Abhydrolase domain containing 8b

Overview
NameAbhydrolase domain containing 8b
Smed IDSMED30006816
Length (bp)1511
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Abhydrolase domain containing 8b (SMED30006816) t-SNE clustered cells

Violin plots show distribution of expression levels for Abhydrolase domain containing 8b (SMED30006816) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Abhydrolase domain containing 8b (SMED30006816) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Abhydrolase domain containing 8b (SMED30006816) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006816

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30006816SMESG000041066.1 dd_Smed_v4_11027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Abhydrolase domain containing 8b vs. Ensembl Human
Match: ABHD8 (abhydrolase domain containing 8 [Source:HGNC Symbol;Acc:HGNC:23759])

HSP 1 Score: 172.17 bits (435), Expect = 1.410e-47
Identity = 99/264 (37.50%), Postives = 142/264 (53.79%), Query Frame = 2
Query:  134 SIDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILPLFRSQ--AHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAM 910
            +I +D  +RI   +  +  V      LFFIHGVGGS  IW+ Q+ FF  L YEV+  DL GHG SS  +    Y F  L++D   +F R+     +N ++GHSYG S  T++AH   +LV ++++I+GG  + L +P     F +  C L CL P +   F     A  G       K+  + NV S VL+AM+ GQ W EG   YH+++ VP LL+HG  DKFV ++E+  M   L L  L  + +  HM ML+    VN  +
Sbjct:  157 TIHIDCEKRITSCKGAQADVV-----LFFIHGVGGSLAIWKEQLDFFVRLGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFKRY--AKKRNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTAL-EPSFCSIFNMPTCVLHCLSPCLAWSFLKAGFARQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLECPETVNTLL 412          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Human
Match: EPHX2 (epoxide hydrolase 2 [Source:HGNC Symbol;Acc:HGNC:3402])

HSP 1 Score: 51.6026 bits (122), Expect = 1.827e-6
Identity = 27/83 (32.53%), Postives = 42/83 (50.60%), Query Frame = 2
Query:  224 HGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVA 472
            HG   S + W+ QI       Y V+ +D+ G+G SS   +IE+Y    L K+ +T  D+  L   Q   +GH +G  +  Y+A
Sbjct:  224 HGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLS--QAVFIGHDWGGMLVWYMA 304          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Human
Match: EPHX2 (epoxide hydrolase 2 [Source:HGNC Symbol;Acc:HGNC:3402])

HSP 1 Score: 51.6026 bits (122), Expect = 1.905e-6
Identity = 27/83 (32.53%), Postives = 42/83 (50.60%), Query Frame = 2
Query:  224 HGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVA 472
            HG   S + W+ QI       Y V+ +D+ G+G SS   +IE+Y    L K+ +T  D+  L   Q   +GH +G  +  Y+A
Sbjct:   82 HGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGL--SQAVFIGHDWGGMLVWYMA 162          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Human
Match: EPHX2 (epoxide hydrolase 2 [Source:HGNC Symbol;Acc:HGNC:3402])

HSP 1 Score: 51.9878 bits (123), Expect = 2.164e-6
Identity = 27/83 (32.53%), Postives = 42/83 (50.60%), Query Frame = 2
Query:  224 HGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVA 472
            HG   S + W+ QI       Y V+ +D+ G+G SS   +IE+Y    L K+ +T  D+  L   Q   +GH +G  +  Y+A
Sbjct:  212 HGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGL--SQAVFIGHDWGGMLVWYMA 292          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Human
Match: EPHX2 (epoxide hydrolase 2 [Source:HGNC Symbol;Acc:HGNC:3402])

HSP 1 Score: 51.6026 bits (122), Expect = 2.363e-6
Identity = 27/83 (32.53%), Postives = 42/83 (50.60%), Query Frame = 2
Query:  224 HGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVA 472
            HG   S + W+ QI       Y V+ +D+ G+G SS   +IE+Y    L K+ +T  D+  L   Q   +GH +G  +  Y+A
Sbjct:  199 HGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGL--SQAVFIGHDWGGMLVWYMA 279          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Zebrafish
Match: BX279524.1 (abhydrolase domain containing 8b [Source:NCBI gene;Acc:101883400])

HSP 1 Score: 175.637 bits (444), Expect = 9.024e-49
Identity = 115/323 (35.60%), Postives = 161/323 (49.85%), Query Frame = 2
Query:  134 SIDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEV--TFVLSDCCLRCLHPLILP--LFRSQAHYGCSSSNYEKKI-----SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHFHKDWSTVAPNSLSNGDQFLGSCSVIDLSIPEKSQNDAKISPKILMHRKTMP 1075
            SI +D  R+I C +     V+     LFFIHGVGGS  IW++Q+ FF+ L YEVI +DL GHG SS  +    Y F  L++D   +F R+     +N +VGHSYG S  T++AH     V ++V+I+GG  + L +P +   F L  C L  L P +    L    AH G      EKK+     + NV S VL++M+ GQ W EG   YH++I VP LL+HG  DKFV + E+  M   L L  L  +    HM M++    VN  +   F    +T +            + S  D S P+ +      S   L+   T P
Sbjct:  137 SIVIDCERKITCCKGTHPDVA-----LFFIHGVGGSLDIWRSQLDFFSQLGYEVIAMDLAGHGASSAPRIPAAYTFYALAEDVRIIFKRY--AKRRNILVGHSYGVSFCTFLAHEYPEQVHKLVMINGGGPTAL-EPSLCSVFNLPTCVLNFLSPCLTWSFLMAGFAHQG----TREKKLLKENNAFNVSSFVLRSMMSGQYWPEGDEVYHAEITVPVLLVHGMYDKFVPVQEDQRMAEILLLGFLKVLDDGSHMVMMECPDVVNTLLHEFFLWQPATASKPKQEAAPTKTNTKSPEDTSRPKTAPKSPSKSQPDLLRPTTAP 447          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Zebrafish
Match: abhd8b (abhydrolase domain containing 8b [Source:ZFIN;Acc:ZDB-GENE-130530-805])

HSP 1 Score: 175.252 bits (443), Expect = 9.702e-49
Identity = 115/323 (35.60%), Postives = 161/323 (49.85%), Query Frame = 2
Query:  134 SIDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEV--TFVLSDCCLRCLHPLILP--LFRSQAHYGCSSSNYEKKI-----SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHFHKDWSTVAPNSLSNGDQFLGSCSVIDLSIPEKSQNDAKISPKILMHRKTMP 1075
            SI +D  R+I C +     V+     LFFIHGVGGS  IW++Q+ FF+ L YEVI +DL GHG SS  +    Y F  L++D   +F R+     +N +VGHSYG S  T++AH     V ++V+I+GG  + L +P +   F L  C L  L P +    L    AH G      EKK+     + NV S VL++M+ GQ W EG   YH++I VP LL+HG  DKFV + E+  M   L L  L  +    HM M++    VN  +   F    +T +            + S  D S P+ +      S   L+   T P
Sbjct:  136 SIVIDCERKITCCKGTHPDVA-----LFFIHGVGGSLDIWRSQLDFFSQLGYEVIAMDLAGHGASSAPRIPAAYTFYALAEDVRIIFKRY--AKRRNILVGHSYGVSFCTFLAHEYPEQVHKLVMINGGGPTAL-EPSLCSVFNLPTCVLNFLSPCLTWSFLMAGFAHQG----TREKKLLKENNAFNVSSFVLRSMMSGQYWPEGDEVYHAEITVPVLLVHGMYDKFVPVQEDQRMAEILLLGFLKVLDDGSHMVMMECPDVVNTLLHEFFLWQPATASKPKQEAAPTKTNTKSPEDTSRPKTAPKSPSKSQPDLLRPTTAP 446          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Zebrafish
Match: BX279524.1 (abhydrolase domain containing 8b [Source:NCBI gene;Acc:101883400])

