAATKVSYKEDQNDFETDSDD------LI---------EMAEGAEEAQ------DDDSETIEKVMDTRTGKKGATGAATTLYAVEEKGDPGADFDLEKDEGETQFLIKWKGWSYIHNTWESIDSL-TQQKVKGMKKLENFKKKNDELNAWLR-RASPEDLEYYNCQQELTTDLNKQFQIVERVIATKTGKSQVPSDFPSHKTTSNEPEYLCKWMGLPYAECTWEDGALISKK-FQSCVDSFNSRNSSKTVPSKECKVLKQRPRFVALKKQPSYIG-GENLELRDYQLDGVNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLLVVPLSTLTSWQREFCTWAPDMNVVVYLGDVLSRKTIRDYEWIHQQSKRIKFNALLTTYEILLKDKSVLGNINWAFLGVDEAHRLKNDDSLLYKTLIDFRSNHRLLITGTPLQNSLKELWSLLHFLMPDKFESWEDFEDEHG-----KGRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMSAQQKQFYKWILTRNYKALSKGTRGSSSGFLNIVMELKKCCNHGFLIKQPEDGDGET---PLERLQILVRGSGKLVLLDKLLTRLKERGNRVLVFSQMVRMLDILADYLTIKHYPFQRLDGSIKGEIRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTVLDNGSGNSNSNPFNKEELTAILKFGAEELFKEPEGEESEPQEMDIDEILRLAE-TRESDQGSSATDELLSQFKVANFT---MDENTPEL--EGKTVRDWDDIIPEDQRRRVEEEEKQKEMEDIYMLPRSRSSNKKLQANDSDSDVGSKLKLKNRSSGSDSETDDSDDDKKPKRRGRPRARKNNVEGFTDAEIRRFIKAYKKFGAPLERLEAIARDSELVDKSIADLKRLGELVHNTCVTAIQEHEEQMKENPTEAKGPGKRRGINIKISGVQVNAKSIIQHEEEFEPLHKAVPPNPAERNKY-LTCRLKVPHFDVDWDIHDDTQLLLGIYEHGYGNWDLLKTDADLKLSEKILLDDPNKKPQAKQLQMRADYLLKMLK 1320          

HSP 2 Score: 57.7658 bits (138), Expect = 1.150e-7
Identity = 33/99 (33.33%), Postives = 52/99 (52.53%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            E+    F  C +RM+P+K  LK L+  +   G  ++   +    CLL IG+ I   + ++ + E  + WR  LW FV+ F + F    LH++YK A KK
Sbjct: 1454 ELDQETFSICKERMRPVKKALKQLD--KPDEGLSVQEQLQHTRACLLKIGDRITECLKSYSDPEHVKTWRRNLWIFVSKFTE-FGARKLHKLYKMAQKK 1549          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Cavefish
Match: chd2 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:103032281])

HSP 1 Score: 943.34 bits (2437), Expect = 0.000e+0
Identity = 519/1096 (47.35%), Postives = 704/1096 (64.23%), Query Frame = 2
Query:  593 ECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKN------------SDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLV-NPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKP-KLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETGGK---------------------------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKAV-----------FTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
            E  EG+ + Q       ++   IE+V++ R G  G TG  T+ Y    K +   + D   DE E Q+LIKW+ WS+IH+TWES  ++ T Q   GMKKL  FK+       W +  ASPEDL+    ++E    L +Q    ER+I  +  K+            S+  +YL KW  L Y   TWE G +I K  F + +  F  R+ S  +P+++C+ L +RP+F  +++QP Y+    +++LRDYQLDGVNWLAH+W R NSVILADEMGLGKTIQTI FLSYLF+QH ++GPFLLVVPLST++SWQ EF  WAP MN+++Y GD +SR+ IR+ EW   + K +KF+  +TTYE+LLKDK  L  I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHF+MPDKF +W DFED +      +  +     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV M  +Q + YK ILT+NY+ALSK TRG +S FLNIVMELKKCCNH  L+  P D + E    P   L+  ++ SGK++LLDKL+  LKE+G+RVL+FSQMVRMLDI++DYL ++ + FQRLDGSIKG +RKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K ++EE+IIE AK+KMVLDHLVIQRMD+     L   +  + + PF+K+EL  ILKFGA +LF + E  + E +   I +IL+ AE T   D+  +  ++LLS FKV N T    DE+   +  +GK  + W DI+P+D R +++EEE QK + ++ + PR R   K  Q    +S      +  N+ +G                              TD EI+  IK  KKF  PLER+++I  ++E++D +  ++  + + + N C     E + + K+N                I  + ++ K+I+Q  ++ + LH+ +P N  ER KF L    K+ ++   W+  DD +LL+G++E G  NW+ +K D DLKL+ KIL    +++PQA  L+ R +YLLK L+
Sbjct:  260 EMAEGAEEAQ------DDDSETIEKVMDTRTGKKGATGAATTLYAVEEKGDPGADFDLEKDEGETQFLIKWKGWSYIHNTWESIDSL-TQQKVKGMKKLENFKKKNDELNAWLRR-ASPEDLEYYNCQQELTTDLNKQFQIVERVIATKTGKSQVPSDFPSHKTTSNEPEYLCKWMGLPYAECTWEDGALISKK-FQSCVDSFNSRNSSKTVPSKECKVLKQRPRFVALKKQPSYIG-GENLELRDYQLDGVNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLLVVPLSTLTSWQREFCTWAPDMNVVVYLGDVLSRKTIRDYEWIHQQSKRIKFNALLTTYEILLKDKSVLGNINWAFLGVDEAHRLKNDDSLLYKTLIDFRSNHRLLITGTPLQNSLKELWSLLHFLMPDKFESWEDFEDEHG-----KGRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMSAQQKQFYKWILTRNYKALSKGTRGSSSGFLNIVMELKKCCNHGFLIKQPEDGDGET---PLERLQILVRGSGKLVLLDKLLTRLKERGNRVLVFSQMVRMLDILADYLTIKHYPFQRLDGSIKGEIRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTVLDNGSGNSNSNPFNKEELTAILKFGAEELFKEPEGEESEPQEMDIDEILRLAE-TRESDQGSSATDELLSQFKVANFT---MDENTPEL--EGKTVRDWDDIIPEDQRRRVEEEEKQKEMEDIYMLPRSRSSNKKLQANDSDSDVGSKLKLKNRSSGSDSETDDSDDDKKPKRRGRPRARKNNVEGFTDAEIRRFIKAYKKFGAPLERLEAIARDSELVDKSIADLKRLGELVHNTCVTAIQEHEEQMKENPTEAKGPGKRRGINIKISGVQVNAKSIIQHEEEFEPLHKAVPPNPAERNKFQLTCRLKVPHFDVDWDIHDDTQLLLGIYEHGYGNWDLLKTDADLKLSEKILLDDPNKKPQAKQLQMRADYLLKMLK 1331          

HSP 2 Score: 57.7658 bits (138), Expect = 1.192e-7
Identity = 33/99 (33.33%), Postives = 51/99 (51.52%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            E+    F  C +RM+P+K  LK L+      G  ++   +    CLL IG+ I   + ++ + E  + WR  LW FV+ F + F    LH++YK A KK
Sbjct: 1464 ELDQETFSICKERMRPVKKALKQLDKPD--EGLSVQEQLQHTRACLLKIGDRITECLKSYSDPEHVKTWRRNLWIFVSKFTE-FGARKLHKLYKMAQKK 1559          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Cavefish
Match: chd2 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:103032281])

HSP 1 Score: 942.954 bits (2436), Expect = 0.000e+0
Identity = 519/1096 (47.35%), Postives = 704/1096 (64.23%), Query Frame = 2
Query:  593 ECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKN------------SDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLV-NPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKP-KLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETGGK---------------------------LTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKAV-----------FTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
            E  EG+ + Q       ++   IE+V++ R G  G TG  T+ Y    K +   + D   DE E Q+LIKW+ WS+IH+TWES  ++ T Q   GMKKL  FK+       W +  ASPEDL+    ++E    L +Q    ER+I  +  K+            S+  +YL KW  L Y   TWE G +I K  F + +  F  R+ S  +P+++C+ L +RP+F  +++QP Y+    +++LRDYQLDGVNWLAH+W R NSVILADEMGLGKTIQTI FLSYLF+QH ++GPFLLVVPLST++SWQ EF  WAP MN+++Y GD +SR+ IR+ EW   + K +KF+  +TTYE+LLKDK  L  I+WAFLGVDEAHRLKND+S LY  LI F +N RLLITGTP+ NSL+ELW+LLHF+MPDKF +W DFED +      +  +     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV M  +Q + YK ILT+NY+ALSK TRG +S FLNIVMELKKCCNH  L+  P D + E    P   L+  ++ SGK++LLDKL+  LKE+G+RVL+FSQMVRMLDI++DYL ++ + FQRLDGSIKG +RKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K ++EE+IIE AK+KMVLDHLVIQRMD+     L   +  + + PF+K+EL  ILKFGA +LF + E  + E +   I +IL+ AE T   D+  +  ++LLS FKV N T    DE+   +  +GK  + W DI+P+D R +++EEE QK + ++ + PR R   K  Q    +S      +  N+ +G                              TD EI+  IK  KKF  PLER+++I  ++E++D +  ++  + + + N C     E + + K+N                I  + ++ K+I+Q  ++ + LH+ +P N  ER KF L    K+ ++   W+  DD +LL+G++E G  NW+ +K D DLKL+ KIL    +++PQA  L+ R +YLLK L+
Sbjct:  260 EMAEGAEEAQ------DDDSETIEKVMDTRTGKKGATGAATTLYAVEEKGDPGADFDLEKDEGETQFLIKWKGWSYIHNTWESIDSL-TQQKVKGMKKLENFKKKNDELNAWLRR-ASPEDLEYYNCQQELTTDLNKQFQIVERVIATKTGKSQVPSDFPSHKTTSNEPEYLCKWMGLPYAECTWEDGALISKK-FQSCVDSFNSRNSSKTVPSKECKVLKQRPRFVALKKQPSYIG-GENLELRDYQLDGVNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLLVVPLSTLTSWQREFCTWAPDMNVVVYLGDVLSRKTIRDYEWIHQQSKRIKFNALLTTYEILLKDKSVLGNINWAFLGVDEAHRLKNDDSLLYKTLIDFRSNHRLLITGTPLQNSLKELWSLLHFLMPDKFESWEDFEDEHG-----KGRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMSAQQKQFYKWILTRNYKALSKGTRGSSSGFLNIVMELKKCCNHGFLIKQPEDGDGET---PLERLQILVRGSGKLVLLDKLLTRLKERGNRVLVFSQMVRMLDILADYLTIKHYPFQRLDGSIKGEIRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTVLDNGSGNSNSNPFNKEELTAILKFGAEELFKEPEGEESEPQEMDIDEILRLAE-TRESDQGSSATDELLSQFKVANFT---MDENTPEL--EGKTVRDWDDIIPEDQRRRVEEEEKQKEMEDIYMLPRSRSSNKKLQANDSDSDVGSKLKLKNRSSGSDSETDDSDDDKKPKRRGRPRARKNNVEGFTDAEIRRFIKAYKKFGAPLERLEAIARDSELVDKSIADLKRLGELVHNTCVTAIQEHEEQMKENPTEAKGPGKRRGINIKISGVQVNAKSIIQHEEEFEPLHKAVPPNPAERNKFQLTCRLKVPHFDVDWDIHDDTQLLLGIYEHGYGNWDLLKTDADLKLSEKILLDDPNKKPQAKQLQMRADYLLKMLK 1331          

HSP 2 Score: 57.7658 bits (138), Expect = 1.104e-7
Identity = 33/99 (33.33%), Postives = 52/99 (52.53%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            E+    F  C +RM+P+K  LK L+  +   G  ++   +    CLL IG+ I   + ++ + E  + WR  LW FV+ F + F    LH++YK A KK
Sbjct: 1464 ELDQETFSICKERMRPVKKALKQLD--KPDEGLSVQEQLQHTRACLLKIGDRITECLKSYSDPEHVKTWRRNLWIFVSKFTE-FGARKLHKLYKMAQKK 1559          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Cavefish
Match: chd1 (chromodomain helicase DNA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7120])

HSP 1 Score: 925.62 bits (2391), Expect = 0.000e+0
Identity = 518/1065 (48.64%), Postives = 692/1065 (64.98%), Query Frame = 2
Query:  644 EEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSL-DYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLV-NPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAAD--LFXXXXXXXXXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDN---------------------------KETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSE--CDTEE-------KKNKAVFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            +E   +E V+  RIG  G TG  T+ Y      +   N +++    + QYLIKW+ WSHIH+TWE+E T++  QN  GMKKL  FK+ ++ ++ W K  ASPED++    ++E  + L  Q    ERII     K++    DYL KW+ L Y   +WE G +I +  F   I  +  R++S  IP R C+ L +RP+F P+++QP Y+     ++LRDYQLD +NW+AH+W +GNS ILADEMGLGKTIQTI FL+YLF++H ++GPFLLVVPLST++SWQ E ++WAP MN+++Y GD  SR +IR  EW   + K LKF++ +TTYE+LLKDK +L  +SWAF+GVDEAHRLKND+S LY  +I F +N RLLITGTP+ NSL+ELW+LLHFIMP+KF++W  FED + +       +   + L+K LEPFLLRR KKDVEKSLP+K EQI+RV M   Q + YK ILT+NY+ALSK T+G TS FLNI+MELKKCCNH  L+ +P D +  NK +   HL   I+SSGK++LLDKL+  LKE+GHRVLIFSQMVRMLDI+++YL  R + FQRLDGSIKG +RKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQKRQV++YR V K S+EE IIE AK+KMVLDHLVIQRMD+     LH     + + PF+K+EL+ ILKF                 QE++I +IL+RAET  +D        +LLS FKV N T   E+E  + +   G  + W DI+P++ R +++EEE QK L E+ L PR R   K     Q++    E     N                           +E     +D EI+  IK  KKF  PLER+ +I  +AE++D +E ++  + + + NGC     E  C  E+       K     F I  + ++ K ++   ++L  LH+ +P + EER ++ LP   K A++   W  EDD+ LL+G++E G  +WE IKMD DL LT K+LP    ++PQA  L+TR +YL+K L
Sbjct:  148 DEFETLERVMGIRIGRKGATGATTTVYAVEADGDPNANFNSSKQPGDVQYLIKWKGWSHIHNTWETEETLK-LQNVKGMKKLDNFKKKEQDKKKWLKS-ASPEDVEYFNCQQELMDDLHSQYQLVERIIGHSNQKSAAGYPDYLCKWQGLPYSECSWEDGALISRK-FQKCIDCYMSRNQSKTIPFRDCKVLKQRPRFMPMKKQPHYIG-GDGLELRDYQLDSLNWMAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIHLWAPQMNVVVYLGDISSRNMIRTHEWMHSQTKRLKFNILLTTYEILLKDKSFLGNVSWAFIGVDEAHRLKNDDSLLYKTMIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFHSWELFEDEHGM-----GRDSGYTSLHKELEPFLLRRVKKDVEKSLPAKVEQILRVEMSAMQKQYYKWILTRNYKALSKGTKGSTSGFLNIMMELKKCCNHCYLIKSPDDHDFYNKAEALQHL---IRSSGKLVLLDKLLVRLKERGHRVLIFSQMVRMLDILAEYLKSRQFLFQRLDGSIKGEMRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKRQVNIYRLVTKGSVEEDIIERAKKKMVLDHLVIQRMDTTGKTVLHTGAAPSSSTPFNKEELSAILKFDRCSYVFLMSLLCTVILQEMDIDEILKRAETRENDPGPSTVGEELLSQFKVANFTMMEEEE--IDMDADGNQRNWDDIIPEEQRRRMEEEERQKELAEIYLLPRMRNCAK-----QISFNGNEGRRSRNRRYSGSDSDSASDRKRPKKRGRPRTIPRENIKGFSDAEIRRFIKSYKKFGGPLERLDAIARDAELVDKSEHDLRRLAETVHNGCVKTLRENPCGPEKTSGGRRGKVKGPTFRISGVQVNAKLVISHEEELAPLHKAIPADPEERKRYTLPCHAKAAHFDIDWGKEDDSSLLIGIYEYGYGSWEMIKMDPDLNLTHKLLPDDPDKKPQAKQLQTRADYLIKLL 1193          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004254.1 (pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 gene:ENSPMAG00000003871.1 transcript:ENSPMAT00000004254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 334/533 (62.66%), Postives = 408/533 (76.55%), Query Frame = 2
Query: 1337 RGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMD----SALHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX--IQDILQRAETTNHDDESHNPAN-DLLSAFKV 2914
            RGNSVILADEMGLGKTIQTI FLSY+F+ H ++GPFLLVVPLST++SWQ EF  WAP MN+++Y GD  SR VIRE EW   + K LKF+  +TTYE+LLKDK  L  ++WAFLGVDEAHRLKND+S LY  LI F TN RLLITGTP+ NSL+ELW+LLHFIMPDKF+ W DF+  +         +     L+K LEPFLLRR KKDVE+SLP+K EQI+RV M  +Q   YK ILT+N++ALSK TRG TS FLNI+MELKKCCNH  L+   ++E  +K D    L+  ++SSGK++LLDKL+  L+E GHRVLIFSQMVRMLDI++DYL ++ + FQRLDGSIK   RKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V + ++EE IIE AK+KMVLDHLVIQRMD    + L + +  + + PF+K+EL  ILKFGA +LF + E  ++E +    I +IL+RAET  +DD     A  +LLS FKV
Sbjct:    2 RGNSVILADEMGLGKTIQTISFLSYMFHSHQVYGPFLLVVPLSTVTSWQREFATWAPEMNVVVYLGDMSSRNVIREYEWIHQQTKKLKFNALVTTYEILLKDKTVLGAVNWAFLGVDEAHRLKNDDSLLYKSLIEFKTNVRLLITGTPLQNSLKELWSLLHFIMPDKFSAWEDFDAVHG-----SGSDNGYVSLHKELEPFLLRRVKKDVERSLPAKVEQILRVEMTPQQKHYYKWILTRNFKALSKGTRGSTSGFLNIMMELKKCCNHCYLIKLPEDENVDKHDA---LQSLVRSSGKLILLDKLLCRLRETGHRVLIFSQMVRMLDILADYLAMKHFPFQRLDGSIKNEQRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTRGTVEEDIIERAKKKMVLDHLVIQRMDTTGKTVLQKGSAPSSSTPFNKEELASILKFGAEELFKEGEAEEQESQQEMDIDEILRRAETRENDDSLLPTAGEELLSQFKV 526          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 430.639 bits (1106), Expect = 1.574e-134
Identity = 229/518 (44.21%), Postives = 333/518 (64.29%), Query Frame = 2
Query: 1247 EQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGD-----AVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLF 2785
            E P Y+   +   +RDYQ+ G+NWL   +  G + ILADEMGLGKT+QTI  L Y+ +   I GP +++VP ST+ +W  EF  W P +  +   GD     + S+ ++   EW           VC+T+YE+++++K    K +W +L +DEAHR+KN++S+L   +  F T  RLL+TGTP+ N+L ELW+LL+F++PD FN+   F   ++ +N     +++V  L+ VL PFLLRR K DVEKSLP K E  I + + + Q E Y  IL K+ + L+   +      LNI+M+L+KCCNH  L +    E       D+H+   + +SGKM++LDKL+ +L E+G RVLIFSQM RM+DI+ DY + RG+ + RLDG      R+ +I  FNA  S+ F F+LSTRAGGLGINLATAD VI++DSDWNPQ DLQAM RAHRIGQK+ V V+RF+ ++++E++I+E A+ K+ LD +VIQ+    L  +  ANK     KDE+ +++++GA  +F
Sbjct:  102 ESPSYVKCGT---MRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMAEFERWVPSLRAVCLIGDKDHRVSASQPIVPPIEW----------DVCVTSYEMIIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADTFTSWFD-TNNCFGDQQLVERLHMVLRPFLLRRIKADVEKSLPPKKECKIYIGLSKMQREWYTKILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFD--GAEPGPPYTTDTHI---VINSGKMVVLDKLLPKLHEQGSRVLIFSQMTRMMDILEDYCMWRGYEYCRLDGQTPHEDRQVSIASFNAPDSSKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKVVRVFRFITESTVEDRIVERAEMKLRLDSIVIQQGPGRLVDQV-ANK---LGKDEMLQMIRYGATQVF 596          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 433.335 bits (1113), Expect = 1.734e-131
Identity = 230/518 (44.40%), Postives = 334/518 (64.48%), Query Frame = 2
Query: 1247 EQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGD-----AVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLF 2785
            E P Y+   +   +RDYQ+ G+NWL   +  G + ILADEMGLGKT+QTI  L Y+ +   I GP +++VP ST+ +W  EF  W P +  +   G+     A    V  + EW           VC+T+YE+++++K    K +W +L +DEAHR+KN++S+L + +  F +  RLL+TGTP+ N+L ELW+LL+F++PD FN+  DF+  ++ +N   + E V   L+ VL PFLLRR K DVEKSL  K E  I + + + Q E Y  IL K+ + L+   +      LNI+M+L+KCCNH  L +    E       D+HL   + +SGKM++LDKL+ +L+E+G RVL+FSQM RMLDI+ DY + +G+G+ RLDG      R++AI  +NA  S+ F F+LSTRAGGLGINLATAD VI++DSDWNPQ DLQAM RAHRIGQ ++V V+RF+ +N++EE+I+E A+ K+ LD +VIQ++ +       ANK     KDE+ ++++ GA  +F
Sbjct:  127 ESPTYVKGGT---MRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHHRNIQGPHMVLVPKSTLHNWMNEFERWVPSLRAVCLIGNKDQRVATDENVYTKREW----------DVCVTSYEIVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSDIVREFKSTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSSEDFDSWFDTNNCLGDQELVER-LHMVLRPFLLRRIKADVEKSLQPKKEVKIYIGLSKMQREWYTKILMKDIDILNSAGKMDKLRLLNILMQLRKCCNHPYLFD--GAEPGPPYTTDTHL---VNNSGKMVVLDKLLPKLQEQGSRVLLFSQMTRMLDILEDYCMWKGYGYCRLDGQTPHEDRQEAIAAYNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKRVRVFRFLTENTVEERIVERAEMKLRLDSIVIQQVCAGRLIDQQANK---LGKDEMLQMIRHGATHVF 622          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006729.1 (pep scaffold:Pmarinus_7.0:GL476370:400098:484196:-1 gene:ENSPMAG00000006035.1 transcript:ENSPMAT00000006729.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 409.068 bits (1050), Expect = 1.084e-124
Identity = 258/686 (37.61%), Postives = 392/686 (57.14%), Query Frame = 2
Query:  788 QYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEI-QKRREIWKKHHASPEDLDAAQ---FEEERNESLLQQKMECERIIDAQRNKNSDSLD----YLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWY---FPKKKMLKF---HVCITTYELLLKDKDWLNKISWAFLGVDE-AHRLKNDESQLYNFLITFDTNT-RLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKET-RGHTSSFLNIVMELKKCCNHVQLVNPLDE-------ETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGA 2773
            +Y +K++ +S++H  W S            M++L + K I QK +  W K          AQ   F +   E+     +E +RI+D     + D+ +    YL+KW +L Y  STWE    + +++    I EFE    +++     C+   R P  A  ++  D   + +  +LR+YQL+GVNWL   W    + ILADEMGLGKTIQ+I FL  +     + GPFL++ PLSTI++W+ EF  W   MN +++ G   SRQ+I++ E Y      K ++ F   +  +TT    LK    L+K  ++ + + E + R+      L + L  +     ++L+TGTP+ N++ EL++LL+F+ P +F +   F   +       + EE V +L  +L+P +LRR K+DVEK+L  K E II V +   Q + Y+ IL +N+  L+K   + +  + +N +MEL+KCCNH  L+N  +E       E      PD +L+  ++++GK++L+DKL+  L+E GH+VLIFSQMVR LDI+ DYLV + + ++R+DG ++G++R+ AID F    S  F FLL TRAGGLGINL  ADT IIFDSDWNPQNDLQA AR HRIGQ + V VYR + +NS E ++ + A  K+ LD  V+Q M     R+   N  Q  SK E+ ++L+ GA
Sbjct:   87 EYYVKYKNYSYLHCEWAS------------MQQLERDKRIHQKIKRFWIKR---------AQMNIFAQLDEEAFNPDYVEVDRILDVSHCSDPDTGEPVTYYLVKWCSLPYEDSTWE----LKEDIDQTRIDEFE----ALRARKHVCKRAERPPPKA-WKKLEDSREYKNGNQLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSIAFLQDV-ALAGVHGPFLVIAPLSTIANWEREFRTWTD-MNAVVFHGSVASRQMIQQYEMYTRDAQSKNIVGFCFYYEKVTTVHSHLKVLPELHKGLFSCIYLSEHSTRVITRRVLLMHLLELYGVEEHKVLLTGTPLQNTVEELFSLLNFLEPARFPSESSFLQEFG----QLKSEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILERNFSFLAKGAGQANLPNLMNTMMELRKCCNHPYLINGAEEKILSDFREAHGADVPDFYLQAMVQAAGKLVLIDKLLPRLREGGHKVLIFSQMVRCLDILEDYLVQKRYPYERIDGRVRGNMRQVAIDRFCKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDRAVLQSMSG---RENTTNGVQQMSKKEIEDLLRKGA 733          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Sea Lamprey
Match: SMARCA2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:HGNC Symbol;Acc:HGNC:11098])