HSP 1 Score: 175.637 bits (444), Expect = 9.955e-49
Identity = 115/323 (35.60%), Postives = 161/323 (49.85%), Query Frame = 2
Query:  134 SIDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEV--TFVLSDCCLRCLHPLILP--LFRSQAHYGCSSSNYEKKI-----SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHFHKDWSTVAPNSLSNGDQFLGSCSVIDLSIPEKSQNDAKISPKILMHRKTMP 1075
            SI +D  R+I C +     V+     LFFIHGVGGS  IW++Q+ FF+ L YEVI +DL GHG SS  +    Y F  L++D   +F R+     +N +VGHSYG S  T++AH     V ++V+I+GG  + L +P +   F L  C L  L P +    L    AH G      EKK+     + NV S VL++M+ GQ W EG   YH++I VP LL+HG  DKFV + E+  M   L L  L  +    HM M++    VN  +   F    +T +            + S  D S P+ +      S   L+   T P
Sbjct:  142 SIVIDCERKITCCKGTHPDVA-----LFFIHGVGGSLDIWRSQLDFFSQLGYEVIAMDLAGHGASSAPRIPAAYTFYALAEDVRIIFKRY--AKRRNILVGHSYGVSFCTFLAHEYPEQVHKLVMINGGGPTAL-EPSLCSVFNLPTCVLNFLSPCLTWSFLMAGFAHQG----TREKKLLKENNAFNVSSFVLRSMMSGQYWPEGDEVYHAEITVPVLLVHGMYDKFVPVQEDQRMAEILLLGFLKVLDDGSHMVMMECPDVVNTLLHEFFLWQPATASKPKQEAAPTKTNTKSPEDTSRPKTAPKSPSKSQPDLLRPTTAP 452          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Zebrafish
Match: BX279524.1 (abhydrolase domain containing 8b [Source:NCBI gene;Acc:101883400])

HSP 1 Score: 174.866 bits (442), Expect = 1.091e-48
Identity = 115/323 (35.60%), Postives = 161/323 (49.85%), Query Frame = 2
Query:  134 SIDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEV--TFVLSDCCLRCLHPLILP--LFRSQAHYGCSSSNYEKKI-----SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHFHKDWSTVAPNSLSNGDQFLGSCSVIDLSIPEKSQNDAKISPKILMHRKTMP 1075
            SI +D  R+I C +     V+     LFFIHGVGGS  IW++Q+ FF+ L YEVI +DL GHG SS  +    Y F  L++D   +F R+     +N +VGHSYG S  T++AH     V ++V+I+GG  + L +P +   F L  C L  L P +    L    AH G      EKK+     + NV S VL++M+ GQ W EG   YH++I VP LL+HG  DKFV + E+  M   L L  L  +    HM M++    VN  +   F    +T +            + S  D S P+ +      S   L+   T P
Sbjct:  127 SIVIDCERKITCCKGTHPDVA-----LFFIHGVGGSLDIWRSQLDFFSQLGYEVIAMDLAGHGASSAPRIPAAYTFYALAEDVRIIFKRY--AKRRNILVGHSYGVSFCTFLAHEYPEQVHKLVMINGGGPTAL-EPSLCSVFNLPTCVLNFLSPCLTWSFLMAGFAHQG----TREKKLLKENNAFNVSSFVLRSMMSGQYWPEGDEVYHAEITVPVLLVHGMYDKFVPVQEDQRMAEILLLGFLKVLDDGSHMVMMECPDVVNTLLHEFFLWQPATASKPKQEAAPTKTNTKSPEDTSRPKTAPKSPSKSQPDLLRPTTAP 437          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Zebrafish
Match: abhd8b (abhydrolase domain containing 8b [Source:ZFIN;Acc:ZDB-GENE-130530-805])

HSP 1 Score: 175.637 bits (444), Expect = 1.184e-48
Identity = 115/323 (35.60%), Postives = 161/323 (49.85%), Query Frame = 2
Query:  134 SIDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEV--TFVLSDCCLRCLHPLILP--LFRSQAHYGCSSSNYEKKI-----SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHFHKDWSTVAPNSLSNGDQFLGSCSVIDLSIPEKSQNDAKISPKILMHRKTMP 1075
            SI +D  R+I C +     V+     LFFIHGVGGS  IW++Q+ FF+ L YEVI +DL GHG SS  +    Y F  L++D   +F R+     +N +VGHSYG S  T++AH     V ++V+I+GG  + L +P +   F L  C L  L P +    L    AH G      EKK+     + NV S VL++M+ GQ W EG   YH++I VP LL+HG  DKFV + E+  M   L L  L  +    HM M++    VN  +   F    +T +            + S  D S P+ +      S   L+   T P
Sbjct:  151 SIVIDCERKITCCKGTHPDVA-----LFFIHGVGGSLDIWRSQLDFFSQLGYEVIAMDLAGHGASSAPRIPAAYTFYALAEDVRIIFKRY--AKRRNILVGHSYGVSFCTFLAHEYPEQVHKLVMINGGGPTAL-EPSLCSVFNLPTCVLNFLSPCLTWSFLMAGFAHQG----TREKKLLKENNAFNVSSFVLRSMMSGQYWPEGDEVYHAEITVPVLLVHGMYDKFVPVQEDQRMAEILLLGFLKVLDDGSHMVMMECPDVVNTLLHEFFLWQPATASKPKQEAAPTKTNTKSPEDTSRPKTAPKSPSKSQPDLLRPTTAP 461          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Xenopus
Match: usp13 (ubiquitin specific peptidase 13 [Source:Xenbase;Acc:XB-GENE-998128])

HSP 1 Score: 174.481 bits (441), Expect = 1.278e-48
Identity = 100/265 (37.74%), Postives = 144/265 (54.34%), Query Frame = 2
Query:  137 IDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILPLFRSQAHYGCSSSNYEKKI-----SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAM 910
            I VD  R++ C +     V      LFFIHGVGGS  IW+ Q+ FF+ L YEV+  DL GHG S+  +    Y F  L++D   +F R+  +  +N +VGHSYG S  T++AH   +LV ++V+I+GG  + L +P +   F +  C L CL P +   F             EK++     + NV S VL+AM+ GQ W EG   YH+++ VP LL+HG  DKFV +DE+  M   L +  L  + +  HM ML+    VN  +
Sbjct:  149 IMVDCQRQVTCCKGTHSDVV-----LFFIHGVGGSLDIWKEQLDFFSKLGYEVVAPDLVGHGASTAPQIGAAYSFYALAEDMRCIFKRYAKK--RNILVGHSYGVSFCTFLAHEYPDLVHKVVMINGGGPTAL-EPSLCSIFNMPTCVLHCLSPCLAWSFLKAGF--ARQGAKEKQLLREGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPILLVHGMHDKFVPLDEDQRMAEILLITFLKVIEEGSHMVMLECPETVNTLL 403          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Mouse
Match: Abhd8 (abhydrolase domain containing 8 [Source:MGI Symbol;Acc:MGI:1918946])