HSP 1 Score: 371.703 bits (953), Expect = 6.237e-106
Identity = 205/484 (42.36%), Postives = 287/484 (59.30%), Query Frame = 2
Query: 1286 LRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLIT-FDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYN---------IXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYK------LILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEE-TENKMDPDSHLRY--YIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQ 2680
            L+ YQ+ G+ WL   +    + ILADEMGLGKTIQTI  ++YL     + GPFL++VPLST+S+W  EF+ W P +  I Y G  ++R+       + P+ +  KF+V +TTYE ++KDK  L K+ W ++ VDE HR+KN   +L   L T +    RLL+TGTP+ N L ELWALL+F++P  F +   FE  +N         +     E   ++  L+KVL PFLLRR KK+VE  LP K E +I+  M   Q  LY+      ++LT   E   K       + +N +++L+K  NH  +   ++E   E+   P+S ++     ++SGK  LLD+++ +L+   HRVL+F QM  ++ I+ DY   R + + RLDG+ K   R   +  FN   S  F FLLSTRAGGLG+NL  ADTVIIFDSDWNP  DLQA  RAHRIGQ+ +V V R    NS+EEKI+  AK K+ +D  VIQ
Sbjct:  736 LKMYQVQGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPFLIIVPLSTLSNWMMEFDKWGPSVVKISYKGSPIARRA------FMPQLRSGKFNVLLTTYEYIIKDKHVLAKLRWKYMIVDEGHRMKNHHCKLTQVLNTHYIAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFALTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKVLYRHMQAKGVLLTDGSEKDKKGKG-GAKTLMNTIVQLRKIANHPYMFQHIEESFAEHLGFPNSIVQGADLFRASGKFELLDRILPKLRVSNHRVLLFCQMTSLMTIMEDYFAFRSFRYLRLDGTTKSEDRSNLLKTFNEPNSPYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQ 1212          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Yeast
Match: CHD1 (Chromatin remodeler that regulates various aspects of transcription; acts in in conjunction with Isw1b to regulate chromatin structure and maintain chromatin integrity during transcription elongation by RNAP II by preventing trans-histone exchange over coding regions; contains a chromo domain, a helicase domain and a DNA-binding domain; component of both the SAGA and SLIK complexes [Source:SGD;Acc:S000000966])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 436/1135 (38.41%), Postives = 637/1135 (56.12%), Query Frame = 2
Query:  644 EEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKF--KEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDS---LDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYF-PK---KKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKF--NTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEET-----ENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXXIQDILQRAE---TTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVP-------QDLREKIKEEEHQKALLELELGPRQR---KKVKAYQVGQVNXXXXXXXXXDNKETG---------GKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEI-IDHTEK--EVYDVMKQIINGC-------------------NAVYSECDTEE--------------------KKNKAVFTIRKI-VISVKNILQSLDDLDILHQILPKN-KEERLKFVLPFETK--LANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKIL---------------------PS--------SASERPQASHLRTRVEYLLKKLR 3709
            E+ + I+ V+N R+     T +E     KVL  EK   D NN  E   ++LIKW + SH+H+TWE   T ++     G+K+L  +  + I + +++    + + ED++    E ER     ++    ERIID+QR    D    L YL+KW+ L+Y  +TWE+   IVK L P  +  F+ R  S  +P       ++RP+F  +  QP ++      +LRD+QL G+NW+A  W++G++ ILADEMGLGKT+QT+ F+S+L       GP ++VVPLST+ +W   F  WAP +N I Y G+  SR  IRE E+Y  P+   KK +KF+V +TTYE +LKD+  L  I W F+ VDEAHRLKN ES LY  L +F    R+LITGTP+ N+++EL AL++F+MP +F  +   DFE++      + E EE + +L++ ++PF+LRR KKDVEKSLPSK+E+I+RV +   QTE YK ILTKNY AL+   +G   S LNI+ ELKK  NH  L +  +E       + KM  ++ LR  I SSGKM+LLD+L+  LK+ GHRVLIFSQMVRMLDI+ DYL ++G  FQRLDG++  + R+ +IDHFN+  S DF FLLSTRAGGLGINL TADTV+IFDSDWNPQ DLQAMARAHRIGQK  V VYR V K+++EE+++E A++KM+L++ +I    +  ++ T   KN+P +  EL+ ILKFGA ++F   +   + ++LN+ D+L  AE   TT    ESH    + L  F+V   T+   D D            W DI+P       QD  +K K+EE+ K   +LE+  R+    KK+K    G   + + +S ++    +            + + E++++ K + KF    E +  ++ +  + +   EK  E YD M +    C                    A  ++  + E                    +K   +F  + +  ++ +++L  ++DL  L  ++  N K++ LKF L   T   + NWS  W  E+D +LL+GVF+ G  +W  I+ D  L +T KI                      PS        S+ + P A HL  RV+YLL  LR
Sbjct:  174 EDFHGIDIVINHRL----KTSLEEG---KVL--EKTVPDLNNCKEN-YEFLIKWTDESHLHNTWE---TYESIGQVRGLKRLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEATWENATDIVK-LAPEQVKHFQNRENSKILPQYSSNYTSQRPRFEKLSVQPPFIKGG---ELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQ------DEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYT--KKNEP-NAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEV---TDYKADID------------WDDIIPEEELKKLQDEEQKRKDEEYVKE--QLEMMNRRDNALKKIKNSVNGDGTAANSDSDDDSTSRSSRRRARANDMDSIGESEVRALYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRDDPFLGITDKIFLNEVHNPVAKKSASSSDTTPTPSKKGKGITGSSKKVPGAIHLGRRVDYLLSFLR 1265          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Yeast
Match: ISW2 (ATP-dependent DNA translocase involved in chromatin remodeling; ATPase component that, with Itc1p, forms a complex required for repression of a-specific genes, INO1, and early meiotic genes during mitotic growth; the Isw2 complex exhibits basal levels of chromatin binding throughout the genome as well as target-specific chromatin interactions; targeted by Ume6p- and Sua7p-dependent DNA looping to many loci genome-wide [Source:SGD;Acc:S000005831])

HSP 1 Score: 452.595 bits (1163), Expect = 2.208e-137
Identity = 255/544 (46.88%), Postives = 350/544 (64.34%), Query Frame = 2
Query: 1241 IREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDA-----VSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKET--RGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXXIQDILQRAE 2851
            + E P ++      KLRDYQ+ G+NWL        S ILADEMGLGKT+QTI FL YL     I GPFL++VP ST+ +W+ EF  W P +N+++  GD      + R +I E           +F V IT+YE+++++K+ L +++W ++ +DEAHR+KN++S L   +  F +  RLLITGTP+ N+L ELWALL+F++PD F     F++ +  +N  ++ E V+ +L+ VL PFLLRR K DVEKSL  K E  + V M   Q + YK +L K+ +A++     R   +  LNIVM+L+KCCNH  L      E       D HL   I +SGKM++LDKL+  LKEKG RVLIFSQM R+LDI+ DY   R + + R+DGS     R +AID +N   S  F FLL+TRAGGLGINL TADTVI+FDSDWNPQ DLQAM RAHRIGQK+QV VYRFV +N+IEEK+IE A +K+ LD LVIQ+      +KT +  N   SKD+L ++++FGA ++F + +      + +I DIL++ E
Sbjct:  172 VSESPSFVKSG---KLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIEGPFLIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIILEA----------RFDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDIFGDSELFDEWFEQNNSEQDQEIVIQQLHSVLNPFLLRRVKADVEKSLLPKIETNVYVGMTDMQIQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYLFEGA--EPGPPYTTDEHL---IFNSGKMIILDKLLKRLKEKGSRVLIFSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLDQLVIQQ---GTGKKTASLGN---SKDDLLDMIQFGAKNMF-EKKASKVTVDADIDDILKKGE 690          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Yeast
Match: ISW1 (ATPase subunit of imitation-switch (ISWI) class chromatin remodelers; with Ioc3p forms Isw1a complex involved in repression of transcription initiation; with Ioc2p and Ioc4p forms Isw1b complex involved in regulation of transcription elongation; Isw1b recruited to ORFs by H3K36 methylation and acts with Chd1p to prevent trans-histone exchange over coding regions; Isw1p import into nucleus depends on C-terminal bipartite nuclear targeting signal KRIR X19 KKAK [Source:SGD;Acc:S000000449])

HSP 1 Score: 429.098 bits (1102), Expect = 7.345e-129
Identity = 246/519 (47.40%), Postives = 337/519 (64.93%), Query Frame = 2
Query: 1241 IREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKML--KFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEAL--SKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLF 2785
             RE P Y++     +LR YQ+ GVNWL        + ILADEMGLGKT+QTI FL YL     I GPFL++ P ST+++W  E N W P +N  I  GD   R  + +       KK+L   F V I +YE+++++K  L KI+W ++ +DEAHR+KN+ES L   L  F +  RLLITGTP+ N+L ELWALL+F++PD F+   DF+D ++  +   + +++V +L+ VL+PFLLRR K DVE SL  K E  + V M   Q + YK IL K+ +A+  S  ++   +  LNI+M+L+KCCNH  L +    E       D HL Y   ++ K+ +LDKL+ +LKE+G RVLIFSQM R+LDI+ DY   R + + R+DGS     R QAID +NA  S  F FLL+TRAGGLGINL +AD V+++DSDWNPQ DLQAM RAHRIGQK+QV V+R V  NS+EEKI+E A +K+ LD LVIQ+  ++L +K    +N+  SKD L  +++ GAAD+F
Sbjct:  185 FRESPAYVNG----QLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIPGPFLVIAPKSTLNNWLREINRWTPDVNAFILQGDKEERAELIQ-------KKLLGCDFDVVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDAQDFDDWFSSESTEEDQDKIVKQLHTVLQPFLLRRIKSDVETSLLPKKELNLYVGMSSMQKKWYKKILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCNHPYLFD--GAEPGPPYTTDEHLVY---NAAKLQVLDKLLKKLKEEGSRVLIFSQMSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGINLTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLDQLVIQQNRTSLKKK----ENKADSKDALLSMIQHGAADVF 683          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Yeast
Match: STH1 (ATPase component of the RSC chromatin remodeling complex; required for expression of early meiotic genes; promotes base excision repair in chromatin; essential helicase-related protein homologous to Snf2p [Source:SGD;Acc:S000001388])

HSP 1 Score: 386.726 bits (992), Expect = 3.280e-112
Identity = 218/500 (43.60%), Postives = 312/500 (62.40%), Query Frame = 2
Query: 1241 IREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLIT--FDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXX-----------XXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFL----NIVMELKKCCNHVQLVNPLDEETENKMDP---DSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQ 2680
            I +QP  L   +   L++YQL G+ W+   +    + ILADEMGLGKTIQ+I  ++YL+      GPFL++VPLSTI++W  EF  WAP +N IIY G    R  ++       + ++  F V +TTYE ++KDK  L+K  WA + +DE HR+KN +S+L +F I+  + T  RL++TGTP+ N+L ELWALL+F++P  FN+   FED +N    N   +E +             L+KVL PFLLRR KK+VEK LP K E++I+  +   Q +LY+ +L  N   +   T G T   +    N +M+L+K CNH  + +    E E  ++P   +S L + +  +GK  LLD+++ + K  GHRVL+F QM +++DI+ D+L ++   + RLDGS K   R + ++ FNA  S  FCFLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQK +V + R +  +S+EE I+E A +K+ +D  VIQ
Sbjct:  458 IDKQPSILVGGT---LKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRHSLQH------QIRVGNFDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKL-SFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFD----EVEGVVNPSRGNSDLLFRV--AGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKVIQ 941          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Yeast
Match: SNF2 (Catalytic subunit of the SWI/SNF chromatin remodeling complex; involved in transcriptional regulation; contains DNA-stimulated ATPase activity; functions interdependently in transcriptional activation with Snf5p and Snf6p [Source:SGD;Acc:S000005816])

HSP 1 Score: 381.719 bits (979), Expect = 4.112e-109
Identity = 214/499 (42.89%), Postives = 306/499 (61.32%), Query Frame = 2
Query: 1241 IREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLIT-FDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYN-----------IXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEAL------SKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYI-KSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQ 2680
            I++QP  L   +   L+DYQ+ G+ W+   +    + ILADEMGLGKTIQTI  L+YL+    I GP+L++VPLST+S+W +EF  WAP +  I + G    R+  +       K +  +F V +TT+E ++K++  L+K+ W  + +DE HR+KN +S+L   L T +  + RL++TGTP+ N+L ELWALL+F++P  FN+   F++ +N           I     E   V+  L+KVL PFLLRR KKDVEK LP K E++++  M   Q  +Y+ +L   Y  L      +K+  G    F N +M+LKK CNH  +     EE E++++P       I + +GK  LLD+++ +LK  GHRVLIF QM +++DI+ D+L      + RLDG  K   R + +  FNA  S   CF+LSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQK +V + R +  NS+EE I+E A +K+ +D  VIQ
Sbjct:  755 IKKQPSILVGGT---LKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNERKAKQA------KIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLK--YRRLFIGDQNNKKMVG-LRGFNNQIMQLKKICNHPFVF----EEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKLDIDGKVIQ 1237          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Nematostella
Match: EDO39585 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J4])

HSP 1 Score: 506.908 bits (1304), Expect = 3.840e-160
Identity = 303/755 (40.13%), Postives = 434/755 (57.48%), Query Frame = 2
Query:  779 TERQYLIKWREWSHIHSTWESETTVQ--------TYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERN-------ESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYF--------------PKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRG-HTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXX---------XXIQDILQRAETTNHDDESHNP--ANDLLSAFKVVN 2920
            T R++ +KWRE S+ H +W +E  ++         +   + M +     +      I    H SP     A+ ++E N         +  + ++  RI++ +  K+  S ++ +KW+ + Y  STWES D  + +      I  +ER                        +QP YL  T   KL +YQ +G+NWL  +W +G + ILADEMGLGKTIQTI FL  L  +    GPFL+  PLST+ +W+ EF  WAP M ++ Y GD  SR  IR  ++ F               K   +KFHV +T+YEL+  D   L  I WA L VDEAHRLKN++S+ +  L  ++   +LL+TGTP+ N+L ELW LL F+ P +FN   +F   ++    N   E+ + +L+ +L P +LRR K DV K +PSKSE I+RV +   Q + YK ILT+N+EAL+  T+G    S LN++MELKKCCNH  L +    E +             ++SGK+MLL K++ +L+E+GHRVLIFSQM RMLD++ D+L   G+ ++R+DGS+ G+ R++AID FNA  S  FCFLLSTRAGGLGINLATADTV I+DSDWNP ND+QA +RAHRIGQ  +V +YRFV ++S+EE+I + AK+KM+L HLV++           +NK    SK EL++ILKFG ++LF  D+  D E             I  +L R +    D+    P  AN+ L++FKV++
Sbjct:  100 TTREFFVKWREKSYWHCSWITELQIEIQHPEMFRAFSRKNDMDEPPPLSDDDDEDSIEDGQHPSPTAKSKAKEQDENNLEARFYRYGVNPEWLQINRIMNHRVLKDG-SEEFFVKWRDVPYSQSTWESPDDPINHQI--SYINCKER----------------------YEKQPAYLDETGG-KLHEYQREGLNWLRFSWAQGTNTILADEMGLGKTIQTISFLYSLMKEGHSQGPFLVSAPLSTLVNWEREFEFWAPDMYVVTYAGDKESRATIRNFDFSFDEDAFKSGLKAYKLKKDSPVKFHVLLTSYELVSIDSASLQSIDWAMLVVDEAHRLKNNQSKFFRTLSDYNIGYKLLLTGTPLQNNLEELWNLLFFLDPVEFNNKNNFLTEFD----NVAKEDQIKKLHDILGPHMLRRLKADVLKGIPSKSELIVRVELSPMQKKYYKWILTRNFEALN--TKGAQQVSLLNVMMELKKCCNHPYLFHAAALEAKRTQSGGYEPNSLTEASGKLMLLVKMLKKLREQGHRVLIFSQMTRMLDLLEDFLEGHGYKYERIDGSVNGAARQEAIDRFNAPTSQAFCFLLSTRAGGLGINLATADTVFIYDSDWNPHNDIQAFSRAHRIGQNNKVMIYRFVTRSSVEERITQVAKKKMMLTHLVVR-------PGLGSNKATIMSKSELDDILKFGTSELFKDDDTKDGESGDSVVFHYDDKAITSLLDRDQQVMEDEVKDEPMLANEYLASFKVLS 815          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Nematostella
Match: EDO47298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMN4])

HSP 1 Score: 451.825 bits (1161), Expect = 1.348e-134
Identity = 262/677 (38.70%), Postives = 394/677 (58.20%), Query Frame = 2
Query:  788 QYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQ----RNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYF------PKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETR--GHTSSFLNIVMELKKCCNHVQLVNPLDE---ETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGA 2773
            ++ +K++ +S++H+ W +                 K  +  KR ++  K + + +   AA F E   +S     +E +R++D       N       +L+KW++L Y  STWE    +  ++  + I +F +      +P R+        ++  +   P Y    +   LR+YQL+GVNWL   W    + ILADEMGLGKTIQ+I FL +   ++ I GP L++ PLSTIS+WQ EF  W   +N ++Y G A SR +I+E E+Y+      P   + KF V ITTYE+++ D   L+ + W  + +DEAHRLKN   +L   L       R+L+TGTP+ N++ EL++LL+F+ P +F +   F   +     + + E  V +L ++L+P +LRR K+DVEK++  K E II V +   Q + Y+ IL +N+  L+K T    +  + +N +MEL+KCCNH  L+   +E   +   +   D H    I++SGK++L+ KL+ +LK  GH+VL+FSQMVR LDI+ DYLV   + ++R+DG ++G+LR+ AID F+   S  F FLL TRAGGLGINL  ADTVIIFDSDWNPQNDLQA AR HRIGQ R V VYR + +NS E ++ + A  K+ LD  V+Q M++    K +A  N   SK E+ ++LK GA
Sbjct:   81 EFHVKFKNYSYLHAEWATAE---------------KLAKGDKRVQMKIKRYKAKQLNTAAFFSEMEEDSFNPDYVEVDRVLDMSTGMDHNTGEPITHFLVKWRSLPYEESTWE----VKADVEESKIQQFYKLREPPPLPQRQFRPRPYPHEWHKLETSPVYKDENT---LREYQLEGVNWLMFCWCNRQNSILADEMGLGKTIQSIAFL-FEMQRYGIRGPNLVIAPLSTISNWQREFESWND-INAVVYHGSASSRHLIQEYEFYYRDEHGQPIPNIFKFQVLITTYEIIIADNMQLSTVPWRAVIIDEAHRLKNRNCKLLEGLNNLQMEHRILLTGTPLQNNVEELFSLLNFLEPSQFPSQGAFLMEFG----DLKTESQVDKLKQLLKPMMLRRLKEDVEKNIAPKEETIIEVELTTVQKKFYRAILERNFAFLAKGTSSTANVPNLMNTMMELRKCCNHPFLITGAEEKILQEYGREHVDRHTHAMIEASGKLVLIHKLLPKLKLGGHKVLVFSQMVRCLDILEDYLVHMKYPYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTVIIFDSDWNPQNDLQAQARCHRIGQSRSVKVYRLITRNSYEREMFDRASMKLGLDKAVLQSMNT----KENAGNNGQMSKREIEDLLKRGA 725          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Nematostella
Match: EDO40761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S667])

HSP 1 Score: 417.542 bits (1072), Expect = 3.365e-125
Identity = 227/515 (44.08%), Postives = 327/515 (63.50%), Query Frame = 2
Query: 1247 EQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKML--KFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLF 2785
            E P+Y+      ++RDYQ+ G+NWL   +  G + ILADEMGLGKT+QTI  L Y+ N   + GP +++ P ST+++W  EF  W P +  +   G+   R         F +  ML  ++ VC+T+YE+++++K    K +W ++ +DEAHR+KN++S+L   +    +  RLL+TGTP+ N+L ELWALL+F++PD F++  DF+  +N SN   E +++V  L+ VL PFLLRR K DVEK L  K E  +   + + Q   Y  IL K+ + ++   +      LNI+M+L+KCCNH  L +    E       D HL   I++SGKM +LDKL+  LK++G RVLIFSQM R+LDI+ DY + R + + RLDG      R+  I+ FN  GST F F+LSTRAGGLGINLATAD VI++DSDWNPQ DLQAM RAHRIGQK+QV V+RF+ ++++EE+IIE A+ K+ LD +VIQ+      R  D N      K+E+  +++ GA  +F
Sbjct:  134 ESPNYIKGG---EMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKNFRNVPGPHMVICPKSTLANWMAEFERWCPSIRAVCLIGNQEQRTA-------FIRDTMLPGEWDVCVTSYEMVIREKAVFKKFAWRYIVIDEAHRIKNEKSKLSEIVRELRSANRLLLTGTPLQNNLHELWALLNFLLPDVFSSSDDFDAWFN-SNNLVEEKQLVERLHSVLRPFLLRRLKSDVEKRLLPKKETKVYTGLTKMQRSWYTKILMKDIDVVNGAGKTDKMRLLNILMQLRKCCNHPYLFD--GAEPGPPYTTDVHL---IENSGKMRVLDKLLARLKQEGSRVLIFSQMTRLLDILEDYCLWRQYDYCRLDGQTPHEERQAYINSFNMPGSTKFIFMLSTRAGGLGINLATADIVILYDSDWNPQVDLQAMDRAHRIGQKKQVKVFRFISESTVEERIIERAEMKLRLDAVVIQQ-----GRLVDPNLK--VGKEEMLSMIRHGAEAVF 625          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Nematostella
Match: EDO46669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPD7])

HSP 1 Score: 375.555 bits (963), Expect = 2.317e-111
Identity = 219/540 (40.56%), Postives = 306/540 (56.67%), Query Frame = 2
Query: 1286 LRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLK-FHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPD------KFNTWPDF-----EDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTK---------------------------------NY----------EALSKE------------TRGHTSSFLNIVMEL-------KKCCNHVQLVN-PLDEETEN-KMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVI 2677
            LR YQL+GV WL   +  G + ILADEMGLGKTIQ IG +SYL  +  + GPFL+  PLST+ +W +EF  ++P + +I+Y G    R  +R       K    +   V +T+YE+ + D+  L ++ W  + VDE HR+KN   +L   L ++++  RLL+TGTP+ N+L ELW+LL+F++PD       F  W DF     E          +  +V+  L+ +L PFLLRR K DVE SLP K E ++R P+  KQTE Y+  L K                                 NY          E L++E            T    SS  +I +++       +KCCNH  L+  PLD  T+  K+D +      ++ SGKM+LLD+++  LK +GH++LIFSQM +MLDI+ DY  LRG+ + RLDGS+K   R++ ID F A     F FLLSTRAGGLG+NL+ ADTVII+DSDWNPQ+DLQA  R HRIGQ + + VYR V  N++++KI+E A  K  L+ +VI
Sbjct:  298 LRSYQLEGVEWLKGLYENGVNGILADEMGLGKTIQCIGLVSYLI-EMGVRGPFLVAAPLSTLPNWVSEFRRFSPQIPVILYHGSIQERTSLRRKITKLKKAGPFETMPVVVTSYEIAMNDQKHLFQLMWKHMIVDEGHRIKNLNCRLIRELKSYNSANRLLLTGTPLQNNLAELWSLLNFLLPDIFDDLNSFQRWFDFSAINDEGGNEKIIAQEKEHQVLERLHSILTPFLLRRLKTDVELSLPPKKEVLVRAPLTSKQTEFYRAALDKTILDIVGDNKDKKEDKVEISSTGRKKRKGRRNINYKIFDDENGSIEELAEELATLEKSRREICTPSQKSSTYDISIKITNILMLLRKCCNHPYLLEYPLDPVTQQYKIDEE-----LVRCSGKMLLLDQMVPALKRRGHKILIFSQMTKMLDILQDYCYLRGYQYSRLDGSMKVEDRREEIDAF-ASDPEKFIFLLSTRAGGLGLNLSAADTVIIYDSDWNPQSDLQAQDRCHRIGQTKPILVYRLVTSNTVDQKIVERAASKRKLEKMVI 830          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Nematostella
Match: EDO48116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK66])

HSP 1 Score: 374.785 bits (961), Expect = 6.922e-107
Identity = 213/508 (41.93%), Postives = 297/508 (58.46%), Query Frame = 2
Query: 1241 IREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQ----VIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLIT-FDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYN---------IXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELY-----KLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYY---------IKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQ 2680
            I EQP  L      +L++YQL G+ W+        + ILADEMGLGKTIQTI   SYL  +  + GPFL++VPLST+S+WQ EF  WAP   ++ Y G    R+    V+R            KF+V +TTYE +++DK  L K+ W ++ VDE HR+KN   +L   L T +    R+L+TGTP+ N L ELWALL+F++P  F +   FE  +N         +     E   ++  L+KVL PFLLRR KK+VE  LP K E +++  M   Q  LY     K +L  +     K+ +G T + +N +M+L+K CNH  +   ++E          HL ++          ++SGK  LLD+++ +LK   HRVL+F QM  ++ I+ DY   +G+ + RLDG+ K   R Q +  FNA+ S  F FLLSTRAGGLG+NL  ADTV+IFDSDWNP  DLQA  RAHRIGQ+++V V R +  NS+EEKI+  A+ K+ +D  VIQ
Sbjct:  634 ITEQPSMLVGG---RLKEYQLAGLEWMVSLHNNNLNGILADEMGLGKTIQTIALFSYLIEKKRLNGPFLVIVPLSTLSNWQLEFEKWAPSAIVVSYKGSPNMRRSAGAVLRTG----------KFNVVLTTYEYVMRDKAILAKVRWKYMVVDEGHRMKNHHCKLTQVLNTHYAAQHRILLTGTPLQNRLPELWALLNFLLPTIFKSVSTFEQWFNAPFAMTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVVKCDMSILQRILYNHMYKKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPFMFQHIEESIAE------HLGFHGGIVTGPDIYRASGKFELLDRILPKLKRNKHRVLMFCQMTSLMTILEDYFNWKGFPYLRLDGTTKSEDRGQLLSLFNAKDSPYFVFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQEKEVRVLRLMTVNSVEEKILAAARYKLNVDEKVIQ 1122          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Medaka
Match: chd2 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:101160654])