HSP 1 Score: 173.711 bits (439), Expect = 2.736e-48
Identity = 99/261 (37.93%), Postives = 143/261 (54.79%), Query Frame = 2
Query:  134 SIDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILPLFRSQ--AHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVN 901
            +I +D  +RI   +  +  V      LFFIHGVGGS  IW+ Q+ FF  L YEV+  DL GHG SS  +    Y F  L++D   +F R+  +  +N ++GHSYG S  T++AH   +LV ++++I+GG  + L +P +   F +  C L CL P +   F     A  G       K+  + NV S VL+AM+ GQ W EG   YH+++ VP LL+HG  DKFV ++E+  M   L L  L  + +  HM ML+    VN
Sbjct:  149 TIHIDCEQRITSCKGAQADVV-----LFFIHGVGGSLAIWKEQLDFFVRLGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFTRYAKK--RNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTAL-EPSLCSIFNMPTCVLHCLSPCLAWSFLKAGFARQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIEEGSHMVMLECPETVN 401          
BLAST of Abhydrolase domain containing 8b vs. UniProt/SwissProt
Match: sp|Q6AX59|ABHD8_XENLA (Protein ABHD8 OS=Xenopus laevis OX=8355 GN=abhd8 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.351e-47
Identity = 101/269 (37.55%), Postives = 145/269 (53.90%), Query Frame = 2
Query:  137 IDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILPLFRSQAHYGCSSSNYEKKI-----SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHF 922
            I VD  R++ C +     V      LFFIHGVGGS  IW+ Q+ FF+ L YEV+  DL GHG S+  +    Y F  L++D   +F R+  +  +N +VGHSYG S  T++AH   +LV ++V+I+GG  + L +P +   F +  C L CL P +   F             EK++     + NV S VL+AM+ GQ W EG   YH+++ VP LL+HG  DKFV +DE+  M   L +  L  + +  HM ML+    VN  +   F
Sbjct:  149 IMVDCQRQVKCCKGTHSDVV-----LFFIHGVGGSLDIWKEQLDFFSKLGYEVVAPDLVGHGASTAPQIGAAYTFYALAEDMRCIFKRYAKK--RNILVGHSYGVSFCTFLAHEYPDLVHKVVMINGGGPTAL-EPSLCSIFNMPTCVLHCLSPCLAWSFLKAGF--ARQGAKEKQLLREGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPILLVHGMHDKFVPLDEDQRMAEILLITFLKIIEEGSHMVMLECPETVNTLLHEFF 407          
BLAST of Abhydrolase domain containing 8b vs. UniProt/SwissProt
Match: sp|Q8R0P8|ABHD8_MOUSE (Protein ABHD8 OS=Mus musculus OX=10090 GN=Abhd8 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.914e-47
Identity = 99/261 (37.93%), Postives = 143/261 (54.79%), Query Frame = 2
Query:  134 SIDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILPLFRSQ--AHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVN 901
            +I +D  +RI   +  +  V      LFFIHGVGGS  IW+ Q+ FF  L YEV+  DL GHG SS  +    Y F  L++D   +F R+  +  +N ++GHSYG S  T++AH   +LV ++++I+GG  + L +P +   F +  C L CL P +   F     A  G       K+  + NV S VL+AM+ GQ W EG   YH+++ VP LL+HG  DKFV ++E+  M   L L  L  + +  HM ML+    VN
Sbjct:  149 TIHIDCEQRITSCKGAQADVV-----LFFIHGVGGSLAIWKEQLDFFVRLGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFTRYAKK--RNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTAL-EPSLCSIFNMPTCVLHCLSPCLAWSFLKAGFARQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIEEGSHMVMLECPETVN 401          
BLAST of Abhydrolase domain containing 8b vs. UniProt/SwissProt
Match: sp|Q17QP1|ABHD8_BOVIN (Protein ABHD8 OS=Bos taurus OX=9913 GN=ABHD8 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 2.250e-47
Identity = 99/261 (37.93%), Postives = 143/261 (54.79%), Query Frame = 2
Query:  134 SIDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEV--TFVLSDCCLRCLHPLILPLFRSQ--AHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVN 901
            +I +D  +RI   +  +  V      LFFIHGVGGS  IW+ Q+ FF  L YEV+  DL GHG SS  +    Y F  L++D   +F R+  +  +N ++GHSYG S  T++AH   +LV ++++I+GG  + L +P +   F +  C L CL P +   F     A  G       K+  + NV S VL+AM+ GQ W EG   YH+++ VP LL+HG  DKFV ++E+  M   L L  L  + +  HM ML+    VN
Sbjct:  150 TIHIDCEKRITSCKGAQADVV-----LFFIHGVGGSLAIWKEQLDFFVRLGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFKRYAKK--RNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTAL-EPSLCSVFNMPTCVLHCLSPCLAWSFLKAGFARQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLECPETVN 402          
BLAST of Abhydrolase domain containing 8b vs. UniProt/SwissProt
Match: sp|Q96I13|ABHD8_HUMAN (Protein ABHD8 OS=Homo sapiens OX=9606 GN=ABHD8 PE=1 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 6.770e-47
Identity = 99/264 (37.50%), Postives = 142/264 (53.79%), Query Frame = 2
Query:  134 SIDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILPLFRSQ--AHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAM 910
            +I +D  +RI   +  +  V      LFFIHGVGGS  IW+ Q+ FF  L YEV+  DL GHG SS  +    Y F  L++D   +F R+     +N ++GHSYG S  T++AH   +LV ++++I+GG  + L +P     F +  C L CL P +   F     A  G       K+  + NV S VL+AM+ GQ W EG   YH+++ VP LL+HG  DKFV ++E+  M   L L  L  + +  HM ML+    VN  +
Sbjct:  157 TIHIDCEKRITSCKGAQADVV-----LFFIHGVGGSLAIWKEQLDFFVRLGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFKRY--AKKRNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTAL-EPSFCSIFNMPTCVLHCLSPCLAWSFLKAGFARQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLECPETVNTLL 412          
BLAST of Abhydrolase domain containing 8b vs. UniProt/SwissProt
Match: sp|Q4R584|ABHD8_MACFA (Protein ABHD8 OS=Macaca fascicularis OX=9541 GN=ABHD8 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 7.275e-47
Identity = 99/261 (37.93%), Postives = 142/261 (54.41%), Query Frame = 2
Query:  134 SIDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILPLFRSQ--AHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVN 901
            +I +D  +RI   +  +  V      LFFIHGVGGS  IW+ Q+ FF  L YEV+  DL GHG SS  +    Y F  L++D   +F R+  +  +N ++GHSYG S  T++AH   +LV ++++I+GG  + L +P     F +  C L CL P +   F     A  G       K+  + NV S VL+AM+ GQ W EG   YH+++ VP LL+HG  DKFV ++E+  M   L L  L  + +  HM ML+    VN
Sbjct:  158 TIHIDCEKRITSCKGAQADVV-----LFFIHGVGGSLAIWKEQLDFFVRLGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFKRYAKK--RNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTAL-EPSFCSIFNMPTCVLHCLSPCLAWSFLKAGFARQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLECPETVN 410          
BLAST of Abhydrolase domain containing 8b vs. TrEMBL
Match: A0A3M6TVJ3 (AB hydrolase-1 domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00000803 PE=4 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 2.078e-54
Identity = 122/347 (35.16%), Postives = 189/347 (54.47%), Query Frame = 2
Query:  197 KKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPL---GDPEVTFVLSDCCLRCLHPLILPLFRSQAHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHFHKDWSTVAPNSLSNGDQFLGSCSVIDLSIPEKSQNDAKISPKILMHRKTMPIGLLVRRKSTQLSL----KRALSMRSSFQ--NFENNV-SQEITVQETISE 1204
            KK+  +FFIHGVGGS+ +W  Q+ +F    YEVI  DL GHG SS   +  DYEF +LS D L +FDR+  +  +N +VGHSYG S    +A  R  LV +MVLISGG  +PL   G  +V F L    L C+ P+ L ++  +A+    + +  KK+ + +    V+KA++ GQVW++G   YH ++ VP LLI+G +DKFV+++EE  MQ  +   +L  ++ AGHM M+++   VN  +     +D +T    SL  G Q     S   L +  K +     + +  +   +  +    RR S+ ++L    K + +++SS    N   NV S  I+  + + E
Sbjct:   75 KKIVVIFFIHGVGGSADLWYEQVQYFCKAGYEVIAPDLLGHGQSSAPNNTSDYEFSELSYDLLRLFDRYHKK--RNVLVGHSYGASFCAVIACERARLVSKMVLISGGGPTPLVGVGTCDV-FCLPTLLLSCIKPVFLSVYERRAYNSMRARSLRKKVKAFSAPPFVMKAVMAGQVWEDGDETYHQELMVPALLIYGAQDKFVTLEEEQWMQEVIYSSSLEVIQDAGHMVMVESPVRVNWLIYNFLQRDATT---RSLHAGSQSCNLSSKGSLHVASKDEPAPSRTLEAGLQTVSESVNEETRRHSSGMALGPSGKNSFNIQSSQASLNVPGNVASARISTADDVEE 415          
BLAST of Abhydrolase domain containing 8b vs. TrEMBL
Match: A0A2B4SYK5 (Abhydrolase domain-containing protein 8 OS=Stylophora pistillata OX=50429 GN=abhd8 PE=4 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.197e-53
Identity = 113/313 (36.10%), Postives = 177/313 (56.55%), Query Frame = 2
Query:  212 LFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPL---GDPEVTFVLSDCCLRCLHPLILPLFRSQAHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHFHKDWSTVAPNSLSN-GDQFL-----GSCSVIDLSIPEKSQNDAKISPKILMHRKTMPIGLLVRRKSTQLSLK 1120
            +FFIHGVGG + +W  Q+ +F    YEV+  DL GHG SS   +I DYEF +LS D L +FDR+  +  +N +VGHSYG S    +A  R  LV +MVLISGG  +PL   G  ++ F L    L C+ P+ L ++  +A+    + +  +K+ + +    V+KA++ GQVW++G   YH ++ VP LLI+G +DKFV+++EE  MQ  +   +L  ++ AGHM M+++   VN  +     +D +T    SL N G Q+      GS  V     P  S+N+A+      +   +  +    RR+S+ ++L+
Sbjct:   80 IFFIHGVGGCADLWYEQVQYFCKAGYEVVAPDLLGHGQSSAPNNIADYEFSELSYDLLRLFDRYHKK--RNVLVGHSYGASFCAVIACERARLVSKMVLISGGGPTPLVGVGTCDM-FCLPTLLLSCIKPVFLSVYERRAYNSVRARSLRRKVKAFSAPPFVMKAVMAGQVWEDGDESYHQELMVPALLIYGAQDKFVTLEEEQWMQEVIYSSSLEVIQDAGHMVMVESPVRVNWLIHNFLQRDATT---RSLHNVGSQYFNFSSKGSLHVASKDKPTPSRNEAE------LQTVSESVNEGTRRRSSGMALE 380          
BLAST of Abhydrolase domain containing 8b vs. TrEMBL
Match: R7VHZ7 (AB hydrolase-1 domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_83871 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 4.064e-53
Identity = 96/230 (41.74%), Postives = 138/230 (60.00%), Query Frame = 2
Query:  212 LFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVTFVLSDCCLRCLHPLILPLFRSQAHYGCSSSNYEKKISINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVN 901
            LFF HGV GSS +W++QI  F    YE+++ DL GHG+S+  +++  Y F +++ D L +FD   L   +N +VGHSYG S A  +A NR   V ++++ISGGS +PL      F    CCL C  PL+   F   A +  S +   +  + ++ S VLK ++ GQ+WDEG   +H  I  PTLLIHGK D+ VS++EE +M  A+  CNL  V  A HM M++  +EVN
Sbjct:    5 LFFFHGVAGSSEVWRSQIDHFGRQGYEMVIPDLIGHGMSATPQNLNAYTFDEIASDLLVLFDL--LCKKRNVLVGHSYGSSFAAVIARNRPTRVSKLIMISGGSPTPLAPQPGLFQAPVCCLDCFTPLLHHQFFKSAFHKKSKTCGLRDRAFDIPSYVLKGIMNGQIWDEGDAEFHEWINAPTLLIHGKHDQLVSVEEEKEMVDAIFDCNLVVVEDASHMVMMEKPSEVN 232          
BLAST of Abhydrolase domain containing 8b vs. TrEMBL
Match: V4BFA3 (AB hydrolase-1 domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_75209 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 5.441e-53
Identity = 94/234 (40.17%), Postives = 138/234 (58.97%), Query Frame = 2
Query:  212 LFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIV-GHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVTFVLSDCCLRCLHPLILPLFRSQAHYGCSSSNYEKKISINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAM 910
            LFFIHGVGGSS IW++QI +F  L YE++  DL GHGLS   KD++ Y F +++ D   +FD++     +NN+V GHSYGCS A ++A NR   V ++V+ISGG   PL      F L    L CL P +   +   A       +     + ++ + VL  ++ GQ+W +G  FYH+ I  PTLLI+G++DK +++ EE  M+ A+  C L  + +AGHM ML+    VN  +
Sbjct:    6 LFFIHGVGGSSDIWKSQIDYFRKLGYEIVAPDLIGHGLSCAPKDLKSYHFDQIAADIEEIFDKY---CKRNNVVIGHSYGCSFAAFLARNRTRRVTKLVMISGGGPIPLAPQTNVFSLPVSILSCLRPCVQCKYERSAFSQSKKPDKLSYEAFSIPTYVLSNIMKGQIWSDGDEFYHNWIVSPTLLIYGQQDKLITLREEERMREAIYNCELQVLPEAGHMVMLEEPETVNKLL 236          
BLAST of Abhydrolase domain containing 8b vs. TrEMBL
Match: T1G746 (AB hydrolase-1 domain-containing protein OS=Helobdella robusta OX=6412 GN=20216893 PE=4 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.577e-50
Identity = 93/241 (38.59%), Postives = 147/241 (61.00%), Query Frame = 2
Query:  212 LFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVTFVLSDCCLRCLHPLILPLFRSQAHYGCSSSNYEKKISINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHFHKDW 934
            +F IHGVGG   +W  QI+F  N  + VI ++L GHG SSK +D   Y F K+SKD   +FD+F ++  +N IVGHSYGC  A  +A  + + +  +++ISGG+  PLG     F L  CCL+C+  ++   F S++ +  + +N     +I V   VLK  + GQ WDEGG  ++S I  PTLLI GK+D+ +S++E   M++ +   +L  +   GHM ML++  ++N ++IA+F +++
Sbjct:   22 VFMIHGVGGKFKVWSPQITFLNNYGFTVIALNLIGHGGSSKPRDQAAYTFEKMSKDVFAIFDKFMMQ--KNVIVGHSYGCCFAALLARQKPDYIHGLIMISGGAPIPLGPQLGIFGLPLCCLQCIKCILYREFLSRSFHKPNRNNLCHLTAITVPIFVLKNTLNGQRWDEGGVNFYSLIASPTLLIQGKKDRLISVEEVYFMKNTIKTSSLVLMENVGHMVMLESPDDLN-SLIAYFMEEF 259          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Cavefish
Match: abhd8b (abhydrolase domain containing 8 [Source:NCBI gene;Acc:103022221])