HSP 1 Score: 937.176 bits (2421), Expect = 0.000e+0
Identity = 510/1074 (47.49%), Postives = 687/1074 (63.97%), Query Frame = 2
Query:  656 VIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNK--------------NSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLV-NPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANK----NQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXX-------------------------XXXDNKETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKAV-----------FTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
             IE++L+ RIG  G  G  T+ Y      +     D   +E E QYLIKW+ WS+IHSTWES  ++ T Q   G+KK+  FK+  +    W +  A PED++    ++E    L +Q    ER+I  +  K              +SD  +YL KW  L Y   +WE G +++K  F   I  F  R+ S  +P++ C+ L +RP+F  +++QP Y+    +++LRDYQLDG+NWLAH+W R NSVILADEMGLGKTIQTI FLSYLF+QH ++GPFLLVVPLST++SWQ EF  WAP MN+++Y GD +SR+ IR+ EW   + K ++F+  ITTYE+LLKDK  L  I+WAFLGVDEAHRLKND+S LY  L+ F +N RLLITGTP+ NSL+ELW+LLHF+MPDKF++W DFED +      +  +     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV M  +Q + YK ILT+NY+ALSK TRG +S FLNIVMELKKCCNH  L+  P D + E + D    L+  ++ SGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI++ YL  + + FQRLDGSIKG +RKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K ++EE IIE AK+KMVLDHLVIQRMD+      D+N     + PF+K+EL  ILKFGA DLF + E  + E +   I +IL+ AE T   D+  +  ++LLS FKV N +     E+  +   +   + W DI+P++ R K +EEE Q+ + ++ + PR R   K  Q    +S                                   K      TD EI+  IK  KKF  PLER+++I  ++E++D +  ++  + + I + C +   E +   K+N                I  + ++ K+I+Q  ++ + LH+ +P N  +R KF L    K+A++   W+ +DD +LL+G++E G  NWE IK D DLKLT KILP   S++PQA  L+ R EYLLK L+
Sbjct:  283 TIEKILDTRIGKKGAIGAATTVYAVEENGDPAEGFDPEKEEGETQYLIKWKGWSYIHSTWESMDSL-TQQKVKGLKKMDNFKKKSEEMNAWLRR-ACPEDIEFHNCQQELMADLNKQFQIVERVIATKTGKTAGTSDFPSHSHKTSSDEPEYLCKWMGLPYSECSWEDGALVMKK-FQRCIDSFTSRNSSKTVPSKDCKVLKQRPRFVALKKQPTYIG-DENLELRDYQLDGLNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLLVVPLSTLTSWQREFETWAPDMNVVVYIGDVMSRKTIRDYEWVNHQTKRIRFNALITTYEILLKDKGVLGNINWAFLGVDEAHRLKNDDSLLYKTLMEFRSNHRLLITGTPLQNSLKELWSLLHFLMPDKFDSWEDFEDEHG-----KGRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMTAQQKQFYKWILTRNYKALSKGTRGSSSGFLNIVMELKKCCNHCFLIKQPEDGDGEVQQDV---LQGVVRGSGKLVLLDKLLTRLRERGNRVLIFSQMVRMLDILAKYLTKKRFPFQRLDGSIKGEIRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEDIIERAKKKMVLDHLVIQRMDTTGRTVLDSNSGNTNSNPFNKEELTAILKFGAEDLFKEAEGEESEPQEMDIDEILRLAE-TRESDQGSSATDELLSQFKVANFSSM---EETTHEFEERPVREWDDIIPEEQRRKAEEEEKQREMEDIFMLPRSRSSNKRAQANDSDSDVGSKLKNRSSGSDSETDDSDDDKKPKKRGRPRARKNNVEGFTDAEIRRFIKAYKKFGSPLERLEAIARDSELVDKSIADLKRLGELIHSSCVSAVQEHEEHLKENPVEAKGPGKRRGINIKISGVQVNAKSIIQHEEEFEPLHKAVPSNPNDRDKFKLTCRAKVAHFDVDWDLQDDTQLLLGIYEHGFGNWELIKTDPDLKLTEKILPDDPSKKPQAKQLQARAEYLLKLLK 1340          

HSP 2 Score: 55.8398 bits (133), Expect = 5.086e-7
Identity = 36/108 (33.33%), Postives = 53/108 (49.07%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSD---------CLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            E+    F  C +RM+P+K  LK L+             D+ LSD         CLL IG+ I   + ++++ E  + WR  LW FV+ F + F    LH++YK A KK
Sbjct: 1473 ELDQETFSVCKERMRPVKKALKQLDK-----------PDEGLSDQEQLQHTRTCLLKIGDRITECLKSYNDPEHVKLWRRNLWIFVSKFTE-FGARKLHKLYKMAQKK 1568          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Medaka
Match: chd2 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:101160654])

HSP 1 Score: 936.791 bits (2420), Expect = 0.000e+0
Identity = 510/1074 (47.49%), Postives = 687/1074 (63.97%), Query Frame = 2
Query:  656 VIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNK--------------NSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLV-NPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANK----NQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXX-------------------------XXXDNKETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKAV-----------FTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLR 3709
             IE++L+ RIG  G  G  T+ Y      +     D   +E E QYLIKW+ WS+IHSTWES  ++ T Q   G+KK+  FK+  +    W +  A PED++    ++E    L +Q    ER+I  +  K              +SD  +YL KW  L Y   +WE G +++K  F   I  F  R+ S  +P++ C+ L +RP+F  +++QP Y+    +++LRDYQLDG+NWLAH+W R NSVILADEMGLGKTIQTI FLSYLF+QH ++GPFLLVVPLST++SWQ EF  WAP MN+++Y GD +SR+ IR+ EW   + K ++F+  ITTYE+LLKDK  L  I+WAFLGVDEAHRLKND+S LY  L+ F +N RLLITGTP+ NSL+ELW+LLHF+MPDKF++W DFED +      +  +     L+KVLEPFLLRR KKDVEKSLP+K EQI+RV M  +Q + YK ILT+NY+ALSK TRG +S FLNIVMELKKCCNH  L+  P D + E + D    L+  ++ SGK++LLDKL+  L+E+G+RVLIFSQMVRMLDI++ YL  + + FQRLDGSIKG +RKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQK+QV++YR V K ++EE IIE AK+KMVLDHLVIQRMD+      D+N     + PF+K+EL  ILKFGA DLF + E  + E +   I +IL+ AE T   D+  +  ++LLS FKV N +     E+  +   +   + W DI+P++ R K +EEE Q+ + ++ + PR R   K  Q    +S                                   K      TD EI+  IK  KKF  PLER+++I  ++E++D +  ++  + + I + C +   E +   K+N                I  + ++ K+I+Q  ++ + LH+ +P N  +R KF L    K+A++   W+ +DD +LL+G++E G  NWE IK D DLKLT KILP   S++PQA  L+ R EYLLK L+
Sbjct:  242 TIEKILDTRIGKKGAIGAATTVYAVEENGDPAEGFDPEKEEGETQYLIKWKGWSYIHSTWESMDSL-TQQKVKGLKKMDNFKKKSEEMNAWLRR-ACPEDIEFHNCQQELMADLNKQFQIVERVIATKTGKTAGTSDFPSHSHKTSSDEPEYLCKWMGLPYSECSWEDGALVMKK-FQRCIDSFTSRNSSKTVPSKDCKVLKQRPRFVALKKQPTYIG-DENLELRDYQLDGLNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLLVVPLSTLTSWQREFETWAPDMNVVVYIGDVMSRKTIRDYEWVNHQTKRIRFNALITTYEILLKDKGVLGNINWAFLGVDEAHRLKNDDSLLYKTLMEFRSNHRLLITGTPLQNSLKELWSLLHFLMPDKFDSWEDFEDEHG-----KGRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMTAQQKQFYKWILTRNYKALSKGTRGSSSGFLNIVMELKKCCNHCFLIKQPEDGDGEVQQDV---LQGVVRGSGKLVLLDKLLTRLRERGNRVLIFSQMVRMLDILAKYLTKKRFPFQRLDGSIKGEIRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEDIIERAKKKMVLDHLVIQRMDTTGRTVLDSNSGNTNSNPFNKEELTAILKFGAEDLFKEAEGEESEPQEMDIDEILRLAE-TRESDQGSSATDELLSQFKVANFSSM---EETTHEFEERPVREWDDIIPEEQRRKAEEEEKQREMEDIFMLPRSRSSNKRAQANDSDSDVGSKLKNRSSGSDSETDDSDDDKKPKKRGRPRARKNNVEGFTDAEIRRFIKAYKKFGSPLERLEAIARDSELVDKSIADLKRLGELIHSSCVSAVQEHEEHLKENPVEAKGPGKRRGINIKISGVQVNAKSIIQHEEEFEPLHKAVPSNPNDRDKFKLTCRAKVAHFDVDWDLQDDTQLLLGIYEHGFGNWELIKTDPDLKLTEKILPDDPSKKPQAKQLQARAEYLLKLLK 1299          

HSP 2 Score: 55.8398 bits (133), Expect = 5.244e-7
Identity = 36/108 (33.33%), Postives = 53/108 (49.07%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSD---------CLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKK 4291
            E+    F  C +RM+P+K  LK L+             D+ LSD         CLL IG+ I   + ++++ E  + WR  LW FV+ F + F    LH++YK A KK
Sbjct: 1432 ELDQETFSVCKERMRPVKKALKQLDK-----------PDEGLSDQEQLQHTRTCLLKIGDRITECLKSYNDPEHVKLWRRNLWIFVSKFTE-FGARKLHKLYKMAQKK 1527          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Medaka
Match: chd1 (chromodomain helicase DNA binding protein 1 [Source:NCBI gene;Acc:101173399])

HSP 1 Score: 926.006 bits (2392), Expect = 0.000e+0
Identity = 513/1050 (48.86%), Postives = 698/1050 (66.48%), Query Frame = 2
Query:  668 VLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSL-DYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSA----LHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXX-IQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVK--AYQVGQVNXXXXXXXXXDN--------------------KETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSE--CDTEE-------KKNKAVFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            V++ RIG    TG  T+ Y      +   N + N +  + QYLIKW+ W+HIH+TWE+E T++  QN  GMKKL  FK+ ++ ++ W K  ASPED++    +EE  + L  Q    ERII     K++    DYL KW+ L Y   +WE G +I K  F   I ++  R++S  IP+R C+ L +RP+F P++ QP Y+     ++LRDYQLD +NW+AH+W++GNS ILADEMGLGKTIQTI FL+YLF++H ++GPFLLVVPLST++SWQ E  +WAP MN+++Y GD  SR +IR  EW     + LKF++ +TTYE+LLKDK +L  ++WAF+GVDEAHRLKND+S LY  +I F +N RLLITGTP+ NSL+ELW+LLHFIMPDKF++W  FE  +      +  +   + L+K LEPFLLRR KKDVEKSLP+K EQI+RV M   Q + YK ILT+NY+ALSK T+G TS FLN++MELKKCCNH  L+ P D+E  +K++    L+  I+SSGK++LLDKL+  LKE+GHRVLIFSQMVRMLDI++DYL  R + FQRLDGSIKG +RKQA+DHFNAEGS DFCFLLSTRAGGLGINLA+ADTV+IFDSDWNPQNDLQA ARAHRIGQKRQV++YR V + S+EE IIE AK+KMVLDHLVIQRMD+     L+     + + PF+K+EL+ ILKFGA +LF + E  ++E +   I +IL+RAET  +D        +LLS FKV N +   +DE+I     + + + W DI+P++ R +++EEE QK L E+ + PR R   K  ++  G+            +                    +E     +D EI+  +K  KKF  PLER+ +I  +AE++D +E ++  + + + NGC     E  C  E+       K     F I  + ++ K ++   ++L  LH+ +P + EER K+VLP  +K A++   W  EDD+ LL+G++E G  +WE IKMD DL LT K+LP    ++PQA  L+TR +YL+K L
Sbjct:  269 VMDSRIGRKRATGSVTTVYAVEADGDPNANFNPNKEAGDVQYLIKWKNWAHIHNTWETEETLKQ-QNVRGMKKLDNFKKKEQEQKKWLKM-ASPEDVEYFNCQEELIDDLHSQYQLVERIIGHSNQKSAAGYPDYLCKWQGLPYSECSWEDGALIGKK-FQKRIDDYMCRNQSKTIPSRDCKVLKQRPRFVPMKRQPSYIG-GDGLELRDYQLDSLNWMAHSWSKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTVTSWQREIQLWAPQMNVVVYLGDISSRNMIRTHEWIHLHSRRLKFNILLTTYEILLKDKTFLGNVNWAFIGVDEAHRLKNDDSLLYKTMIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPDKFHSWEHFEADHG-----KGRDSGYTSLHKELEPFLLRRVKKDVEKSLPAKVEQILRVEMTAVQKQYYKWILTRNYKALSKGTKGSTSGFLNVMMELKKCCNHCYLIKPPDDEFLSKVEA---LQLLIRSSGKLVLLDKLLVRLKERGHRVLIFSQMVRMLDILADYLRSRQFLFQRLDGSIKGEMRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKRQVNIYRLVTRGSVEEDIIERAKKKMVLDHLVIQRMDTTGKTVLNTGAAPSSSAPFNKEELSAILKFGAEELFKEPEGEEQEPQEMDIDEILKRAETRENDPGPSTVGEELLSQFKVANFS-MMDDEEIDIDSERSQ-RSWDDIIPEEQRRRMEEEERQKELEEIYMLPRMRNCAKQISFNSGERRHGRSRRYSASDSDSLSDRKRPKKRGRPRTIPRENIKGFSDAEIRRFVKSYKKFGGPLERLDAIARDAELVDKSELDLKRLAETVHNGCLRTLRENPCGPEKTSGGRRGKVKGPTFRISGVQVNAKLVISHEEELAPLHKAIPADPEERKKYVLPCHSKAAHFDIEWGKEDDSSLLIGIYEYGYGSWEMIKMDPDLNLTHKLLPDDPDKKPQAKQLQTRADYLIKLL 1304          