HSP 1 Score: 169.474 bits (428), Expect = 1.018e-46
Identity = 99/242 (40.91%), Postives = 133/242 (54.96%), Query Frame = 2
Query:  212 LFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILP--LFRSQAHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHF 922
            LFFIHGVGGS  IW  Q+ FF+ L YEVI  DL GHG SS  +    Y F  L++D   +F R+     +N ++GHSYG S  T++AH     V ++V+I+GG  + L +P +   F L  C L CL P +    L    AH G       K+  + NV S VL++M+ GQ W EG   YH++I VPTLL+HG  DKFV I E+  M   L L  L  + +  HM M++    VN  +   F
Sbjct:  156 LFFIHGVGGSLDIWGGQLDFFSQLGYEVIAPDLTGHGASSAPQITAAYTFYALAEDIRIIFKRYAKR--RNILIGHSYGVSFCTFLAHEYPEQVHKVVMINGGGPTAL-EPSLCSIFNLPTCVLHCLSPCLSWSFLMAGFAHQGTKEKKLLKEKNAFNVSSFVLRSMMSGQYWPEGDEVYHAEITVPTLLVHGMYDKFVPIQEDQRMAEILLLGFLKIIDEGSHMVMMECPETVNTLLHEFF 394          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Cavefish
Match: abhd8b (abhydrolase domain containing 8 [Source:NCBI gene;Acc:103022221])

HSP 1 Score: 169.474 bits (428), Expect = 1.018e-46
Identity = 99/242 (40.91%), Postives = 133/242 (54.96%), Query Frame = 2
Query:  212 LFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILP--LFRSQAHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHF 922
            LFFIHGVGGS  IW  Q+ FF+ L YEVI  DL GHG SS  +    Y F  L++D   +F R+     +N ++GHSYG S  T++AH     V ++V+I+GG  + L +P +   F L  C L CL P +    L    AH G       K+  + NV S VL++M+ GQ W EG   YH++I VPTLL+HG  DKFV I E+  M   L L  L  + +  HM M++    VN  +   F
Sbjct:  156 LFFIHGVGGSLDIWGGQLDFFSQLGYEVIAPDLTGHGASSAPQITAAYTFYALAEDIRIIFKRYAKR--RNILIGHSYGVSFCTFLAHEYPEQVHKVVMINGGGPTAL-EPSLCSIFNLPTCVLHCLSPCLSWSFLMAGFAHQGTKEKKLLKEKNAFNVSSFVLRSMMSGQYWPEGDEVYHAEITVPTLLVHGMYDKFVPIQEDQRMAEILLLGFLKIIDEGSHMVMMECPETVNTLLHEFF 394          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Cavefish
Match: abhd8b (abhydrolase domain containing 8 [Source:NCBI gene;Acc:103022221])

HSP 1 Score: 169.474 bits (428), Expect = 1.018e-46
Identity = 99/242 (40.91%), Postives = 133/242 (54.96%), Query Frame = 2
Query:  212 LFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILP--LFRSQAHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHF 922
            LFFIHGVGGS  IW  Q+ FF+ L YEVI  DL GHG SS  +    Y F  L++D   +F R+     +N ++GHSYG S  T++AH     V ++V+I+GG  + L +P +   F L  C L CL P +    L    AH G       K+  + NV S VL++M+ GQ W EG   YH++I VPTLL+HG  DKFV I E+  M   L L  L  + +  HM M++    VN  +   F
Sbjct:  156 LFFIHGVGGSLDIWGGQLDFFSQLGYEVIAPDLTGHGASSAPQITAAYTFYALAEDIRIIFKRYAKR--RNILIGHSYGVSFCTFLAHEYPEQVHKVVMINGGGPTAL-EPSLCSIFNLPTCVLHCLSPCLSWSFLMAGFAHQGTKEKKLLKEKNAFNVSSFVLRSMMSGQYWPEGDEVYHAEITVPTLLVHGMYDKFVPIQEDQRMAEILLLGFLKIIDEGSHMVMMECPETVNTLLHEFF 394          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Cavefish
Match: abhd8b (abhydrolase domain containing 8 [Source:NCBI gene;Acc:103022221])

HSP 1 Score: 169.474 bits (428), Expect = 1.018e-46
Identity = 99/242 (40.91%), Postives = 133/242 (54.96%), Query Frame = 2
Query:  212 LFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILP--LFRSQAHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHF 922
            LFFIHGVGGS  IW  Q+ FF+ L YEVI  DL GHG SS  +    Y F  L++D   +F R+     +N ++GHSYG S  T++AH     V ++V+I+GG  + L +P +   F L  C L CL P +    L    AH G       K+  + NV S VL++M+ GQ W EG   YH++I VPTLL+HG  DKFV I E+  M   L L  L  + +  HM M++    VN  +   F
Sbjct:  156 LFFIHGVGGSLDIWGGQLDFFSQLGYEVIAPDLTGHGASSAPQITAAYTFYALAEDIRIIFKRYAKR--RNILIGHSYGVSFCTFLAHEYPEQVHKVVMINGGGPTAL-EPSLCSIFNLPTCVLHCLSPCLSWSFLMAGFAHQGTKEKKLLKEKNAFNVSSFVLRSMMSGQYWPEGDEVYHAEITVPTLLVHGMYDKFVPIQEDQRMAEILLLGFLKIIDEGSHMVMMECPETVNTLLHEFF 394          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Cavefish
Match: abhd8a (protein ABHD8-like [Source:NCBI gene;Acc:103033441])

HSP 1 Score: 167.162 bits (422), Expect = 9.096e-46
Identity = 93/242 (38.43%), Postives = 131/242 (54.13%), Query Frame = 2
Query:  212 LFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILPLFRSQ--AHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHF 922
            LFFIHGVGGS  IW  Q+ FF+ L YEV+  DL GHG S+  +    Y F  L++D   +F R+  +  +N ++GHSYG S  T++AH     V ++V+I+GG  + L +P +   F L  C L CL P +   F     A  G       K+  + NV   VL+AM+ GQ W EG   YH+++ VP LL+HG  DKFV +DE+  M   L    L  + +  HM M++    VN  +   F
Sbjct:  175 LFFIHGVGGSLDIWGRQLDFFSRLGYEVVAPDLAGHGASTAPQIAAAYTFYALAEDLRAIFKRYARK--RNILIGHSYGVSFCTFLAHEYPEQVHKVVMINGGGPTAL-EPSLCSIFQLPSCVLHCLSPCLAWSFLKAGFARQGAKEKQLLKEGNAFNVSPFVLRAMMSGQYWPEGDEVYHAELTVPILLVHGLYDKFVPMDEDQRMAEILLFAFLKVIEEGSHMVMMECPETVNTLLHEFF 413          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Sea Lamprey
Match: abhd8b (abhydrolase domain containing 8b [Source:ZFIN;Acc:ZDB-GENE-130530-805])