HSP 2 Score: 66.6254 bits (161), Expect = 2.644e-10
Identity = 35/101 (34.65%), Postives = 57/101 (56.44%), Query Frame = 2
Query: 3995 EMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSE 4297
            E+    F  C +RM+P+K+ LK L+  ++    + +++      CL+ IG+HI   +  + N EQ +QWR  LW FV+ F + F    LH++YK A KK +
Sbjct: 1481 ELDQRTFSVCKERMRPVKAALKQLDRPEKGLSEREQLE--HTRQCLIKIGDHITECLKEYSNPEQIKQWRKNLWIFVSKFTE-FDARKLHKLYKHAIKKRQ 1578          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Medaka
Match: chd3 (chromodomain-helicase-DNA-binding protein 3 [Source:NCBI gene;Acc:101167742])

HSP 1 Score: 527.324 bits (1357), Expect = 2.116e-159
Identity = 306/757 (40.42%), Postives = 438/757 (57.86%), Query Frame = 2
Query:  782 ERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNE--------------SLLQQK----------MECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKM------------LKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXX---------XXXIQDILQRAETTNHDDESHNPANDLLSAFKVV 2917
            ER++ +K    S+ H TW +E  ++ + +       + ++  Q++ ++       P  LD     EE N               ++L+ K          M   RII+   +K      YL+KW+ L Y   TWE  D+ + +              ++  P  K E            EQPD+++ T    L  YQL+G+NWL  +W +G   ILADEMGLGKTIQTI FL  LF +    GPFL+  PLSTI +W+ EF +WAP   ++ YTGD  SR +IRE E+ F    +            +KFHV +T+YEL+  D+  L  I WA L VDEAHRLKN++S+ +  L  +  + +LL+TGTP+ N+L EL+ LL+F+ P++FN    F + +     +   E+ + +L+ +L P +LRR K DV K++P+K+E I+RV +   Q + YKLILTKN+EAL+ +  G+  S LNI+M+LKKCCNH  L      E +             K+SGK+MLL K++ +LKE+GHRVL+FSQM +MLD++ D+L   G+ ++R+DG I G+LR++AID FNA G+  FCFLLSTRAGGLGINLATADTVIIFDSDWNP ND+QA +RAHRIGQ  +V +YRFV + S+EE+I + AKRKM+L HLV+        R    +K    +K EL++ILKFG  +LF  + E D+ +            I+ +L R++    D +  N  N+ LS+FKV 
Sbjct:  516 EREFFVKLVGQSYWHCTWITELQLEIFHS-------VMYRNYQRKTDM-----DEPPSLDYGSGGEEENSVGKSEKRRAKDPQFAILEDKYYKYGIKPEWMMIHRIINHSLDKKG-VYHYLVKWRDLTYDQCTWERDDMTIPDF-------------AIYKPTIKYE------------EQPDFVTATGGT-LHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLYSLFKEGHTKGPFLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKDSRAIIRENEFSFDDTAVKGGKKAFKLRAPIKFHVLLTSYELVTIDQTALKSIEWACLVVDEAHRLKNNQSKFFRRLNDYKIDYKLLLTGTPLQNNLEELFHLLNFLTPNRFNNLEGFLEEF----ADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKLILTKNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVASMEAQKTPSGAYEGSALTKASGKLMLLQKMLRKLKEQGHRVLVFSQMTKMLDLLEDFLDHEGYKYERIDGGITGALRQEAIDRFNAPGACQFCFLLSTRAGGLGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASVEERITQVAKRKMMLTHLVV--------RPGLGSKAGSMTKQELDDILKFGTEELFKDEGEGDKVEDEGNVIHYDSTAIERLLDRSQDATDDTDVQN-MNEYLSSFKVA 1220          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Medaka
Match: chd4a (chromodomain-helicase-DNA-binding protein 4 [Source:NCBI gene;Acc:101174845])

HSP 1 Score: 525.783 bits (1353), Expect = 1.066e-156
Identity = 314/773 (40.62%), Postives = 443/773 (57.31%), Query Frame = 2
Query:  779 TERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEER--------------NESLLQQKMECE-----RIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNR-----KCEALTRRPKFAP----------IREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFP--------------KKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETE---NKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXX---------XXIQDILQRAETTNHDDESHNPANDLLSAFKVV 2917
             ER++  KW   S+ H +W SE  ++       M   + F+  Q++ ++       P  +D  + EE++               E  L+  ++ E     RI++   ++ ++ + YLIKW+ L Y  +TWE+ D+ +    P     +  R   +    R     K +   +RP+  P             QPDYL  T    L  YQL+G+NWL  +W +G   ILADEMGLGKT+QT  FL  L+ +    GPFL+  PLSTI +W+ EF +WAP M ++ Y GD  SR VIRE E+ F               K   +KFHV +T+YEL+  D   L  I WA L VDEAHRLKN++S+ +  L  +    +LL+TGTP+ N+L EL+ LL+F+ P++FN    F + +     +   E+ + +L+ +L P +LRR K DV K +PSK+E I+RV +   Q + YK ILTKN+EAL+ +  G+  S LN+VM+LKKCCNH  L      E     N M   S L    KSSGK+MLL K+M +LKE GHRVL+FSQM +MLD++ D+L   G+ ++R+DG I G +R++AID FNA G+  F FLLSTRAGGLGINLATADTVII+DSDWNP ND+QA +RAHRIGQ ++V +YRFV K S+EE+I + AK+KM+L HLV+        R    +K    SK EL++ILKFG  +LF  + E + ++E           I  +L R +    D E  +  N+ LS+FKV 
Sbjct:  533 AEREFFAKWCNMSYWHCSWVSELQLE-------MHCQVMFRNYQRKNDM-----DEPPPIDFGEGEEDKCVKRKSKDPTYVHLEEKYLRFGIKMEWLMIHRILNHSVDRKNN-VHYLIKWRELPYDQATWEAEDMDLPEFEPYKQQYWNHRELMMGDDGRPGKKIKVKGRVKRPERPPENPVVDPTIKFERQPDYLDSTGGT-LHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYIGDKDSRAVIRENEFSFEDNAIRGGKRASRMKKDSSIKFHVLLTSYELITIDMAALGSIDWACLVVDEAHRLKNNQSKFFRVLNNYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEVFLEEF----ADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKFILTKNFEALNTKGGGNQVSLLNVVMDLKKCCNHPYLFPAAAMEAPKLPNGMYDGSAL---TKSSGKLMLLQKMMRKLKEGGHRVLVFSQMTKMLDLLEDFLENEGYKYERIDGGITGGMRQEAIDRFNAPGAQQFAFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTKASVEERITQVAKKKMMLTHLVV--------RPGLGSKTGSMSKQELDDILKFGTEELFKDEGEGENKEEDSSIIHYDDKAIDRLLDRNQDATDDTELQS-MNEYLSSFKVA 1275          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Planmine SMEST
Match: SMESG000033395.1 (SMESG000033395.1)

HSP 1 Score: 2178.29 bits (5643), Expect = 0.000e+0
Identity = 1128/1132 (99.65%), Postives = 1129/1132 (99.73%), Query Frame = 2
Query:   71 MLDYXXXXXXXXXXXXXXXXXVILPSKTRQRSLLDEIKENPDLYTTRRSERNRKEPSRFNILSERGSQGNRLSRKIYSGSTXXXXXXXXXXXXXFVYSKRNKKYNQKQKMEFRKRAHVSYKEVVTSDEDVGSDDSGQPKKKVAKINNSNGFTNVRDNPLLNKPLILIRGEKIDNECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKAVFTIRKIVISVKNILQSLDDLDILHQILPKNKE 3466
            MLDYSDEESSRNSIDSSNESEVILPSKTRQRSLLDEIKENPDLYTTRRSERNRKEPSRFNILSERGSQGNRLSRKIYSGSTSEENDDEENDDSDFVYSKRNKKYNQKQKMEFRKRAHVSYKEVVTSDEDVGSDDSGQPKKKVAKINNSNGFTNVRDNPLLNKPLILIRGEKIDNECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNISNENREVEEVVSELYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLFNQDEELDEEQELNIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNSTSEESSEEDNKETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKAVFTIRKIVISVKNILQSLDDLDILHQI  K K+
Sbjct:    1 MLDYSDEESSRNSIDSSNESEVILPSKTRQRSLLDEIKENPDLYTTRRSERNRKEPSRFNILSERGSQGNRLSRKIYSGSTSEENDDEENDDSDFVYSKRNKKYNQKQKMEFRKRAHVSYKEVVTSDEDVGSDDSGQPKKKVAKINNSNGFTNVRDNPLLNKPLILIRGEKIDNECIEGSYDDQRMSEFISEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNISNENREVEEVVSELYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLFNQDEELDEEQELNIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELELGPRQRKKVKAYQVGQVNSTSEESSEEDNKETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNKAVFTIRKIVISVKNILQSLDDLDILHQIYQKIKK 1132          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Planmine SMEST
Match: SMESG000047519.1 (SMESG000047519.1)

HSP 1 Score: 844.343 bits (2180), Expect = 0.000e+0
Identity = 474/1032 (45.93%), Postives = 665/1032 (64.44%), Query Frame = 2
Query:  641 SEEVNVIEEVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLFXXXXXXXXXXXXXIQDILQRAETTNHDDESHNPANDLLSAFKVVNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKI-KEEEHQKALLE-------LELGPRQRKKVKAYQVGQVNXXXXXXXXXDNKETGGKLTDKEIKSIIKVMKKFPRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSE-CDTEEKKNKAVFTIRKIVISVKNILQSLDDLDILHQILPK-NKEERLKFVLPFETKLANWSCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKL 3706
            SEEV+ I+E+L+ R+G  G+TG ET+ YN +       N  + S  TE+QYLIKW+ WS++H+TWESE +++   + +G KKL KF    K  E +K +  SP++L+   F EE+      QKM+ +R+I  Q +K    L+Y IKWK+LDY++ T ES + +V+ LF   I ++E   ++ K+PN     L +RP F P+ +   +   +S + LRDYQ  GVNW+   WT G++ ILADEMGLGKTIQ I F+S LF ++ I+GP+LL+VPLSTI +W+ EF  WAP +  I+YTGD  SR++I++ EWY P  K LKF+  +TTYE+ + DK  L  + W FLGVDEAHRLK+ +S+LY  +  F TN R LITGTP+ N+++ELWALLHFIMP  F ++ DFE ++  ++      E ++ L + + PF++RR KKDVEKSLP+KSEQI+R+ M  KQ ELY+LIL KN+++L  ET   T  F N+++ELKKCCNHV+L++   E+ +N         Y IKSSGKM++LDKL+  LK + HRVLIFSQMVRMLDI+ DYL ++GWGFQRLDGS    +R +AI +FNA+ STDFCFLLSTRAGGLGINL TADTVIIFDSDWNP  DLQAMARAHRIGQ +QVS+YRFVIKNS+EEKIIE AKRKMVLDHL+IQRM++  +  T  N       D+   IL+F A ++F ++ +  ++ + N+Q IL++AE  + D  S   A   LS+FKV+++    E + +         K W D++P+   + + K      A+++       LE+ P+   K+       +N           +   GKL   E + ++  ++KF  P +RI+ I  E +++  +E ++ + + +II+GC  +  E CD ++  N   F      I  K ++  +D L+ LH I+ + ++EER++     +TK  +W+C W  EDD RLLVGVFE G+ +W+ IK D  LKL SKIL S  S  PQ  HL TRV YLL  L
Sbjct:   93 SEEVDTIQEILDTRLGAPGDTGDETTIYNSIYN----PNPSHASRGTEQQYLIKWKNWSYVHATWESEESLKARGHIEGRKKLDKFIATFKEAERYK-NSCSPDELERRLFAEEQIRERNYQKMQIDRVIHKQYDK-VGGLEYFIKWKSLDYKFVTAESAESVVEPLFKGAIADYENNLKNNKVPNNNNMYLRKRPVFFPLPKTVTFGLPSSRLCLRDYQEIGVNWMMKLWTIGHNGILADEMGLGKTIQIISFISMLFRRYDIYGPYLLIVPLSTIDNWKREFETWAPEIYTIVYTGDIASREIIKKYEWYQPNTKTLKFNALLTTYEIAMNDKALLGNVYWTFLGVDEAHRLKSPDSKLYKTIYPFRTNCRFLITGTPLQNNIKELWALLHFIMPSIFASFEDFEQKFGNTDNETLCNEKLANLREAISPFIIRREKKDVEKSLPAKSEQILRINMSHKQKELYRLILAKNFDSLLAETNKRT-IFKNVIVELKKCCNHVELIS---EKFKNLHSLPERQEYLIKSSGKMIVLDKLLTHLKSENHRVLIFSQMVRMLDILDDYLCMKGWGFQRLDGSRSSVMRNEAIKNFNAQNSTDFCFLLSTRAGGLGINLTTADTVIIFDSDWNPHADLQAMARAHRIGQTKQVSIYRFVIKNSVEEKIIERAKRKMVLDHLIIQRMEA--NGITSKNNKTKLEADDFEAILRFSAQEIF-KECDDSDDADFNLQTILKQAEVRDQDTSSATSA--FLSSFKVISL----EPDKLESPAEIADAKNWCDLIPKKYIDTLHKNRGDINAIMDMIPKTKPLEVNPKTNSKI------NINVP---------QPPNGKLNRIETRKLVTTIQKFGCPQKRIEKIQSETQLLKLSENQLCNCIMEIIDGCRKIVVENCDADD-LNSLTFEYNGYHIVAKTLITKIDSLNELHMIMTQYSEEERIQHEFITKTKPTSWNCEWTREDDNRLLVGVFEHGMSSWKEIKYDPKLKLKSKILKSDKSILPQEKHLSTRVHYLLDVL 1089          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Planmine SMEST
Match: SMESG000033397.1 (SMESG000033397.1)