HSP 1 Score: 150.984 bits (380), Expect = 8.189e-41
Identity = 90/237 (37.97%), Postives = 125/237 (52.74%), Query Frame = 2
Query:  212 LFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEV--TFVLSDCCLRCLHPLILPLFRSQAHYGCSSSNYEKKI-----SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVN 901
            LFF HGVGGS  +W+ Q+   + L YE +  DL GHG SS       Y F  L++D   +F R+     +N +VGHSYG S  T++AH     V ++VLI+GG  +PL +P V   F L  C L C+ P +   F             EK++     + +V  LVL+A + GQ W EG   YH+ + VPTL++HG  D+FV I+E+  M   L +  L  V    HM ML+    VN
Sbjct:  167 LFFFHGVGGSLEVWREQLRALSALGYECVAPDLLGHGGSSAPDAAAAYTFAALAEDMRFIFRRYAKR--RNVLVGHSYGVSFCTFLAHEYPEQVCKVVLINGGGPTPL-EPSVCSVFSLPSCVLHCISPCLAWAFLKAGFA--RQGTKEKQLLRDGNAFSVPPLVLRATMSGQYWPEGDELYHAALTVPTLIVHGLHDRFVPIEEDQRMAEILLIAFLKAVEDGSHMVMLECPEAVN 398          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Nematostella
Match: EDO37216 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGB6])

HSP 1 Score: 167.162 bits (422), Expect = 9.588e-49
Identity = 92/228 (40.35%), Postives = 132/228 (57.89%), Query Frame = 2
Query:  212 LFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILPLFRSQAHYGCS--SSNYEKKISINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQ 883
            +FF+HGVGG + +W  Q+ +F    YEV+  DL GHG SS  +D   YEF +L +D L +FDR+  +  +N +VGHSYG S  + V+  R  LV ++VLI+GG   PL  PE    F L    +    PL+L  F   A Y  S   ++ +K  + +    VLKA++ GQ W EG   +H+ + VP LLI+G +DKFVS+ EE  M  A+    L  + +AGHM M++
Sbjct:    3 IFFVHGVGGCAELWHEQLKYFCRAGYEVVAPDLLGHGGSSSPRDNAQYEFSELHQDVLCIFDRYARK--RNILVGHSYGSSFCSLVSAQRTRLVSKVVLIAGGGPIPL-RPESCHFFCLPVPVIALFKPLLLCSFERSAFYDRSKIKASSKKLKAFSAPLFVLKAVLAGQNWMEGDVSFHNSLMVPVLLIYGAQDKFVSLAEEKSMLEAVYASTLEVIPEAGHMVMME 227          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Medaka
Match: abhd8b (abhydrolase domain containing 8 [Source:NCBI gene;Acc:101170831])

HSP 1 Score: 178.333 bits (451), Expect = 1.955e-49
Identity = 106/281 (37.72%), Postives = 152/281 (54.09%), Query Frame = 2
Query:  134 SIDVDIYRRI-ACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEV--TFVLSDCCLRCLHPLILPLFRSQ--AHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHFHKDWSTVAPNSL 958
            ++ +D  R+I AC     KG    +  LFFIHGVGGS  IW++Q+ FF+ L YEVI  DL GHG SS  +    Y F  L++D   +F R+     +N ++GHSYG S  T++AH   + +++MV+I+GG  + L +P +   F L  C L CL PL+   F     A  G       K+  + NV S VL+AM+ GQ W EG   YH+++ VPTLL+HG  DKFV ++E+  M   L +  L  +    HM M++    +N  +  H    W    P  L
Sbjct:  224 TVVIDCERKISAC-----KGTHSDV-VLFFIHGVGGSLDIWRSQLDFFSRLGYEVIAPDLAGHGASSAPQIAAAYTFYALAEDMRIIFKRY--AKKRNILIGHSYGVSFCTFLAHEFPDQIQKMVMINGGGPTAL-EPSLCSIFNLPTCVLHCLSPLLAWSFLKAGFARQGAREKQLLKENNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPTLLVHGMHDKFVPVEEDQRMAEILLMAFLKVLEDGSHMVMMECPETINTLL--HEFLLWEPATPAPL 493          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Medaka
Match: abhd8b (abhydrolase domain containing 8 [Source:NCBI gene;Acc:101170831])

HSP 1 Score: 175.252 bits (443), Expect = 5.036e-49
Identity = 102/265 (38.49%), Postives = 148/265 (55.85%), Query Frame = 2
Query:  134 SIDVDIYRRI-ACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILPLFRSQ--AHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAM 910
            ++ +D  R+I AC     KG    +  LFFIHGVGGS  IW++Q+ FF+ L YEVI  DL GHG SS  +    Y F  L++D   +F R+     +N ++GHSYG S  T++AH   + +++MV+I+GG  + L +P +   F L  C L CL PL+   F     A  G       K+  + NV S VL+AM+ GQ W EG   YH+++ VPTLL+HG  DKFV ++E+  M   L +  L  +    HM M++    +N  +
Sbjct:  139 TVVIDCERKISAC-----KGTHSDV-VLFFIHGVGGSLDIWRSQLDFFSRLGYEVIAPDLAGHGASSAPQIAAAYTFYALAEDMRIIFKRY--AKKRNILIGHSYGVSFCTFLAHEFPDQIQKMVMINGGGPTAL-EPSLCSIFNLPTCVLHCLSPLLAWSFLKAGFARQGAREKQLLKENNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPTLLVHGMHDKFVPVEEDQRMAEILLMAFLKVLEDGSHMVMMECPETINTLL 394          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Medaka
Match: abhd8a (protein ABHD8 [Source:NCBI gene;Acc:101162784])

HSP 1 Score: 168.703 bits (426), Expect = 2.189e-46
Identity = 93/242 (38.43%), Postives = 133/242 (54.96%), Query Frame = 2
Query:  212 LFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILPLFRSQ--AHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHF 922
            LFF+HGVGGS  IW +Q+ FF+ L YEVI  DL GHG S+  +    Y F  L++D   +F R+  +  +N ++GHSYG S  T++AH   +LV ++V+I+GG  + L +P +   F L  C L CL P +   F     A  G       K+  + NV   VL+AM+ GQ W EG   YH+++  P LL+HG  DKFV +DE+  M   L    L  + +  HM M++    VN  +   F
Sbjct:  185 LFFVHGVGGSLDIWSSQLDFFSRLGYEVIAPDLAGHGASTAPQIAAAYTFYALAEDLRAIFKRYARK--RNILIGHSYGVSFCTFLAHEYPDLVHKVVMINGGGPTAL-EPSLCSIFQLPSCVLHCLSPCLAWSFLKAGFARQGAKEKQLLKQGNAFNVSPFVLRAMMSGQYWPEGDEVYHAELTTPILLVHGMCDKFVPVDEDQRMAEILLFAFLKVIEEGSHMVMMECPDTVNTLLHEFF 423          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Medaka
Match: abhd8a (protein ABHD8 [Source:NCBI gene;Acc:101162784])

HSP 1 Score: 168.703 bits (426), Expect = 3.737e-46
Identity = 93/242 (38.43%), Postives = 133/242 (54.96%), Query Frame = 2
Query:  212 LFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVT--FVLSDCCLRCLHPLILPLFRSQ--AHYGCSSSNYEKKI-SINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHF 922
            LFF+HGVGGS  IW +Q+ FF+ L YEVI  DL GHG S+  +    Y F  L++D   +F R+  +  +N ++GHSYG S  T++AH   +LV ++V+I+GG  + L +P +   F L  C L CL P +   F     A  G       K+  + NV   VL+AM+ GQ W EG   YH+++  P LL+HG  DKFV +DE+  M   L    L  + +  HM M++    VN  +   F
Sbjct:  211 LFFVHGVGGSLDIWSSQLDFFSRLGYEVIAPDLAGHGASTAPQIAAAYTFYALAEDLRAIFKRYARK--RNILIGHSYGVSFCTFLAHEYPDLVHKVVMINGGGPTAL-EPSLCSIFQLPSCVLHCLSPCLAWSFLKAGFARQGAKEKQLLKQGNAFNVSPFVLRAMMSGQYWPEGDEVYHAELTTPILLVHGMCDKFVPVDEDQRMAEILLFAFLKVIEEGSHMVMMECPDTVNTLLHEFF 449          
BLAST of Abhydrolase domain containing 8b vs. Ensembl Medaka
Match: ENSORLT00000002022.2 (epoxide hydrolase 2 [Source:NCBI gene;Acc:101157276])

HSP 1 Score: 53.1434 bits (126), Expect = 4.688e-7
Identity = 42/156 (26.92%), Postives = 68/156 (43.59%), Query Frame = 2
Query:   53 ILNEYMGNQIVKGLEFTSTEFVEYDDISIDVDIYRRIACHRFK--RKGVSKKLEKL------FFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVK 496
            IL E +   +VK  EFT  +  E  D S          CH +   R GV     ++         HG   S + W+ QI       + V+ +D+ G+G S+   DIE++   +L KD +T  D+  +   Q  +VGH +G ++   +A      V+
Sbjct:  209 ILVESLDAALVKLSEFTGVKAEE--DESPPPFCSPDEVCHGYVTIRTGVRSHFVEMGCGPPVLLCHGFPESWYSWRFQIPALAAAGFRVLALDMKGYGESTAPPDIEEFSQEQLCKDLITFLDKMAIP--QVTLVGHDWGGALVWSMAQFHPERVR 360          
BLAST of Abhydrolase domain containing 8b vs. Planmine SMEST
Match: SMESG000041066.1 (SMESG000041066.1)