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 380/380 (100.00%), Postives = 380/380 (100.00%), Query Frame = 2
Query: 3599 MDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNHVTNPKSAEFVESSDNSSRXXXXXXXXXXXXXXXXXXXXXXXXXRESKSHGDDDHEHLFYEMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSEVXXXXXXXXXXXXXXXXGKHDSFINKGSESVKESKTQSDKVKCNFEARSYQEYIKMKNWNGETTKTFDDNNRNEKYKPYSRSSFNDKRNDKTYKSYHDRDDKSDFDRNRKSGSSYNNFEXXXXXXXXXXXXGANFSRDPRLSKSTIN 4738
            MDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLRDSKIVVKSESVVVKKVIKSSKVDINKKSKVKTKVNHVTNPKSAEFVESSDNSSRKSDAKNKSKHKSKSNKSKSVSENPKRESKSHGDDDHEHLFYEMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSEVKSINKDSSNNNKQNNNGKHDSFINKGSESVKESKTQSDKVKCNFEARSYQEYIKMKNWNGETTKTFDDNNRNEKYKPYSRSSFNDKRNDKTYKSYHDRDDKSDFDRNRKSGSSYNNFENSQSNYKSNSKSGANFSRDPRLSKSTIN
Sbjct:    1 MDLDLKLTSKILPSSASERPQASHLRTRVEYLLKKLRDSKIVVKSESVVVKKVIKSSKVDINKKSKVKTKVNHVTNPKSAEFVESSDNSSRKSDAKNKSKHKSKSNKSKSVSENPKRESKSHGDDDHEHLFYEMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDKQLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLHRIYKSAYKKSEVKSINKDSSNNNKQNNNGKHDSFINKGSESVKESKTQSDKVKCNFEARSYQEYIKMKNWNGETTKTFDDNNRNEKYKPYSRSSFNDKRNDKTYKSYHDRDDKSDFDRNRKSGSSYNNFENSQSNYKSNSKSGANFSRDPRLSKSTIN 380          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Planmine SMEST
Match: SMESG000068192.1 (SMESG000068192.1)

HSP 1 Score: 503.827 bits (1296), Expect = 1.353e-149
Identity = 284/628 (45.22%), Postives = 385/628 (61.31%), Query Frame = 2
Query: 1010 MECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDI---------------IVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAP-------IREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKM--------------LKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLF 2785
            M+  RIID   ++N +S+ YLIKW+ L Y   TWE  D                I++ LF   I  ++++ ++  IP  K   L + P   P       + +QPDY+  T   KL  YQL+G+NWL  ++      ILADEMGLGKTIQTI FL  L+ +    GPFL+  PLST+ +W+ EF  WAP   ++ Y GD  SR V+RE E+ + +  M               KFHV +T+YEL+  D+  L  ISW  L VDEAHRLKN++S+ +  L ++  N +LL+TGTP+ N+L EL+ LLHF+ P+KFN    F D +     +   EE V  L+++L   LLRR K DV   +PSK E I+RV +   Q + YK ILT+N++ALS +  G   S +NIVM+LKKCCNH  L     +E     +        IK+SGK+ LL K++ +LK  GHRVLIFSQM R+LDI+ D++   G+ F+R+DG++ G  R+ +ID FNA  S  F FLLSTRAGGLGINLATADTVII+DSDWNP ND+QA +RAHRIGQ  +V +YRFV +N++EE++ + AK+KM+L HLV++     L  K  A+     SK EL+EILKFG  DLF
Sbjct:  626 MQIHRIIDHMTHRN-NSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDI--YKKKFKNSSIP--KEIILKKIPPEHPTTDLKKRMSKQPDYIEETGG-KLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEF----ADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVR---PGLGGKGGAS----MSKKELDEILKFGTEDLF 1236          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Planmine SMEST
Match: SMESG000068192.1 (SMESG000068192.1)