HSP 1 Score: 803.512 bits (2074), Expect = 0.000e+0
Identity = 386/387 (99.74%), Postives = 387/387 (100.00%), Query Frame = 2
Query:   68 MGNQIVKGLEFTSTEFVEYDDISIDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVTFVLSDCCLRCLHPLILPLFRSQAHYGCSSSNYEKKISINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHFHKDWSTVAPNSLSNGDQFLGSCSVIDLSIPEKSQNDAKISPKILMHRKTMPIGLLVRRKSTQLSLKRALSMRSSFQNFENNVSQEITVQETISEEVTSSGFL 1228
            MGNQIVKGLEFTSTEFVEYDDISIDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVTFVLSDCCLRCLHPLILPLFRSQAHYGCSSSNYEKKISINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHFHKDWSTVAPN+LSNGDQFLGSCSVIDLSIPEKSQNDAKISPKILMHRKTMPIGLLVRRKSTQLSLKRALSMRSSFQNFENNVSQEITVQETISEEVTSSGFL
Sbjct:    1 MGNQIVKGLEFTSTEFVEYDDISIDVDIYRRIACHRFKRKGVSKKLEKLFFIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCKLSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISGGSSSPLGDPEVTFVLSDCCLRCLHPLILPLFRSQAHYGCSSSNYEKKISINVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDMQHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHFHKDWSTVAPNNLSNGDQFLGSCSVIDLSIPEKSQNDAKISPKILMHRKTMPIGLLVRRKSTQLSLKRALSMRSSFQNFENNVSQEITVQETISEEVTSSGFL 387          
The following BLAST results are available for this feature:
BLAST of Abhydrolase domain containing 8b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABHD81.410e-4737.50abhydrolase domain containing 8 [Source:HGNC Symbo... [more]
EPHX21.827e-632.53epoxide hydrolase 2 [Source:HGNC Symbol;Acc:HGNC:3... [more]
EPHX21.905e-632.53epoxide hydrolase 2 [Source:HGNC Symbol;Acc:HGNC:3... [more]
EPHX22.164e-632.53epoxide hydrolase 2 [Source:HGNC Symbol;Acc:HGNC:3... [more]
EPHX22.363e-632.53epoxide hydrolase 2 [Source:HGNC Symbol;Acc:HGNC:3... [more]
back to top
BLAST of Abhydrolase domain containing 8b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Abhydrolase domain containing 8b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Abhydrolase domain containing 8b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX279524.19.024e-4935.60abhydrolase domain containing 8b [Source:NCBI gene... [more]
abhd8b9.702e-4935.60abhydrolase domain containing 8b [Source:ZFIN;Acc:... [more]
BX279524.19.955e-4935.60abhydrolase domain containing 8b [Source:NCBI gene... [more]
BX279524.11.091e-4835.60abhydrolase domain containing 8b [Source:NCBI gene... [more]
abhd8b1.184e-4835.60abhydrolase domain containing 8b [Source:ZFIN;Acc:... [more]
back to top
BLAST of Abhydrolase domain containing 8b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
usp131.278e-4837.74ubiquitin specific peptidase 13 [Source:Xenbase;Ac... [more]
back to top
BLAST of Abhydrolase domain containing 8b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Abhd82.736e-4837.93abhydrolase domain containing 8 [Source:MGI Symbol... [more]
back to top
BLAST of Abhydrolase domain containing 8b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AX59|ABHD8_XENLA1.351e-4737.55Protein ABHD8 OS=Xenopus laevis OX=8355 GN=abhd8 P... [more]
sp|Q8R0P8|ABHD8_MOUSE1.914e-4737.93Protein ABHD8 OS=Mus musculus OX=10090 GN=Abhd8 PE... [more]
sp|Q17QP1|ABHD8_BOVIN2.250e-4737.93Protein ABHD8 OS=Bos taurus OX=9913 GN=ABHD8 PE=2 ... [more]
sp|Q96I13|ABHD8_HUMAN6.770e-4737.50Protein ABHD8 OS=Homo sapiens OX=9606 GN=ABHD8 PE=... [more]
sp|Q4R584|ABHD8_MACFA7.275e-4737.93Protein ABHD8 OS=Macaca fascicularis OX=9541 GN=AB... [more]
back to top
BLAST of Abhydrolase domain containing 8b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M6TVJ32.078e-5435.16AB hydrolase-1 domain-containing protein OS=Pocill... [more]
A0A2B4SYK51.197e-5336.10Abhydrolase domain-containing protein 8 OS=Styloph... [more]
R7VHZ74.064e-5341.74AB hydrolase-1 domain-containing protein (Fragment... [more]
V4BFA35.441e-5340.17AB hydrolase-1 domain-containing protein (Fragment... [more]
T1G7461.577e-5038.59AB hydrolase-1 domain-containing protein OS=Helobd... [more]
back to top
BLAST of Abhydrolase domain containing 8b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abhd8b1.018e-4640.91abhydrolase domain containing 8 [Source:NCBI gene;... [more]
abhd8b1.018e-4640.91abhydrolase domain containing 8 [Source:NCBI gene;... [more]
abhd8b1.018e-4640.91abhydrolase domain containing 8 [Source:NCBI gene;... [more]
abhd8b1.018e-4640.91abhydrolase domain containing 8 [Source:NCBI gene;... [more]
abhd8a9.096e-4638.43protein ABHD8-like [Source:NCBI gene;Acc:103033441... [more]
back to top
BLAST of Abhydrolase domain containing 8b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
abhd8b8.189e-4137.97abhydrolase domain containing 8b [Source:ZFIN;Acc:... [more]
back to top
BLAST of Abhydrolase domain containing 8b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Abhydrolase domain containing 8b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO372169.588e-4940.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Abhydrolase domain containing 8b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abhd8b1.955e-4937.72abhydrolase domain containing 8 [Source:NCBI gene;... [more]
abhd8b5.036e-4938.49abhydrolase domain containing 8 [Source:NCBI gene;... [more]
abhd8a2.189e-4638.43protein ABHD8 [Source:NCBI gene;Acc:101162784][more]
abhd8a3.737e-4638.43protein ABHD8 [Source:NCBI gene;Acc:101162784][more]
ENSORLT00000002022.24.688e-726.92epoxide hydrolase 2 [Source:NCBI gene;Acc:10115727... [more]
back to top
BLAST of Abhydrolase domain containing 8b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000041066.10.000e+099.74SMESG000041066.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006816 ID=SMED30006816|Name=Abhydrolase domain containing 8b|organism=Schmidtea mediterranea sexual|type=transcript|length=1511bp
CAATTTAATTAGTATAGTTACTAAAACACATTATTATTAACTATTGTATT
TGATTTTAAATGAATATATGGGAAATCAAATTGTGAAAGGATTAGAGTTT
ACTAGCACGGAGTTTGTAGAGTACGATGACATATCTATTGATGTAGATAT
TTATAGACGAATTGCCTGTCATCGATTTAAAAGGAAAGGAGTTTCAAAAA
AATTGGAAAAATTGTTTTTCATTCACGGTGTTGGAGGTAGTAGTCATATT
TGGCAGAATCAAATAAGTTTTTTCACGAATTTGGATTATGAAGTAATATT
AATAGATTTATTCGGCCATGGATTAAGTAGTAAAAGCAAAGATATCGAAG
ATTACGAATTCTGTAAATTGTCTAAAGATTGTTTGACTGTATTTGATAGA
TTTCGCTTAGAAAGCGGTCAAAATAATATTGTTGGTCATTCATATGGGTG
TTCTATGGCTACGTATGTTGCTCATAACCGTCAGAACTTAGTGAAAAGGA
TGGTCTTAATTAGCGGTGGATCATCGTCCCCGTTAGGTGATCCTGAAGTA
ACATTTGTACTATCAGATTGCTGTCTCCGGTGCTTGCATCCATTGATATT
ACCGTTGTTTCGAAGTCAAGCACATTATGGCTGTTCGTCAAGCAATTACG
AGAAAAAGATTTCAATTAATGTCGACAGTTTGGTATTAAAAGCTATGATA
GTCGGTCAAGTCTGGGATGAAGGCGGTCCTTTTTATCATAGTCAGATTTT
TGTACCAACTCTTTTAATTCATGGCAAAAGAGATAAATTTGTTTCAATTG
ATGAAGAAACAGATATGCAACATGCTTTACCTCTATGCAATTTGCATACA
GTGCGAAAAGCTGGCCACATGTCAATGTTGCAAGCCTCGGCCGAGGTTAA
TGCAGCAATGATTGCCCATTTTCACAAAGATTGGAGTACGGTAGCACCAA
ATAGTTTATCAAATGGAGATCAATTCCTTGGATCATGCTCTGTGATTGAT
CTTTCAATTCCTGAGAAATCACAAAATGATGCTAAAATTTCCCCAAAAAT
TTTGATGCATCGTAAAACAATGCCTATCGGCCTATTAGTCAGGCGAAAAT
CCACTCAGTTGTCATTAAAAAGAGCACTTTCAATGAGGTCCAGTTTTCAA
AATTTTGAAAATAATGTTTCCCAGGAAATAACTGTCCAGGAAACCATTTC
AGAAGAAGTCACTAGTTCTGGATTTTTGTAGTGTTTTTGTTTCCAAGATT
ATCCTAGCATTTTTTGTTCTCATAACTTTTTATTTTCTTTAACATTTATA
GTTCTTTTTTTTATAAAATGTGATTTGTTTTTTCCGAAAACTTATTTCTA
TTCAATATGTTTCTATTATTTTCTGTAAAAAAGTGTCTCACAAAAACCCA
ATTGTACCGAGAATAGAGAAGCCTTGTGAAGATATGGAGGAGTGAAGAAG
GTTTACGTAAATATTTTTTACAATGAAATAAAATTATGCATTGAAAAAAA
AAGATCGGAAG
back to top

protein sequence of SMED30006816-orf-1

>SMED30006816-orf-1 ID=SMED30006816-orf-1|Name=SMED30006816-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=388bp
MGNQIVKGLEFTSTEFVEYDDISIDVDIYRRIACHRFKRKGVSKKLEKLF
FIHGVGGSSHIWQNQISFFTNLDYEVILIDLFGHGLSSKSKDIEDYEFCK
LSKDCLTVFDRFRLESGQNNIVGHSYGCSMATYVAHNRQNLVKRMVLISG
GSSSPLGDPEVTFVLSDCCLRCLHPLILPLFRSQAHYGCSSSNYEKKISI
NVDSLVLKAMIVGQVWDEGGPFYHSQIFVPTLLIHGKRDKFVSIDEETDM
QHALPLCNLHTVRKAGHMSMLQASAEVNAAMIAHFHKDWSTVAPNSLSNG
DQFLGSCSVIDLSIPEKSQNDAKISPKILMHRKTMPIGLLVRRKSTQLSL
KRALSMRSSFQNFENNVSQEITVQETISEEVTSSGFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000073AB_hydrolase_1
IPR029058AB_hydrolase
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000073Alpha/beta hydrolase fold-1PRINTSPR00111ABHYDROLASEcoord: 121..134
score: 33.0
coord: 73..88
score: 42.24
coord: 231..245
score: 38.16
coord: 135..148
score: 26.85
IPR000073Alpha/beta hydrolase fold-1PFAMPF00561Abhydrolase_1coord: 49..157
e-value: 2.5E-19
score: 69.9
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 192..291
e-value: 6.8E-11
score: 44.1
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 13..167
e-value: 2.0E-24
score: 88.8
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 31..287
NoneNo IPR availablePANTHERPTHR42886:SF1PROTEIN ABHD8coord: 23..286
NoneNo IPR availablePANTHERPTHR42886FAMILY NOT NAMEDcoord: 23..286