HSP 1 Score: 503.827 bits (1296), Expect = 1.364e-149
Identity = 284/628 (45.22%), Postives = 385/628 (61.31%), Query Frame = 2
Query: 1010 MECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDI---------------IVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAP-------IREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYFPKKKM--------------LKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNIXXXXXXXXXXXXXLYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPLDEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGAADLF 2785
            M+  RIID   ++N +S+ YLIKW+ L Y   TWE  D                I++ LF   I  ++++ ++  IP  K   L + P   P       + +QPDY+  T   KL  YQL+G+NWL  ++      ILADEMGLGKTIQTI FL  L+ +    GPFL+  PLST+ +W+ EF  WAP   ++ Y GD  SR V+RE E+ + +  M               KFHV +T+YEL+  D+  L  ISW  L VDEAHRLKN++S+ +  L ++  N +LL+TGTP+ N+L EL+ LLHF+ P+KFN    F D +     +   EE V  L+++L   LLRR K DV   +PSK E I+RV +   Q + YK ILT+N++ALS +  G   S +NIVM+LKKCCNH  L     +E     +        IK+SGK+ LL K++ +LK  GHRVLIFSQM R+LDI+ D++   G+ F+R+DG++ G  R+ +ID FNA  S  F FLLSTRAGGLGINLATADTVII+DSDWNP ND+QA +RAHRIGQ  +V +YRFV +N++EE++ + AK+KM+L HLV++     L  K  A+     SK EL+EILKFG  DLF
Sbjct:  626 MQIHRIIDHMTHRN-NSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDI--YKKKFKNSSIP--KEIILKKIPPEHPTTDLKKRMSKQPDYIEETGG-KLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHEFSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEF----ADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQISLINIVMDLKKCCNHPYLFPSGSDEAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVR---PGLGGKGGAS----MSKKELDEILKFGTEDLF 1236          
The following BLAST results are available for this feature:
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHD21.019e-749.35chromodomain helicase DNA binding protein 2 [Sourc... [more]
CHD29.948e-849.35chromodomain helicase DNA binding protein 2 [Sourc... [more]
CHD16.055e-1048.71chromodomain helicase DNA binding protein 1 [Sourc... [more]
CHD16.055e-1048.71chromodomain helicase DNA binding protein 1 [Sourc... [more]
CHD20.000e+054.30chromodomain helicase DNA binding protein 2 [Sourc... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd-10.000e+046.99Chromodomain and Helicase Domain protein [Source:... [more]
chd-39.233e-15241.28Chromodomain-helicase-DNA-binding protein 3 homolo... [more]
let-4187.112e-14741.37pep chromosome:WBcel235:V:5826833:5832866:1 gene:W... [more]
chd-75.996e-12936.22Chromodomain and Helicase Domain protein [Source:... [more]
isw-15.208e-12745.02Chromatin-remodeling complex ATPase chain isw-1 [... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chd14.890e-746.10gene:FBgn0250786 transcript:FBtr0077674[more]
Chd14.930e-746.10gene:FBgn0250786 transcript:FBtr0331654[more]
Chd15.237e-746.10gene:FBgn0250786 transcript:FBtr0305980[more]
Chd31.120e-15640.16gene:FBgn0023395 transcript:FBtr0074998[more]
Mi-27.860e-15339.72gene:FBgn0262519 transcript:FBtr0100394[more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd12.263e-1149.39chromodomain helicase DNA binding protein 1 [Sourc... [more]
chd12.014e-1149.44chromodomain helicase DNA binding protein 1 [Sourc... [more]
chd25.897e-847.47chromodomain helicase DNA binding protein 2 [Sourc... [more]
chd25.062e-847.47chromodomain helicase DNA binding protein 2 [Sourc... [more]
chd52.135e-15839.52chromodomain helicase DNA binding protein 5 [Sourc... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000053481.10.000e+044.30chromodomain helicase DNA binding protein 2 [Sourc... [more]
ENSXETT00000053510.16.752e-845.48chromodomain helicase DNA binding protein 2 [Sourc... [more]
ENSXETT00000053494.16.856e-845.44chromodomain helicase DNA binding protein 2 [Sourc... [more]
ENSXETT00000053518.17.535e-848.92chromodomain helicase DNA binding protein 2 [Sourc... [more]
ENSXETT00000053490.16.940e-848.16chromodomain helicase DNA binding protein 2 [Sourc... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chd26.220e-849.07chromodomain helicase DNA binding protein 2 [Sourc... [more]
Chd13.311e-1048.68chromodomain helicase DNA binding protein 1 [Sourc... [more]
Chd10.000e+054.22chromodomain helicase DNA binding protein 1 [Sourc... [more]
Chd37.844e-15640.08chromodomain helicase DNA binding protein 3 [Sourc... [more]
Chd51.961e-15539.62chromodomain helicase DNA binding protein 5 [Sourc... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O14647|CHD2_HUMAN4.896e-749.35Chromodomain-helicase-DNA-binding protein 2 OS=Hom... [more]
sp|E9PZM4|CHD2_MOUSE4.351e-749.07Chromodomain-helicase-DNA-binding protein 2 OS=Mus... [more]
sp|B6ZLK2|CHD1_CHICK2.438e-948.49Chromodomain-helicase-DNA-binding protein 1 OS=Gal... [more]
sp|P40201|CHD1_MOUSE2.316e-948.68Chromodomain-helicase-DNA-binding protein 1 OS=Mus... [more]
sp|O14646|CHD1_HUMAN2.908e-948.71Chromodomain-helicase-DNA-binding protein 1 OS=Hom... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A075ADF91.262e-651.67Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A1S8WHI81.223e-651.42Protein, SNF2 family (Fragment) OS=Opisthorchis vi... [more]
A0A4S2LRS01.109e-651.70Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LXI31.179e-651.02Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LYW40.000e+051.10Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd21.002e-744.74chromodomain helicase DNA binding protein 2 [Sourc... [more]
chd21.150e-744.23chromodomain helicase DNA binding protein 2 [Sourc... [more]
chd21.192e-747.35chromodomain helicase DNA binding protein 2 [Sourc... [more]
chd21.104e-747.35chromodomain helicase DNA binding protein 2 [Sourc... [more]
chd10.000e+048.64chromodomain helicase DNA binding protein 1 [Sourc... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004254.10.000e+062.66pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 ge... [more]
SMARCA51.574e-13444.21SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA51.734e-13144.40SWI/SNF related, matrix associated, actin dependen... [more]
ENSPMAT00000006729.11.084e-12437.61pep scaffold:Pmarinus_7.0:GL476370:400098:484196:-... [more]
SMARCA26.237e-10642.36SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CHD10.000e+038.41Chromatin remodeler that regulates various aspects... [more]
ISW22.208e-13746.88ATP-dependent DNA translocase involved in chromati... [more]
ISW17.345e-12947.40ATPase subunit of imitation-switch (ISWI) class ch... [more]
STH13.280e-11243.60ATPase component of the RSC chromatin remodeling c... [more]
SNF24.112e-10942.89Catalytic subunit of the SWI/SNF chromatin remodel... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO395853.840e-16040.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472981.348e-13438.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407613.365e-12544.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466692.317e-11140.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481166.922e-10741.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd25.086e-747.49chromodomain helicase DNA binding protein 2 [Sourc... [more]
chd25.244e-747.49chromodomain helicase DNA binding protein 2 [Sourc... [more]
chd12.644e-1048.86chromodomain helicase DNA binding protein 1 [Sourc... [more]
chd32.116e-15940.42chromodomain-helicase-DNA-binding protein 3 [Sourc... [more]
chd4a1.066e-15640.62chromodomain-helicase-DNA-binding protein 4 [Sourc... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033395.10.000e+099.65SMESG000033395.1[more]
SMESG000047519.10.000e+045.93SMESG000047519.1[more]
SMESG000033397.10.000e+0100.00SMESG000033397.1[more]
SMESG000068192.11.353e-14945.22SMESG000068192.1[more]
SMESG000068192.11.364e-14945.22SMESG000068192.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006818 ID=SMED30006818|Name=Chromodomain-helicase-DNA-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4789bp
GAACCAATCAGATTCTGTATAGTGTGTGATCGCCATTTTGTTTCGCTATT
CACTGATTCGCTTTATGACGATGTTAGATTACAGTGATGAAGAGTCATCA
AGAAACAGTATAGATAGTTCAAATGAAAGTGAAGTAATTTTACCCAGCAA
AACCAGACAGCGTTCTTTACTCGATGAGATTAAAGAAAATCCAGATTTAT
ACACTACCAGACGATCTGAAAGAAATCGTAAAGAGCCATCCAGATTTAAT
ATTTTATCCGAACGTGGGTCCCAAGGAAATAGACTTAGTCGTAAAATATA
TTCGGGGTCTACCTCAGAAGAGAACGATGATGAAGAAAATGATGACAGTG
ATTTTGTATATTCTAAAAGAAATAAGAAGTATAATCAAAAGCAAAAAATG
GAGTTTCGTAAACGTGCCCATGTTAGTTATAAAGAAGTTGTAACAAGTGA
TGAGGATGTGGGTTCAGATGACAGTGGACAACCTAAAAAGAAAGTTGCTA
AAATCAATAATTCAAATGGATTCACTAATGTTAGAGATAATCCTTTATTA
AACAAACCTTTAATTTTGATTCGCGGAGAAAAAATTGATAATGAATGTAT
TGAAGGTTCATACGATGATCAACGAATGTCAGAATTTATTAGCGAAGAAG
TAAACGTTATTGAAGAAGTTCTAAATTTCCGAATAGGATTCGTAGGAAAT
ACCGGTATTGAAACTTCATATTATAATAAAGTGCTCAAAAATGAAAAATA
CGGAAATGATGATAATAATTCCGATGAAACAGAACGTCAATATCTTATAA
AGTGGAGAGAATGGAGTCACATTCACAGTACTTGGGAATCAGAGACTACT
GTTCAAACGTATCAAAATTTTGATGGTATGAAGAAATTGCTAAAGTTTAA
AGAAATTCAGAAAAGAAGAGAAATATGGAAAAAACATCATGCTTCTCCTG
AAGATTTAGATGCTGCTCAATTTGAAGAAGAGCGAAATGAATCACTTCTT
CAACAAAAAATGGAATGTGAACGGATTATTGACGCTCAACGAAATAAAAA
TTCTGACTCCCTCGATTATTTAATCAAATGGAAAACCCTAGATTATCGAT
ATTCTACCTGGGAATCGGGAGATATAATTGTTAAAAACCTATTTCCTAAT
GGTATAATTGAATTTGAAGAGCGCAGTCGTTCAGTAAAAATCCCTAATCG
GAAATGTGAAGCATTAACAAGACGACCAAAATTTGCTCCTATCAGAGAAC
AACCAGATTATTTATCTCATACTTCTGATATGAAACTTAGAGATTATCAA
TTAGATGGGGTTAATTGGCTTGCTCATGCATGGACAAGAGGTAACAGTGT
TATTCTCGCTGATGAAATGGGATTAGGTAAAACAATTCAAACTATTGGAT
TTCTTTCATATTTATTTAACCAACATACTATTTTTGGTCCATTCTTACTG
GTCGTTCCATTGAGTACTATTAGTAGTTGGCAAACAGAATTTAATATATG
GGCCCCATATATGAATATTATCATTTATACTGGAGATGCTGTTTCTCGAC
AAGTTATTCGGGAATGCGAATGGTATTTTCCCAAGAAGAAAATGTTAAAG
TTTCATGTTTGTATTACAACTTATGAATTATTATTAAAAGATAAAGATTG
GCTTAATAAAATTTCATGGGCATTTCTAGGTGTTGACGAAGCCCATCGTC
TTAAAAATGATGAAAGCCAATTATATAATTTTTTAATAACATTTGATACA
AATACACGATTGTTAATCACTGGAACACCAGTTCATAATTCATTAAGAGA
ATTGTGGGCGTTACTTCATTTCATTATGCCAGACAAATTTAATACATGGC
CAGATTTTGAAGATCGATACAATATATCTAATGAAAACAGGGAAGTGGAA
GAAGTTGTTAGTGAGTTATATAAAGTTTTGGAGCCGTTTTTACTGAGAAG
AACTAAGAAAGATGTGGAAAAGTCTTTGCCATCTAAAAGTGAACAAATTA
TTAGAGTACCGATGTGTCGTAAACAAACAGAGTTATATAAGTTAATATTA
ACGAAGAATTATGAAGCATTATCAAAAGAAACCAGGGGGCATACTTCTTC
ATTTCTAAATATTGTTATGGAATTAAAAAAATGCTGTAATCATGTTCAGT
TGGTAAATCCATTAGACGAAGAAACTGAAAATAAAATGGATCCCGACAGT
CACCTGAGATATTATATTAAGTCTAGTGGTAAAATGATGCTTTTGGATAA
ATTAATGTTTGAATTGAAAGAAAAAGGTCATAGAGTTTTAATATTTTCTC
AAATGGTTAGAATGCTGGATATTATTTCTGATTATTTGGTTTTAAGAGGT
TGGGGTTTTCAAAGACTGGATGGGTCTATAAAGGGTAGTCTCAGAAAACA
GGCAATAGATCATTTTAATGCAGAAGGTTCCACAGACTTTTGTTTTTTAC
TTTCCACAAGAGCTGGTGGCTTAGGTATTAATCTAGCTACTGCTGACACT
GTAATTATTTTTGATTCCGATTGGAATCCTCAAAATGATTTGCAAGCCAT
GGCAAGAGCTCATAGAATAGGCCAGAAAAGGCAAGTATCGGTATATAGAT
TTGTAATAAAAAATTCAATTGAAGAAAAAATAATTGAATGCGCTAAAAGA
AAAATGGTATTAGATCATCTGGTGATTCAAAGAATGGATTCTGCTTTACA
TCGAAAAACTGATGCAAACAAGAATCAACCATTTAGTAAAGATGAACTTA
ATGAAATTTTAAAATTCGGAGCAGCTGATTTATTCAATCAAGACGAGGAG
CTGGATGAAGAACAGGAATTAAATATTCAAGATATTTTGCAACGAGCGGA
AACTACAAATCATGATGATGAAAGTCACAATCCCGCAAATGATTTATTGT
CAGCTTTTAAAGTCGTTAATATTACTGAAACAGCAGAAGATGAAGATATT
GTTTATATTGGACACAAAGGAAAGCCAAAATTATGGAGTGATATTGTTCC
TCAGGATCTCCGAGAAAAAATTAAAGAAGAGGAACATCAGAAAGCTCTTT
TAGAGTTAGAATTAGGTCCAAGGCAGCGAAAAAAAGTTAAAGCTTATCAA
GTGGGACAGGTTAATTCAACTAGTGAAGAAAGTTCCGAAGAAGATAATAA
AGAAACAGGAGGGAAATTAACTGATAAAGAAATAAAGTCCATAATAAAAG
TAATGAAAAAGTTTCCCAGGCCTCTAGAACGAATTCAATCTATCATGGTT
GAAGCAGAAATAATTGACCACACAGAGAAAGAAGTTTATGACGTAATGAA
GCAAATTATTAATGGTTGTAATGCAGTGTATAGCGAATGTGATACAGAAG
AAAAGAAAAATAAAGCTGTATTTACCATTCGTAAAATTGTAATCTCTGTA
AAAAATATTTTACAGTCCCTTGATGATTTAGACATTTTACATCAAATTTT
ACCAAAAAATAAAGAAGAGAGATTAAAATTTGTGTTACCATTTGAAACTA
AACTGGCTAATTGGTCATGTATGTGGGAGACAGAAGACGATGCTCGTCTT
TTAGTAGGTGTTTTTGAAAGAGGATTGGACAATTGGGAAGCTATTAAAAT
GGACCTTGATCTAAAATTAACTAGTAAAATTTTACCGTCATCAGCAAGTG
AAAGACCTCAAGCTAGTCATTTAAGAACTCGAGTTGAATATCTTTTAAAG
AAATTACGAGATTCTAAAATTGTTGTCAAGTCTGAGTCGGTTGTTGTGAA
AAAAGTAATAAAGTCATCGAAAGTAGACATCAATAAAAAGTCAAAAGTCA
AAACAAAAGTCAATCATGTAACAAATCCAAAATCTGCTGAGTTTGTCGAA
TCAAGTGATAACAGCAGTAGAAAATCAGATGCTAAAAATAAATCCAAGCA
CAAAAGTAAATCTAACAAATCTAAATCTGTGTCAGAGAACCCGAAACGTG
AAAGTAAATCTCATGGTGATGATGATCATGAACATTTATTTTACGAAATG
CAAGGACCTCTATTTGACAAGTGCACGAAAAGAATGAAACCCATCAAGTC
CAAATTAAAGTTCTTGGAGGACATGCAAAGAAGGAGTGGCAGTAAAATTA
AAGTTGATGACAAACAATTAAGTGACTGTTTATTGGCAATCGGAAATCAC
ATTAGAAGTGTCATATTAAATTTTGATAATGATGAACAAAAGCGTCAATG
GAGAAACTATCTATGGTCGTTTGTAAATTTCTTTTTTGATGTATTTCCCA
AGGAAACATTGCACAGAATTTATAAAAGTGCATATAAGAAATCTGAAGTC
AAATCAATAAACAAAGATTCATCCAACAATAATAAACAGAATAATAACGG
AAAACACGATTCATTTATAAACAAAGGAAGTGAGAGTGTAAAAGAGAGTA
AAACCCAATCGGATAAGGTAAAATGCAATTTTGAAGCGAGGTCGTATCAA
GAATATATAAAAATGAAGAATTGGAATGGTGAGACAACCAAAACTTTTGA
TGATAATAATAGAAATGAAAAATATAAGCCATATAGTCGTTCGAGTTTTA
ATGACAAAAGAAATGACAAAACTTACAAGTCATATCACGATAGAGATGAC
AAATCAGATTTCGATAGGAATCGGAAATCCGGCAGTTCGTACAATAATTT
TGAAAATTCTCAGAGTAATTATAAATCAAATTCCAAATCGGGAGCAAATT
TCAGTCGTGATCCTCGTCTTTCCAAATCAACTATAAATTGAAAATAGCCT
TATCTTTCTCTTATTGCATTTCATTTCATAAACCAAATA
back to top

protein sequence of SMED30006818-orf-1

>SMED30006818-orf-1 ID=SMED30006818-orf-1|Name=SMED30006818-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1559bp
MTMLDYSDEESSRNSIDSSNESEVILPSKTRQRSLLDEIKENPDLYTTRR
SERNRKEPSRFNILSERGSQGNRLSRKIYSGSTSEENDDEENDDSDFVYS
KRNKKYNQKQKMEFRKRAHVSYKEVVTSDEDVGSDDSGQPKKKVAKINNS
NGFTNVRDNPLLNKPLILIRGEKIDNECIEGSYDDQRMSEFISEEVNVIE
EVLNFRIGFVGNTGIETSYYNKVLKNEKYGNDDNNSDETERQYLIKWREW
SHIHSTWESETTVQTYQNFDGMKKLLKFKEIQKRREIWKKHHASPEDLDA
AQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWE
SGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYL
SHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYL
FNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRE
CEWYFPKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDE
SQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFED
RYNISNENREVEEVVSELYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPM
CRKQTELYKLILTKNYEALSKETRGHTSSFLNIVMELKKCCNHVQLVNPL
DEETENKMDPDSHLRYYIKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRM
LDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRA
GGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKN
SIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILK
FGAADLFNQDEELDEEQELNIQDILQRAETTNHDDESHNPANDLLSAFKV
VNITETAEDEDIVYIGHKGKPKLWSDIVPQDLREKIKEEEHQKALLELEL
GPRQRKKVKAYQVGQVNSTSEESSEEDNKETGGKLTDKEIKSIIKVMKKF
PRPLERIQSIMVEAEIIDHTEKEVYDVMKQIINGCNAVYSECDTEEKKNK
AVFTIRKIVISVKNILQSLDDLDILHQILPKNKEERLKFVLPFETKLANW
SCMWETEDDARLLVGVFERGLDNWEAIKMDLDLKLTSKILPSSASERPQA
SHLRTRVEYLLKKLRDSKIVVKSESVVVKKVIKSSKVDINKKSKVKTKVN
HVTNPKSAEFVESSDNSSRKSDAKNKSKHKSKSNKSKSVSENPKRESKSH
GDDDHEHLFYEMQGPLFDKCTKRMKPIKSKLKFLEDMQRRSGSKIKVDDK
QLSDCLLAIGNHIRSVILNFDNDEQKRQWRNYLWSFVNFFFDVFPKETLH
RIYKSAYKKSEVKSINKDSSNNNKQNNNGKHDSFINKGSESVKESKTQSD
KVKCNFEARSYQEYIKMKNWNGETTKTFDDNNRNEKYKPYSRSSFNDKRN
DKTYKSYHDRDDKSDFDRNRKSGSSYNNFENSQSNYKSNSKSGANFSRDP
RLSKSTIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000012neural progenitor cell
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000463cholinergic neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR025260DUF4208
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR000953Chromo/chromo_shadow_dom
IPR027417P-loop_NTPase
IPR000330SNF2_N
IPR023780Chromo_domain
IPR016197Chromo-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003677DNA binding
GO:0004386helicase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus